(data stored in ACNUC7421 zone)

EMBL: CP000094

ID   CP000094; SV 2; circular; genomic DNA; STD; PRO; 6438405 BP.
XX
AC   CP000094; AAAT03000000-AAAT03000024;
XX
PR   Project:PRJNA12;
XX
DT   10-OCT-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Pseudomonas fluorescens Pf0-1, complete genome.
XX
KW   .
XX
OS   Pseudomonas fluorescens Pf0-1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-6438405
RX   DOI; 10.1186/gb-2009-10-5-r51.
RX   PUBMED; 19432983.
RA   Silby M.W., Cerdeno-Tarraga A.M., Vernikos G.S., Giddens S.R.,
RA   Jackson R.W., Preston G.M., Zhang X.X., Moon C.D., Gehrig S.M.,
RA   Godfrey S.A., Knight C.G., Malone J.G., Robinson Z., Spiers A.J.,
RA   Harris S., Challis G.L., Yaxley A.M., Harris D., Seeger K., Murphy L.,
RA   Rutter S., Squares R., Quail M.A., Saunders E., Mavromatis K.,
RA   Brettin T.S., Bentley S.D., Hothersall J., Stephens E., Thomas C.M.,
RA   Parkhill J., Levy S.B., Rainey P.B., Thomson N.R.;
RT   "Genomic and genetic analyses of diversity and plant interactions of
RT   Pseudomonas fluorescens";
RL   Genome Biol. 10(5):R51-R51(2009).
XX
RN   [2]
RP   1-6438405
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Saunders E.H., Schmutz J., Larimer F.,
RA   Land M., Anderson I., Richardson P.;
RT   ;
RL   Submitted (08-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-6438405
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Israni S., Pitluck S., Saunders E.H., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Silby M., Richardson P.;
RT   ;
RL   Submitted (15-JUL-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c73b47fa9b00266c540e6fe0f907b4df.
DR   BioSample; SAMN02598267.
DR   EnsemblGenomes-Gn; EBG00001000280.
DR   EnsemblGenomes-Gn; EBG00001000282.
DR   EnsemblGenomes-Gn; EBG00001000284.
DR   EnsemblGenomes-Gn; EBG00001000286.
DR   EnsemblGenomes-Gn; EBG00001000287.
DR   EnsemblGenomes-Gn; EBG00001000288.
DR   EnsemblGenomes-Gn; EBG00001000289.
DR   EnsemblGenomes-Gn; EBG00001000291.
DR   EnsemblGenomes-Gn; EBG00001000293.
DR   EnsemblGenomes-Gn; EBG00001000295.
DR   EnsemblGenomes-Gn; EBG00001000296.
DR   EnsemblGenomes-Gn; EBG00001000297.
DR   EnsemblGenomes-Gn; EBG00001000298.
DR   EnsemblGenomes-Gn; EBG00001000299.
DR   EnsemblGenomes-Gn; EBG00001000301.
DR   EnsemblGenomes-Gn; EBG00001000303.
DR   EnsemblGenomes-Gn; EBG00001000305.
DR   EnsemblGenomes-Gn; EBG00001000308.
DR   EnsemblGenomes-Gn; EBG00001000310.
DR   EnsemblGenomes-Gn; EBG00001000312.
DR   EnsemblGenomes-Gn; EBG00001000315.
DR   EnsemblGenomes-Gn; EBG00001000317.
DR   EnsemblGenomes-Gn; EBG00001000319.
DR   EnsemblGenomes-Gn; EBG00001000321.
DR   EnsemblGenomes-Gn; EBG00001000322.
DR   EnsemblGenomes-Gn; EBG00001000325.
DR   EnsemblGenomes-Gn; EBG00001000328.
DR   EnsemblGenomes-Gn; EBG00001000329.
DR   EnsemblGenomes-Gn; EBG00001000330.
DR   EnsemblGenomes-Gn; EBG00001000331.
DR   EnsemblGenomes-Gn; EBG00001000332.
DR   EnsemblGenomes-Gn; EBG00001000333.
DR   EnsemblGenomes-Gn; EBG00001000335.
DR   EnsemblGenomes-Gn; EBG00001000336.
DR   EnsemblGenomes-Gn; EBG00001000337.
DR   EnsemblGenomes-Gn; EBG00001000338.
DR   EnsemblGenomes-Gn; EBG00001000339.
DR   EnsemblGenomes-Gn; EBG00001000341.
DR   EnsemblGenomes-Gn; EBG00001000343.
DR   EnsemblGenomes-Gn; EBG00001000346.
DR   EnsemblGenomes-Gn; EBG00001000348.
DR   EnsemblGenomes-Gn; EBG00001000349.
DR   EnsemblGenomes-Gn; EBG00001000350.
DR   EnsemblGenomes-Gn; EBG00001000352.
DR   EnsemblGenomes-Gn; EBG00001000355.
DR   EnsemblGenomes-Gn; EBG00001000360.
DR   EnsemblGenomes-Gn; EBG00001000364.
DR   EnsemblGenomes-Gn; EBG00001000366.
DR   EnsemblGenomes-Gn; EBG00001000368.
DR   EnsemblGenomes-Gn; EBG00001000370.
DR   EnsemblGenomes-Gn; EBG00001000372.
DR   EnsemblGenomes-Gn; EBG00001000374.
DR   EnsemblGenomes-Gn; EBG00001000376.
DR   EnsemblGenomes-Gn; EBG00001000377.
DR   EnsemblGenomes-Gn; EBG00001000378.
DR   EnsemblGenomes-Gn; EBG00001000379.
DR   EnsemblGenomes-Gn; EBG00001000381.
DR   EnsemblGenomes-Gn; EBG00001000383.
DR   EnsemblGenomes-Gn; EBG00001000386.
DR   EnsemblGenomes-Gn; EBG00001000388.
DR   EnsemblGenomes-Gn; EBG00001000391.
DR   EnsemblGenomes-Gn; EBG00001000392.
DR   EnsemblGenomes-Gn; EBG00001000393.
DR   EnsemblGenomes-Gn; EBG00001000394.
DR   EnsemblGenomes-Gn; EBG00001000395.
DR   EnsemblGenomes-Gn; EBG00001000396.
DR   EnsemblGenomes-Gn; EBG00001000397.
DR   EnsemblGenomes-Gn; EBG00001000398.
DR   EnsemblGenomes-Gn; EBG00001000399.
DR   EnsemblGenomes-Gn; EBG00001000402.
DR   EnsemblGenomes-Gn; EBG00001000405.
DR   EnsemblGenomes-Gn; EBG00001000407.
DR   EnsemblGenomes-Gn; EBG00001000414.
DR   EnsemblGenomes-Gn; EBG00001000416.
DR   EnsemblGenomes-Gn; EBG00001000418.
DR   EnsemblGenomes-Gn; EBG00001000420.
DR   EnsemblGenomes-Gn; EBG00001000422.
DR   EnsemblGenomes-Gn; EBG00001000424.
DR   EnsemblGenomes-Gn; EBG00001000425.
DR   EnsemblGenomes-Gn; EBG00001000426.
DR   EnsemblGenomes-Gn; EBG00001000427.
DR   EnsemblGenomes-Gn; EBG00001000428.
DR   EnsemblGenomes-Gn; EBG00001000429.
DR   EnsemblGenomes-Gn; EBG00001000430.
DR   EnsemblGenomes-Gn; EBG00001000431.
DR   EnsemblGenomes-Gn; EBG00001000432.
DR   EnsemblGenomes-Gn; EBG00001000433.
DR   EnsemblGenomes-Gn; EBG00001000434.
DR   EnsemblGenomes-Gn; EBG00001000435.
DR   EnsemblGenomes-Gn; EBG00001000436.
DR   EnsemblGenomes-Gn; EBG00001000437.
DR   EnsemblGenomes-Gn; EBG00001000438.
DR   EnsemblGenomes-Gn; EBG00001000439.
DR   EnsemblGenomes-Gn; EBG00001000440.
DR   EnsemblGenomes-Gn; EBG00001000441.
DR   EnsemblGenomes-Gn; EBG00001000442.
DR   EnsemblGenomes-Gn; EBG00001000443.
DR   EnsemblGenomes-Gn; EBG00001000444.
DR   EnsemblGenomes-Gn; EBG00001000446.
DR   EnsemblGenomes-Gn; EBG00001000449.
DR   EnsemblGenomes-Gn; EBG00001000454.
DR   EnsemblGenomes-Gn; EBG00001000457.
DR   EnsemblGenomes-Gn; EBG00001000460.
DR   EnsemblGenomes-Gn; EBG00001000463.
DR   EnsemblGenomes-Gn; EBG00001000465.
DR   EnsemblGenomes-Gn; EBG00001000467.
DR   EnsemblGenomes-Gn; EBG00001000469.
DR   EnsemblGenomes-Gn; EBG00001000472.
DR   EnsemblGenomes-Gn; EBG00001000475.
DR   EnsemblGenomes-Gn; EBG00001000479.
DR   EnsemblGenomes-Gn; EBG00001000481.
DR   EnsemblGenomes-Gn; EBG00001000483.
DR   EnsemblGenomes-Gn; EBG00001000485.
DR   EnsemblGenomes-Gn; EBG00001000487.
DR   EnsemblGenomes-Gn; EBG00001000489.
DR   EnsemblGenomes-Gn; EBG00001000492.
DR   EnsemblGenomes-Gn; EBG00001000495.
DR   EnsemblGenomes-Gn; EBG00001000497.
DR   EnsemblGenomes-Gn; EBG00001000498.
DR   EnsemblGenomes-Gn; EBG00001000499.
DR   EnsemblGenomes-Gn; EBG00001000500.
DR   EnsemblGenomes-Gn; EBG00001000501.
DR   EnsemblGenomes-Gn; EBG00001000503.
DR   EnsemblGenomes-Gn; EBG00001000506.
DR   EnsemblGenomes-Gn; EBG00001000508.
DR   EnsemblGenomes-Gn; EBG00001000510.
DR   EnsemblGenomes-Gn; EBG00001000512.
DR   EnsemblGenomes-Gn; EBG00001000513.
DR   EnsemblGenomes-Gn; EBG00001000514.
DR   EnsemblGenomes-Gn; EBG00001000515.
DR   EnsemblGenomes-Gn; EBG00001000516.
DR   EnsemblGenomes-Gn; EBG00001000517.
DR   EnsemblGenomes-Gn; EBG00001000519.
DR   EnsemblGenomes-Gn; EBG00001000521.
DR   EnsemblGenomes-Gn; EBG00001000523.
DR   EnsemblGenomes-Gn; EBG00001000525.
DR   EnsemblGenomes-Gn; EBG00001000527.
DR   EnsemblGenomes-Gn; EBG00001000529.
DR   EnsemblGenomes-Gn; EBG00001000531.
DR   EnsemblGenomes-Gn; EBG00001000532.
DR   EnsemblGenomes-Gn; EBG00001000533.
DR   EnsemblGenomes-Gn; EBG00001000534.
DR   EnsemblGenomes-Gn; EBG00001000535.
DR   EnsemblGenomes-Gn; EBG00001000536.
DR   EnsemblGenomes-Gn; EBG00001000538.
DR   EnsemblGenomes-Gn; EBG00001000540.
DR   EnsemblGenomes-Gn; EBG00001000542.
DR   EnsemblGenomes-Gn; EBG00001000545.
DR   EnsemblGenomes-Gn; EBG00001000548.
DR   EnsemblGenomes-Gn; EBG00001000550.
DR   EnsemblGenomes-Gn; EBG00001000554.
DR   EnsemblGenomes-Gn; EBG00001000558.
DR   EnsemblGenomes-Gn; EBG00001000562.
DR   EnsemblGenomes-Gn; EBG00001000567.
DR   EnsemblGenomes-Gn; EBG00001000572.
DR   EnsemblGenomes-Gn; EBG00001000575.
DR   EnsemblGenomes-Gn; EBG00001000580.
DR   EnsemblGenomes-Gn; EBG00001000583.
DR   EnsemblGenomes-Gn; EBG00001000585.
DR   EnsemblGenomes-Gn; EBG00001000587.
DR   EnsemblGenomes-Gn; EBG00001000590.
DR   EnsemblGenomes-Gn; EBG00001000592.
DR   EnsemblGenomes-Gn; EBG00001000595.
DR   EnsemblGenomes-Gn; EBG00001000599.
DR   EnsemblGenomes-Gn; Pfl01_R0001.
DR   EnsemblGenomes-Gn; Pfl01_R0002.
DR   EnsemblGenomes-Gn; Pfl01_R0003.
DR   EnsemblGenomes-Gn; Pfl01_R0004.
DR   EnsemblGenomes-Gn; Pfl01_R0005.
DR   EnsemblGenomes-Gn; Pfl01_R0006.
DR   EnsemblGenomes-Gn; Pfl01_R0007.
DR   EnsemblGenomes-Gn; Pfl01_R0008.
DR   EnsemblGenomes-Gn; Pfl01_R0009.
DR   EnsemblGenomes-Gn; Pfl01_R0010.
DR   EnsemblGenomes-Gn; Pfl01_R0011.
DR   EnsemblGenomes-Gn; Pfl01_R0012.
DR   EnsemblGenomes-Gn; Pfl01_R0013.
DR   EnsemblGenomes-Gn; Pfl01_R0014.
DR   EnsemblGenomes-Gn; Pfl01_R0016.
DR   EnsemblGenomes-Gn; Pfl01_R0017.
DR   EnsemblGenomes-Gn; Pfl01_R0018.
DR   EnsemblGenomes-Gn; Pfl01_R0019.
DR   EnsemblGenomes-Gn; Pfl01_R0020.
DR   EnsemblGenomes-Gn; Pfl01_R0021.
DR   EnsemblGenomes-Gn; Pfl01_R0022.
DR   EnsemblGenomes-Gn; Pfl01_R0023.
DR   EnsemblGenomes-Gn; Pfl01_R0024.
DR   EnsemblGenomes-Gn; Pfl01_R0025.
DR   EnsemblGenomes-Gn; Pfl01_R0026.
DR   EnsemblGenomes-Gn; Pfl01_R0027.
DR   EnsemblGenomes-Gn; Pfl01_R0028.
DR   EnsemblGenomes-Gn; Pfl01_R0029.
DR   EnsemblGenomes-Gn; Pfl01_R0030.
DR   EnsemblGenomes-Gn; Pfl01_R0031.
DR   EnsemblGenomes-Gn; Pfl01_R0032.
DR   EnsemblGenomes-Gn; Pfl01_R0033.
DR   EnsemblGenomes-Gn; Pfl01_R0034.
DR   EnsemblGenomes-Gn; Pfl01_R0035.
DR   EnsemblGenomes-Gn; Pfl01_R0036.
DR   EnsemblGenomes-Gn; Pfl01_R0037.
DR   EnsemblGenomes-Gn; Pfl01_R0038.
DR   EnsemblGenomes-Gn; Pfl01_R0039.
DR   EnsemblGenomes-Gn; Pfl01_R0040.
DR   EnsemblGenomes-Gn; Pfl01_R0041.
DR   EnsemblGenomes-Gn; Pfl01_R0042.
DR   EnsemblGenomes-Gn; Pfl01_R0043.
DR   EnsemblGenomes-Gn; Pfl01_R0044.
DR   EnsemblGenomes-Gn; Pfl01_R0045.
DR   EnsemblGenomes-Gn; Pfl01_R0046.
DR   EnsemblGenomes-Gn; Pfl01_R0047.
DR   EnsemblGenomes-Gn; Pfl01_R0048.
DR   EnsemblGenomes-Gn; Pfl01_R0049.
DR   EnsemblGenomes-Gn; Pfl01_R0050.
DR   EnsemblGenomes-Gn; Pfl01_R0051.
DR   EnsemblGenomes-Gn; Pfl01_R0052.
DR   EnsemblGenomes-Gn; Pfl01_R0053.
DR   EnsemblGenomes-Gn; Pfl01_R0054.
DR   EnsemblGenomes-Gn; Pfl01_R0055.
DR   EnsemblGenomes-Gn; Pfl01_R0056.
DR   EnsemblGenomes-Gn; Pfl01_R0057.
DR   EnsemblGenomes-Gn; Pfl01_R0058.
DR   EnsemblGenomes-Gn; Pfl01_R0059.
DR   EnsemblGenomes-Gn; Pfl01_R0060.
DR   EnsemblGenomes-Gn; Pfl01_R0061.
DR   EnsemblGenomes-Gn; Pfl01_R0062.
DR   EnsemblGenomes-Gn; Pfl01_R0063.
DR   EnsemblGenomes-Gn; Pfl01_R0064.
DR   EnsemblGenomes-Gn; Pfl01_R0065.
DR   EnsemblGenomes-Gn; Pfl01_R0066.
DR   EnsemblGenomes-Gn; Pfl01_R0067.
DR   EnsemblGenomes-Gn; Pfl01_R0068.
DR   EnsemblGenomes-Gn; Pfl01_R0069.
DR   EnsemblGenomes-Gn; Pfl01_R0070.
DR   EnsemblGenomes-Gn; Pfl01_R0071.
DR   EnsemblGenomes-Gn; Pfl01_R0072.
DR   EnsemblGenomes-Gn; Pfl01_R0073.
DR   EnsemblGenomes-Gn; Pfl01_R0074.
DR   EnsemblGenomes-Gn; Pfl01_R0075.
DR   EnsemblGenomes-Gn; Pfl01_R0076.
DR   EnsemblGenomes-Gn; Pfl01_R0077.
DR   EnsemblGenomes-Gn; Pfl01_R0078.
DR   EnsemblGenomes-Gn; Pfl01_R0079.
DR   EnsemblGenomes-Gn; Pfl01_R0080.
DR   EnsemblGenomes-Gn; Pfl01_R0081.
DR   EnsemblGenomes-Gn; Pfl01_R0082.
DR   EnsemblGenomes-Gn; Pfl01_R0083.
DR   EnsemblGenomes-Gn; Pfl01_R0084.
DR   EnsemblGenomes-Gn; Pfl01_R0085.
DR   EnsemblGenomes-Gn; Pfl01_R0086.
DR   EnsemblGenomes-Gn; Pfl01_R0087.
DR   EnsemblGenomes-Gn; Pfl01_R0088.
DR   EnsemblGenomes-Gn; Pfl01_R0089.
DR   EnsemblGenomes-Gn; Pfl01_R0090.
DR   EnsemblGenomes-Gn; Pfl01_R0091.
DR   EnsemblGenomes-Gn; Pfl01_R0092.
DR   EnsemblGenomes-Gn; Pfl01_R0093.
DR   EnsemblGenomes-Gn; Pfl01_R0094.
DR   EnsemblGenomes-Gn; Pfl01_R0095.
DR   EnsemblGenomes-Tr; EBT00001528727.
DR   EnsemblGenomes-Tr; EBT00001528728.
DR   EnsemblGenomes-Tr; EBT00001528729.
DR   EnsemblGenomes-Tr; EBT00001528730.
DR   EnsemblGenomes-Tr; EBT00001528731.
DR   EnsemblGenomes-Tr; EBT00001528732.
DR   EnsemblGenomes-Tr; EBT00001528733.
DR   EnsemblGenomes-Tr; EBT00001528734.
DR   EnsemblGenomes-Tr; EBT00001528735.
DR   EnsemblGenomes-Tr; EBT00001528736.
DR   EnsemblGenomes-Tr; EBT00001528737.
DR   EnsemblGenomes-Tr; EBT00001528738.
DR   EnsemblGenomes-Tr; EBT00001528739.
DR   EnsemblGenomes-Tr; EBT00001528741.
DR   EnsemblGenomes-Tr; EBT00001528743.
DR   EnsemblGenomes-Tr; EBT00001528745.
DR   EnsemblGenomes-Tr; EBT00001528746.
DR   EnsemblGenomes-Tr; EBT00001528748.
DR   EnsemblGenomes-Tr; EBT00001528749.
DR   EnsemblGenomes-Tr; EBT00001528752.
DR   EnsemblGenomes-Tr; EBT00001528754.
DR   EnsemblGenomes-Tr; EBT00001528755.
DR   EnsemblGenomes-Tr; EBT00001528757.
DR   EnsemblGenomes-Tr; EBT00001528760.
DR   EnsemblGenomes-Tr; EBT00001528762.
DR   EnsemblGenomes-Tr; EBT00001528764.
DR   EnsemblGenomes-Tr; EBT00001528767.
DR   EnsemblGenomes-Tr; EBT00001528770.
DR   EnsemblGenomes-Tr; EBT00001528772.
DR   EnsemblGenomes-Tr; EBT00001528774.
DR   EnsemblGenomes-Tr; EBT00001528776.
DR   EnsemblGenomes-Tr; EBT00001528778.
DR   EnsemblGenomes-Tr; EBT00001528780.
DR   EnsemblGenomes-Tr; EBT00001528782.
DR   EnsemblGenomes-Tr; EBT00001528784.
DR   EnsemblGenomes-Tr; EBT00001528786.
DR   EnsemblGenomes-Tr; EBT00001528788.
DR   EnsemblGenomes-Tr; EBT00001528790.
DR   EnsemblGenomes-Tr; EBT00001528792.
DR   EnsemblGenomes-Tr; EBT00001528798.
DR   EnsemblGenomes-Tr; EBT00001528801.
DR   EnsemblGenomes-Tr; EBT00001528803.
DR   EnsemblGenomes-Tr; EBT00001528807.
DR   EnsemblGenomes-Tr; EBT00001528810.
DR   EnsemblGenomes-Tr; EBT00001528812.
DR   EnsemblGenomes-Tr; EBT00001528815.
DR   EnsemblGenomes-Tr; EBT00001528818.
DR   EnsemblGenomes-Tr; EBT00001528821.
DR   EnsemblGenomes-Tr; EBT00001528825.
DR   EnsemblGenomes-Tr; EBT00001528828.
DR   EnsemblGenomes-Tr; EBT00001528831.
DR   EnsemblGenomes-Tr; EBT00001528833.
DR   EnsemblGenomes-Tr; EBT00001528835.
DR   EnsemblGenomes-Tr; EBT00001528838.
DR   EnsemblGenomes-Tr; EBT00001528841.
DR   EnsemblGenomes-Tr; EBT00001528844.
DR   EnsemblGenomes-Tr; EBT00001528846.
DR   EnsemblGenomes-Tr; EBT00001528849.
DR   EnsemblGenomes-Tr; EBT00001528853.
DR   EnsemblGenomes-Tr; EBT00001528856.
DR   EnsemblGenomes-Tr; EBT00001528859.
DR   EnsemblGenomes-Tr; EBT00001528861.
DR   EnsemblGenomes-Tr; EBT00001528864.
DR   EnsemblGenomes-Tr; EBT00001528867.
DR   EnsemblGenomes-Tr; EBT00001528871.
DR   EnsemblGenomes-Tr; EBT00001528874.
DR   EnsemblGenomes-Tr; EBT00001528876.
DR   EnsemblGenomes-Tr; EBT00001528878.
DR   EnsemblGenomes-Tr; EBT00001528880.
DR   EnsemblGenomes-Tr; EBT00001528882.
DR   EnsemblGenomes-Tr; EBT00001528885.
DR   EnsemblGenomes-Tr; EBT00001528888.
DR   EnsemblGenomes-Tr; EBT00001528890.
DR   EnsemblGenomes-Tr; EBT00001528892.
DR   EnsemblGenomes-Tr; EBT00001528895.
DR   EnsemblGenomes-Tr; EBT00001528896.
DR   EnsemblGenomes-Tr; EBT00001528897.
DR   EnsemblGenomes-Tr; EBT00001528900.
DR   EnsemblGenomes-Tr; EBT00001528902.
DR   EnsemblGenomes-Tr; EBT00001528904.
DR   EnsemblGenomes-Tr; EBT00001528905.
DR   EnsemblGenomes-Tr; EBT00001528907.
DR   EnsemblGenomes-Tr; EBT00001528908.
DR   EnsemblGenomes-Tr; EBT00001528910.
DR   EnsemblGenomes-Tr; EBT00001528911.
DR   EnsemblGenomes-Tr; EBT00001528914.
DR   EnsemblGenomes-Tr; EBT00001528916.
DR   EnsemblGenomes-Tr; EBT00001528917.
DR   EnsemblGenomes-Tr; EBT00001528919.
DR   EnsemblGenomes-Tr; EBT00001528921.
DR   EnsemblGenomes-Tr; EBT00001528924.
DR   EnsemblGenomes-Tr; EBT00001528926.
DR   EnsemblGenomes-Tr; EBT00001528927.
DR   EnsemblGenomes-Tr; EBT00001528929.
DR   EnsemblGenomes-Tr; EBT00001528931.
DR   EnsemblGenomes-Tr; EBT00001528933.
DR   EnsemblGenomes-Tr; EBT00001528934.
DR   EnsemblGenomes-Tr; EBT00001528936.
DR   EnsemblGenomes-Tr; EBT00001528938.
DR   EnsemblGenomes-Tr; EBT00001528941.
DR   EnsemblGenomes-Tr; EBT00001528942.
DR   EnsemblGenomes-Tr; EBT00001528944.
DR   EnsemblGenomes-Tr; EBT00001528946.
DR   EnsemblGenomes-Tr; EBT00001528947.
DR   EnsemblGenomes-Tr; EBT00001528949.
DR   EnsemblGenomes-Tr; EBT00001528951.
DR   EnsemblGenomes-Tr; EBT00001528954.
DR   EnsemblGenomes-Tr; EBT00001528955.
DR   EnsemblGenomes-Tr; EBT00001528957.
DR   EnsemblGenomes-Tr; EBT00001528959.
DR   EnsemblGenomes-Tr; EBT00001528961.
DR   EnsemblGenomes-Tr; EBT00001528962.
DR   EnsemblGenomes-Tr; EBT00001528964.
DR   EnsemblGenomes-Tr; EBT00001528965.
DR   EnsemblGenomes-Tr; EBT00001528966.
DR   EnsemblGenomes-Tr; EBT00001528967.
DR   EnsemblGenomes-Tr; EBT00001528968.
DR   EnsemblGenomes-Tr; EBT00001528969.
DR   EnsemblGenomes-Tr; EBT00001528970.
DR   EnsemblGenomes-Tr; EBT00001528971.
DR   EnsemblGenomes-Tr; EBT00001528972.
DR   EnsemblGenomes-Tr; EBT00001528973.
DR   EnsemblGenomes-Tr; EBT00001528974.
DR   EnsemblGenomes-Tr; EBT00001528975.
DR   EnsemblGenomes-Tr; EBT00001528976.
DR   EnsemblGenomes-Tr; EBT00001528977.
DR   EnsemblGenomes-Tr; EBT00001528978.
DR   EnsemblGenomes-Tr; EBT00001528979.
DR   EnsemblGenomes-Tr; EBT00001528980.
DR   EnsemblGenomes-Tr; EBT00001528981.
DR   EnsemblGenomes-Tr; EBT00001528982.
DR   EnsemblGenomes-Tr; EBT00001528983.
DR   EnsemblGenomes-Tr; EBT00001528984.
DR   EnsemblGenomes-Tr; EBT00001528985.
DR   EnsemblGenomes-Tr; EBT00001528986.
DR   EnsemblGenomes-Tr; EBT00001528987.
DR   EnsemblGenomes-Tr; EBT00001528988.
DR   EnsemblGenomes-Tr; EBT00001528989.
DR   EnsemblGenomes-Tr; EBT00001528990.
DR   EnsemblGenomes-Tr; EBT00001528991.
DR   EnsemblGenomes-Tr; EBT00001528992.
DR   EnsemblGenomes-Tr; EBT00001528993.
DR   EnsemblGenomes-Tr; EBT00001528994.
DR   EnsemblGenomes-Tr; EBT00001528995.
DR   EnsemblGenomes-Tr; EBT00001528996.
DR   EnsemblGenomes-Tr; EBT00001528997.
DR   EnsemblGenomes-Tr; EBT00001528998.
DR   EnsemblGenomes-Tr; EBT00001528999.
DR   EnsemblGenomes-Tr; EBT00001529000.
DR   EnsemblGenomes-Tr; EBT00001529001.
DR   EnsemblGenomes-Tr; EBT00001529002.
DR   EnsemblGenomes-Tr; EBT00001529003.
DR   EnsemblGenomes-Tr; EBT00001529004.
DR   EnsemblGenomes-Tr; EBT00001529005.
DR   EnsemblGenomes-Tr; EBT00001529006.
DR   EnsemblGenomes-Tr; EBT00001529007.
DR   EnsemblGenomes-Tr; EBT00001529008.
DR   EnsemblGenomes-Tr; EBT00001529009.
DR   EnsemblGenomes-Tr; EBT00001529010.
DR   EnsemblGenomes-Tr; EBT00001529011.
DR   EnsemblGenomes-Tr; EBT00001529012.
DR   EnsemblGenomes-Tr; EBT00001529013.
DR   EnsemblGenomes-Tr; EBT00001529014.
DR   EnsemblGenomes-Tr; EBT00001529015.
DR   EnsemblGenomes-Tr; Pfl01_R0001-1.
DR   EnsemblGenomes-Tr; Pfl01_R0002-1.
DR   EnsemblGenomes-Tr; Pfl01_R0003-1.
DR   EnsemblGenomes-Tr; Pfl01_R0004-1.
DR   EnsemblGenomes-Tr; Pfl01_R0005-1.
DR   EnsemblGenomes-Tr; Pfl01_R0006-1.
DR   EnsemblGenomes-Tr; Pfl01_R0007-1.
DR   EnsemblGenomes-Tr; Pfl01_R0008-1.
DR   EnsemblGenomes-Tr; Pfl01_R0009-1.
DR   EnsemblGenomes-Tr; Pfl01_R0010-1.
DR   EnsemblGenomes-Tr; Pfl01_R0011-1.
DR   EnsemblGenomes-Tr; Pfl01_R0012-1.
DR   EnsemblGenomes-Tr; Pfl01_R0013-1.
DR   EnsemblGenomes-Tr; Pfl01_R0014-1.
DR   EnsemblGenomes-Tr; Pfl01_R0016-1.
DR   EnsemblGenomes-Tr; Pfl01_R0017-1.
DR   EnsemblGenomes-Tr; Pfl01_R0018-1.
DR   EnsemblGenomes-Tr; Pfl01_R0019-1.
DR   EnsemblGenomes-Tr; Pfl01_R0020-1.
DR   EnsemblGenomes-Tr; Pfl01_R0021-1.
DR   EnsemblGenomes-Tr; Pfl01_R0022-1.
DR   EnsemblGenomes-Tr; Pfl01_R0023-1.
DR   EnsemblGenomes-Tr; Pfl01_R0024-1.
DR   EnsemblGenomes-Tr; Pfl01_R0025-1.
DR   EnsemblGenomes-Tr; Pfl01_R0026-1.
DR   EnsemblGenomes-Tr; Pfl01_R0027-1.
DR   EnsemblGenomes-Tr; Pfl01_R0028-1.
DR   EnsemblGenomes-Tr; Pfl01_R0029-1.
DR   EnsemblGenomes-Tr; Pfl01_R0030-1.
DR   EnsemblGenomes-Tr; Pfl01_R0031-1.
DR   EnsemblGenomes-Tr; Pfl01_R0032-1.
DR   EnsemblGenomes-Tr; Pfl01_R0033-1.
DR   EnsemblGenomes-Tr; Pfl01_R0034-1.
DR   EnsemblGenomes-Tr; Pfl01_R0035-1.
DR   EnsemblGenomes-Tr; Pfl01_R0036-1.
DR   EnsemblGenomes-Tr; Pfl01_R0037-1.
DR   EnsemblGenomes-Tr; Pfl01_R0038-1.
DR   EnsemblGenomes-Tr; Pfl01_R0039-1.
DR   EnsemblGenomes-Tr; Pfl01_R0040-1.
DR   EnsemblGenomes-Tr; Pfl01_R0041-1.
DR   EnsemblGenomes-Tr; Pfl01_R0042-1.
DR   EnsemblGenomes-Tr; Pfl01_R0043-1.
DR   EnsemblGenomes-Tr; Pfl01_R0044-1.
DR   EnsemblGenomes-Tr; Pfl01_R0045-1.
DR   EnsemblGenomes-Tr; Pfl01_R0046-1.
DR   EnsemblGenomes-Tr; Pfl01_R0047-1.
DR   EnsemblGenomes-Tr; Pfl01_R0048-1.
DR   EnsemblGenomes-Tr; Pfl01_R0049-1.
DR   EnsemblGenomes-Tr; Pfl01_R0050-1.
DR   EnsemblGenomes-Tr; Pfl01_R0051-1.
DR   EnsemblGenomes-Tr; Pfl01_R0052-1.
DR   EnsemblGenomes-Tr; Pfl01_R0053-1.
DR   EnsemblGenomes-Tr; Pfl01_R0054-1.
DR   EnsemblGenomes-Tr; Pfl01_R0055-1.
DR   EnsemblGenomes-Tr; Pfl01_R0056-1.
DR   EnsemblGenomes-Tr; Pfl01_R0057-1.
DR   EnsemblGenomes-Tr; Pfl01_R0058-1.
DR   EnsemblGenomes-Tr; Pfl01_R0059-1.
DR   EnsemblGenomes-Tr; Pfl01_R0060-1.
DR   EnsemblGenomes-Tr; Pfl01_R0061-1.
DR   EnsemblGenomes-Tr; Pfl01_R0062-1.
DR   EnsemblGenomes-Tr; Pfl01_R0063-1.
DR   EnsemblGenomes-Tr; Pfl01_R0064-1.
DR   EnsemblGenomes-Tr; Pfl01_R0065-1.
DR   EnsemblGenomes-Tr; Pfl01_R0066-1.
DR   EnsemblGenomes-Tr; Pfl01_R0067-1.
DR   EnsemblGenomes-Tr; Pfl01_R0068-1.
DR   EnsemblGenomes-Tr; Pfl01_R0069-1.
DR   EnsemblGenomes-Tr; Pfl01_R0070-1.
DR   EnsemblGenomes-Tr; Pfl01_R0071-1.
DR   EnsemblGenomes-Tr; Pfl01_R0072-1.
DR   EnsemblGenomes-Tr; Pfl01_R0073-1.
DR   EnsemblGenomes-Tr; Pfl01_R0074-1.
DR   EnsemblGenomes-Tr; Pfl01_R0075-1.
DR   EnsemblGenomes-Tr; Pfl01_R0076-1.
DR   EnsemblGenomes-Tr; Pfl01_R0077-1.
DR   EnsemblGenomes-Tr; Pfl01_R0078-1.
DR   EnsemblGenomes-Tr; Pfl01_R0079-1.
DR   EnsemblGenomes-Tr; Pfl01_R0080-1.
DR   EnsemblGenomes-Tr; Pfl01_R0081-1.
DR   EnsemblGenomes-Tr; Pfl01_R0082-1.
DR   EnsemblGenomes-Tr; Pfl01_R0083-1.
DR   EnsemblGenomes-Tr; Pfl01_R0084-1.
DR   EnsemblGenomes-Tr; Pfl01_R0085-1.
DR   EnsemblGenomes-Tr; Pfl01_R0086-1.
DR   EnsemblGenomes-Tr; Pfl01_R0087-1.
DR   EnsemblGenomes-Tr; Pfl01_R0088-1.
DR   EnsemblGenomes-Tr; Pfl01_R0089-1.
DR   EnsemblGenomes-Tr; Pfl01_R0090-1.
DR   EnsemblGenomes-Tr; Pfl01_R0091-1.
DR   EnsemblGenomes-Tr; Pfl01_R0092-1.
DR   EnsemblGenomes-Tr; Pfl01_R0093-1.
DR   EnsemblGenomes-Tr; Pfl01_R0094-1.
DR   EnsemblGenomes-Tr; Pfl01_R0095-1.
DR   EuropePMC; PMC1855727; 17172348.
DR   EuropePMC; PMC1855914; 17277060.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2396522; 18551168.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2547038; 18658280.
DR   EuropePMC; PMC2647930; 19144133.
DR   EuropePMC; PMC2698329; 19395572.
DR   EuropePMC; PMC2718517; 19432983.
DR   EuropePMC; PMC2794547; 20041161.
DR   EuropePMC; PMC2918963; 20562273.
DR   EuropePMC; PMC3072421; 21490938.
DR   EuropePMC; PMC3165259; 21705548.
DR   EuropePMC; PMC3370510; 22492458.
DR   EuropePMC; PMC3510223; 23209661.
DR   EuropePMC; PMC3581993; 23466902.
DR   EuropePMC; PMC3656225; 23536173.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC4103555; 22972385.
DR   EuropePMC; PMC4262366; 25491753.
DR   EuropePMC; PMC4714231; 26631733.
DR   EuropePMC; PMC5270692; 28126933.
DR   EuropePMC; PMC5879708; 29531068.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01681; P4.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000094.
DR   SILVA-SSU; CP000094.
XX
CC   On Jul 15, 2009 this sequence version replaced gi:77380231.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Projec ID: 2351488
CC   Source DNA and bacteria available from Mark Silby
CC   (mark.silby@tufts.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   ##Metadata-START##
CC   Organism Display Name :: Pseudomonas fluorescens Pf0-1
CC   GOLD Stamp ID         :: Gc00305
CC   Greengenes ID         :: 140331
CC   Isolation Site        :: Agricultural loam soil in 1988
CC   Collection Date       :: 1988
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Phenotypes            :: Non-Pathogen
CC   Energy Source         :: Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6438405
FT                   /organism="Pseudomonas fluorescens Pf0-1"
FT                   /strain="Pf0-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:205922"
FT   gene            565..2088
FT                   /gene="dnaA"
FT                   /locus_tag="Pfl01_0001"
FT   CDS_pept        565..2088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Pfl01_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71745"
FT                   /db_xref="GOA:Q3KKG1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKG1"
FT                   /protein_id="ABA71745.1"
FT                   /translation="MSVELWQQCVELLREELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRVLELLDEHGNGLAPSLSLLIGSKRSSAPRAAPNAPLAAAQVSQAQA
FT                   NAAPASAPAPAPTPAPTKRTTQKTEEISEEPSRDSFDPMAGAASQQAPVRAEQRTVQVE
FT                   GALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLM
FT                   HAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFA
FT                   RKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELE
FT                   TRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELI
FT                   RESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELT
FT                   NHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            2128..3231
FT                   /gene="dnaN"
FT                   /locus_tag="Pfl01_0002"
FT   CDS_pept        2128..3231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Pfl01_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71746"
FT                   /db_xref="GOA:Q3KKG0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKG0"
FT                   /protein_id="ABA71746.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVDGQQLSLT
FT                   GTDLEVELVGRVQLEEPAETGSITVPARKLMDICKSLPNDALIDIKVDEQKLVVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTTSLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   TGVIRAVATDGHRLAMCSMQADIGQQDRHQVIVPRKGILELARLLTEPDGNVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLASGQLKIQANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
FT   gene            3246..4349
FT                   /gene="recF"
FT                   /locus_tag="Pfl01_0003"
FT   CDS_pept        3246..4349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Pfl01_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71747"
FT                   /db_xref="GOA:Q3KKF9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKF9"
FT                   /protein_id="ABA71747.1"
FT                   /translation="MSLSRVSVTAVRNLHPVTFSPSPRINILYGANGSGKTSVLEAIHL
FT                   LGLARSFRSTRLLPVIQYEQLACTVFGQVELAEGGHSALGISRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMATWQRLQKALRQRN
FT                   SWLRHGTLDAVSQAVWDRELCQASAEIDEYRRAYIKALKPVFEQTLSELVELEGLTLSY
FT                   YRGWDKDRELSAVLAGSVQRDQQMGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQARRGQCIYLVDDLPSELDESHRRALCRLLEDLRCQVFITCVDHELLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            4355..6772
FT                   /gene="gyrB"
FT                   /locus_tag="Pfl01_0004"
FT   CDS_pept        4355..6772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Pfl01_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71748"
FT                   /db_xref="GOA:Q3KKF8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF8"
FT                   /protein_id="ABA71748.1"
FT                   /translation="MSEENTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVKDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEELVLTVRRSGKIWEQTYVHGVPQAPMAIVGDSE
FT                   TTGTQIHFKASSETFKNIHFSWDILAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTAVNQVFHFNIQREDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKLVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDDAMEEYMTQSALEDASLHLNEDAPGI
FT                   SGEALERLVNDFRMVMKTLKRLSRLYPQELTEHFIYLPAVSLEMLGDHAKMQDWLAQYE
FT                   VRLRTVEKSGLVYKASLREDRERGVWLPEVELISHGLSNYVTFNRDFFGSNDYKTVVTL
FT                   GAQLSTLLDEGAYIQRGERKKAVTEFKEALDWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSVRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
FT   gene            complement(6835..7551)
FT                   /locus_tag="Pfl01_0005"
FT   CDS_pept        complement(6835..7551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0005"
FT                   /product="putative two-component system, response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71749"
FT                   /db_xref="GOA:Q3KKF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF7"
FT                   /protein_id="ABA71749.1"
FT                   /translation="MRVAILDDEPAELRRVEQTLQQMAEAGGQPWSLHSFESGEDLLRQ
FT                   LRRETFDLLILDWQLPDLTGLALLRWTREHMEAPPAAIMLTSRDGESDIVQALNAGADD
FT                   YVSKPFRPNELKARVAAVLRRHSLQRNAAADVLRFNDLVFDDAELTVTRDGKPIVMTER
FT                   EYRLAHCLFSNLGRPLSRDYLYERFWPHEEMSTSRPLDTHIYRLRNKLGLTADRGWQLL
FT                   TIYGYGYRLESVAAGE"
FT   gene            7716..9257
FT                   /locus_tag="Pfl01_0006"
FT   CDS_pept        7716..9257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0006"
FT                   /product="putative two component system, histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71750"
FT                   /db_xref="GOA:Q3KKF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF6"
FT                   /protein_id="ABA71750.1"
FT                   /translation="MNNQRRHESRVPSQVQRLFRQLVREWVWISLVLLPLTALLSWRAQ
FT                   INLHDPVPLMGAGLSVAMVACVLGLLLWRPRLALWLTLGGIACVLLTSAGLAETRRWWS
FT                   PTPAALGMLFGYLIWNWRRLSVVLTYFGWELARLDSEPKVFPERRRAQFPSADRLQGQI
FT                   MALEQAMSRTRDTRRFIADGLEYLPVATLISDPRGEVLLGNRKARNLFDHTLVGEDVLD
FT                   QLASLGYPELSTEPRPPLSELPLLEFRDHKERSLRLERAALLPVDGDIPIGWLLSLTDL
FT                   SAERAAEEQRGVLLRFLSHDLRAPHSAILALLEVHRHQTGTDSPLFEQIERQVRRALEL
FT                   TDGFVLLARAESEAYQFQPSLFGMLVMDVLDQALPIAQQKLIELSSDMDEQSHERLIMA
FT                   DQGLLTRALFNLLENAIKYSPAGSTVDLRVSCHDDWLRCELIDQGKGIAAEELPDLFSQ
FT                   YRRFSSAQGIDGVGLGLSMVKAVVDHHGGRIECVSVVDRGTTFRLELPLIAEEQA"
FT   gene            complement(9415..10239)
FT                   /locus_tag="Pfl01_0007"
FT   CDS_pept        complement(9415..10239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0007"
FT                   /product="putative phospholipid biosynthesis-related
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71751"
FT                   /db_xref="GOA:Q3KKF5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF5"
FT                   /protein_id="ABA71751.1"
FT                   /translation="MRLNSRALPVTVNVAMSILQAIRIFLFYLLLGTTALLWCSLSFFI
FT                   APFLSFKARYRFINVYWCRCALWLTKVFLGIRYEVKGAENVPDRPCVIQSNHQSTWETF
FT                   FLSAYFSPLSQVLKRELLYVPFFGWAMAMLRPIAIDRDNPKAALKQVAAKGDELLKDDV
FT                   WVLIFPEGTRVPHGTIGKFSRSGSALAVNAALPVLPIAHNAGKFWPKIGWGKKSGVITV
FT                   VIGEPMYAEGSGPRAIADLNDRVQAWNEKTQREMGSLPPAPEAPAANDQIAV"
FT   gene            complement(10277..10810)
FT                   /gene="gmhB"
FT                   /locus_tag="Pfl01_0008"
FT   CDS_pept        complement(10277..10810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="Pfl01_0008"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71752"
FT                   /db_xref="GOA:Q3KKF4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF4"
FT                   /protein_id="ABA71752.1"
FT                   /translation="MKLLILDRDGVINYDSDAYIKSVEEWIPLPGSIEAIAQLSKAGWT
FT                   VAVATNQSGIARGYYDLATLDAMHARLRELVAEQGGEVGLIVYCPHGPDEGCDCRKPKP
FT                   GMLRTIAQHYDVALTNVWFVGDSLGDLEAAKAVDSQPVLVKTGKGEKTQAKTLPVGTLI
FT                   FDDLAAIAAELIHN"
FT   gene            complement(10821..12875)
FT                   /gene="glyS"
FT                   /locus_tag="Pfl01_0009"
FT   CDS_pept        complement(10821..12875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="Pfl01_0009"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71753"
FT                   /db_xref="GOA:Q3KKF3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKF3"
FT                   /protein_id="ABA71753.1"
FT                   /translation="MSAQDFLVELGTEELPPKALNTLAEAFLAGIDKGLQAAGLNYESK
FT                   TVYAAPRRLAVLITALATQQPDRSINLDGPPRQAAFDADGNPTQAALGFAKKCGVELSE
FT                   IDQSGPKLRYSQNIAGKPTASLLPTIVEDSLNDLPIPKRMRWGARKEEFVRPTQWLVML
FT                   LGDQIIDCTILAQKAGRESRGHRFHHPQSVRIGSPSSYLADLRAAYVLADANERREIIS
FT                   KRTEELATRQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLDVPQEALITTMQDNQK
FT                   YFCLLDADGKLLPRFITVANIESKDPQQIIAGNEKVVRPRLTDAEFFFKQDKKQKLEAF
FT                   NDRLQNVVFQEKLGSVYDKAERVSKLAAYIAARIGGNASWAARAGLLSKCDLATEMVGE
FT                   FPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPATLTGAAVAIADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLNDAVAFAVNAFGAKVKAAGLND
FT                   AVLEFIFDRLRARYEDEGVGVATYLSVRALKPGSALDFDQRVQAVQAFRKLPEAAALAA
FT                   VNKRVSNLLSKVEGSVPTEVQAKYFDNANEFSLYSAIQQADQAVQPMAAARQYNESLAR
FT                   LAALREPVDAFFDAVMVNAEDANVRANRYALLARLRGLFLGVADISLLG"
FT   gene            complement(12872..13825)
FT                   /gene="glyQ"
FT                   /locus_tag="Pfl01_0010"
FT   CDS_pept        complement(12872..13825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="Pfl01_0010"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71754"
FT                   /db_xref="GOA:Q3KKF2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKF2"
FT                   /protein_id="ABA71754.1"
FT                   /translation="MSQPTPAVRTFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPDNFQELYLGSL
FT                   KHVGLDPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLF
FT                   ELFDFYESEAKRLIELDQPLPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTL
FT                   ARSVAQAYLLARAKLGFPMATPDLRDEVLAKLEAAQ"
FT   gene            13907..14464
FT                   /locus_tag="Pfl01_0011"
FT   CDS_pept        13907..14464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0011"
FT                   /product="putative DNA-3-methyladenine glycosidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71755"
FT                   /db_xref="GOA:Q3KKF1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF1"
FT                   /protein_id="ABA71755.1"
FT                   /translation="MPRCFWCNEDPLYMAYHDQEWGTPLRDAQGLFELLLLEGFQAGLS
FT                   WITVLRKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRIKLNAARRNAQAWLA
FT                   LEDPVAFLWSFVDNRPVINHFKDRSEVPAITPQAVAMSKGLKKAGFTFVGPTICYALMQ
FT                   ASGMVMDHTQDCDRYAQLANGG"
FT   gene            14505..15392
FT                   /locus_tag="Pfl01_0012"
FT   CDS_pept        14505..15392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0012"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71756"
FT                   /db_xref="GOA:Q3KKF0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF0"
FT                   /protein_id="ABA71756.1"
FT                   /translation="MEKFKGAMLVGALRLFALLPWRAVQAVGSAIGWIMWKTPNRSRDV
FT                   VRINLAKCFPQMDPAERERLVGQTLKDIGKSLTESACAWIWPAQRSIDLVREVEGLEVL
FT                   KDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDELLRKQRVQLGNK
FT                   VAASTKEGILSVIKEVRKGGQVGIPADPEPAESAGIFVPFFATQALTSKFVPNMLAGGK
FT                   AVGVFLHALRLPDGSGYKVILEAAPEAMYSTDTETSCAAMSKVVERYVAAYPSQYMWSM
FT                   KRFKKRPPGEARWY"
FT   sig_peptide     14505..14585
FT                   /locus_tag="Pfl01_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.784 at
FT                   residue 27"
FT   gene            complement(15444..15758)
FT                   /locus_tag="Pfl01_0013"
FT   CDS_pept        complement(15444..15758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71757"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE9"
FT                   /protein_id="ABA71757.1"
FT                   /translation="MIESLEKMLAKGVDNSLLRFGLGKGYLDLGENAKAAEHFQRCVGF
FT                   DPKYSAAWKLLGKAQLALGDLTAARQAWEQGLEAARAHGDKQAEKEMTVFLKKLDRQKP
FT                   "
FT   gene            complement(15779..17155)
FT                   /locus_tag="Pfl01_0014"
FT   CDS_pept        complement(15779..17155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0014"
FT                   /product="trk system potassium uptake protein trkA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71758"
FT                   /db_xref="GOA:Q3KKE8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE8"
FT                   /protein_id="ABA71758.1"
FT                   /translation="MKIIILGAGQVGGSLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAHTLFHTPTKIARVREASY
FT                   LTREEQLFQNEAIPVDVLISPEQVVTNYIKRLIQHPGALQVIDFAEGQAQLVAVRAYYG
FT                   GPLVGQQLRQLREHMPNVETRVAAIFRRDRPILPQGDTVIEADDEVFFIAARANIRAVM
FT                   SEMRRLDESYKRIVIAGGGQIGERLAEAIESRYQVKIIEMNPARCRYLSDTLDSTVVLQ
FT                   GSASDRDLLLEENIADADIFLALTNDDEANIMSSLLAKRLGAKKVMTIINNPAYVDLIQ
FT                   GGDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSKVIGKAI
FT                   ENIALPPGTTIGAIIRDEEVIIAHDDTVIAAGDHVILFLVDKKYIRDVEKLFHVGLSFF
FT                   "
FT   gene            complement(17178..18488)
FT                   /locus_tag="Pfl01_0015"
FT   CDS_pept        complement(17178..18488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0015"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71759"
FT                   /db_xref="GOA:Q3KKE7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE7"
FT                   /protein_id="ABA71759.1"
FT                   /translation="MNPRLAAAKALAAVLSGKASLNSSLPTQLDKVEDRDRGFTQDLAF
FT                   GTARWQPRLSALAEKLLQKPFKAADADVEALLLVGLYQLLYTRVPPHAAIGETVGCADK
FT                   LKKPWAKGLLNAVLRNAQREHEAIFAELERDPVVRTAHPRWLQKSLKAFWPEQWEAICE
FT                   ANNAHPPMILRVNRRHHSRDAYLGLLTEAGIAAQPCTFSRDGIVLEAAADVRSLPGFAE
FT                   GWISVQDEAAQLAADLLDLAPGQRVLDACCAPGGKTCHILEAEPALAGVVAVDLEAKRL
FT                   VRVKENLERLGLNAELIAADGRDTAAWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   ADDIVALAQLQGELLDAMWKTLEVGGILLYATCSTLPTENTEVIGAFLERTPGARELDL
FT                   ATTAGIKQPHGRQLLAQQGGHDGFYYAKLIKIAAARG"
FT   gene            complement(18485..19444)
FT                   /locus_tag="Pfl01_0016"
FT   CDS_pept        complement(18485..19444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0016"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71760"
FT                   /db_xref="GOA:Q3KKE6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKE6"
FT                   /protein_id="ABA71760.1"
FT                   /translation="MTEPLRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLALENNIQVLQPPTLRNADAQAELAALKPDLMVVVAYGLILPQAVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISAED
FT                   TGGSLHDRLAEMGPPAVVQAIAGLAAGTLEGEVQNDELATYAHKLNKDEARIDWSRPAV
FT                   ELERLVRAFNPWPITHSTLNGEALKVLAATLAEGKGAPGTILGASKDGLIVACGEQALC
FT                   LTRLQLPGGKALNFSDLFNSRREKFATGIVLGAAVDAQ"
FT   gene            complement(19501..20007)
FT                   /locus_tag="Pfl01_0017"
FT   CDS_pept        complement(19501..20007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0017"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71761"
FT                   /db_xref="GOA:Q3KKE5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE5"
FT                   /protein_id="ABA71761.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDRTEPRVFINPEFESLTDEMEQYQEGCLSVPGFYENVDR
FT                   PQKVKIKALDRDGKPYELIAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKQ
FT                   HRQNA"
FT   gene            20177..21202
FT                   /locus_tag="Pfl01_0018"
FT   CDS_pept        20177..21202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0018"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71762"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE4"
FT                   /protein_id="ABA71762.1"
FT                   /translation="MRKSLLALLFLASAGAAHGQVQLKEGFPQQYTVVSGDTLWDISGK
FT                   YLREPWQWPQLWRANPQIENPNLIYPGDTLTLSYVNGQPRLTVNRGESRGTIKLSPRIR
FT                   TSPVAEAIPSIPLKSINSFLLSNRIVDKVEDFDKAPYIVAGDAERVLSGTGDRIFARGH
FT                   FDPNQPVYGIFRQGKVYTDPQTKEFLGINADDIGGGEIVATEGDVATLALQRTTQEVRL
FT                   GDRLFSGEERSINSTFMPSAPTTDINGLIIDVPRGVTQIGAMDVVTLNKGKRDGLAEGN
FT                   VLVVMKTGETVRDRITGQPLKIPDERAGLLMVFRTYDKLSYGLVLNASRSLAVLDKVRN
FT                   P"
FT   sig_peptide     20177..20236
FT                   /locus_tag="Pfl01_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            21282..22382
FT                   /locus_tag="Pfl01_0019"
FT   CDS_pept        21282..22382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0019"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71763"
FT                   /db_xref="GOA:Q3KKE3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE3"
FT                   /protein_id="ABA71763.1"
FT                   /translation="MMMPVSASVSPAELEARLRLHRLPEVGPKRFAKLLEAFGSASKAI
FT                   SAPASAWRSLGLPAACAEARRCPEVRDGASHALRWLERPDQHLLMWDHPDYPALLAQIP
FT                   DPPPLLFVAGDPRILEKPQLAVIGSRRASRPGMDTAAAFSRSLAGAGFVITSGLALGID
FT                   AAAHQAAVDVGGQTVGVLGTGLENFYPQRNRRLADVMIASGSAVVSEFPLDTGPTASNF
FT                   PRRNRIISGLSLGVLVVEASVASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
FT                   DGAVLVETIEHILEALRGWQHLPVSTAAANPDNPLLRLLHAAPHTSEGLADSSGWALPK
FT                   VLAALTELEMDGRAVCENGRWFARVS"
FT   gene            22437..22994
FT                   /locus_tag="Pfl01_0020"
FT   CDS_pept        22437..22994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0020"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71764"
FT                   /db_xref="GOA:Q3KKE2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKE2"
FT                   /protein_id="ABA71764.1"
FT                   /translation="MVNSWRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEEAVDRLLA
FT                   IKNRSVDKGLILVADNIRQFDFLFEDFPQDWIDRMASTWPGPNTWLVPHQNLLPEWVTG
FT                   VHDTVALRVSDHPQVRDLCSLVGPLISTSANPQGRPAARTRLRVEQYFRGQVDLVLGGA
FT                   LGGRKNPSLIRDLATGNIVRPA"
FT   gene            complement(23036..24013)
FT                   /locus_tag="Pfl01_0021"
FT   CDS_pept        complement(23036..24013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0021"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71765"
FT                   /db_xref="GOA:Q3KKE1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE1"
FT                   /protein_id="ABA71765.1"
FT                   /translation="MAKRIQFRAHGGPEVLEYVDYQPAEPGPQQVRVSNKAIGLNFIDT
FT                   YYRSGLYAPPALPSGVGAEGAGIVEAVGSEVTRFKVGDRVAYGSGPLGAYSDVHVLPEA
FT                   NLVHLPDAISFETAAGVMLKGLTVQYLLRQTYELKGGETILFHAAAGGVGLLACQWAKA
FT                   LGVKLIGTVSSKAKADLAKAHGAWETIDYSHENVAQRVLELTDGKKVPVVYDGVGKDTW
FT                   PASLDSVAPRGLLVSFGNASGAVDGVNLGILAAKGSLYVTRPTLATYANNAENLQRMAD
FT                   ELFGMITSGKLKVDISQRYPLADAAKAQTELSARRTTGSTVLLP"
FT   gene            24161..25075
FT                   /locus_tag="Pfl01_0022"
FT   CDS_pept        24161..25075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0022"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71766"
FT                   /db_xref="GOA:Q3KKE0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKE0"
FT                   /protein_id="ABA71766.1"
FT                   /translation="MTTRTDAVKAYLLDLQDRICAALETEDGGTRFVEDAWTRPAGGGG
FT                   RTRVIENGTVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVP
FT                   TSHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGNEEDCIHWHRVAEKACAPFGPDVYPR
FT                   YKAWCDTYFHIKHRHEPRGIGGLFFDDLNEWDFDTSFAFMRAIGDAYIDAYLPIVQRRK
FT                   NDAFTARQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWAYDWKA
FT                   EPGSEEARLTEYFLQDRDWLAQA"
FT   gene            25085..25906
FT                   /locus_tag="Pfl01_0023"
FT   CDS_pept        25085..25906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0023"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71767"
FT                   /db_xref="GOA:Q3KKD9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD9"
FT                   /protein_id="ABA71767.1"
FT                   /translation="MDRYVVFGNPIGHSKSPMIHKLFAEQTGQSLDYSTLLAPLDDFSG
FT                   CATAFFQEGRGANVTVPFKEDAYRLANSLTARAERAGAVNTLSKLADGSLLGDNTDGAG
FT                   LVRDLTVNGGFSLTGKRILLLGAGGAVRGALEPLLAEKPASVIIANRTVDKAELLAELF
FT                   CDLGPVSASGYDWLREPVDVIINATSASLTGDVPPIAESLIEPGKTLCYDMMYGKEPTA
FT                   FCRWASEHGAGVVMDGLGMLAEQAAEAFFLWRGVRPDTAPVLAELRRQLTL"
FT   gene            complement(25913..27481)
FT                   /locus_tag="Pfl01_0024"
FT   CDS_pept        complement(25913..27481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0024"
FT                   /product="putative ABC transport system, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71768"
FT                   /db_xref="GOA:Q3KKD8"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD8"
FT                   /protein_id="ABA71768.1"
FT                   /translation="MALPSRRSLFPFLTWLPRQTRASVGRDLVVGLSGAILALPQSIAY
FT                   ALIAGLPPEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLFASVSPLAVPESQDYI
FT                   TLILLLTFLAGIFQWLLGLLRFGALVNFVSHSVVLGFTLGAAVVIAIGQLPNLLGLELP
FT                   AKATALDSLMDLLRHLGAVDKPSLVLGVATVVVGALLKQWLPRWPTLLMTLVLGSLVVW
FT                   LWPAMFGHVQLVSAFFGRLPPFSGLPLDMDLILRLLPSAVAVGMLGLVTSLSIARSISA
FT                   RSQQLLDANQEVRAQGLSNIVGAFFSGSLSAGSFTRSGLSYEAGACSPLAGVFSALWVA
FT                   LFAIFGAGLIAHIPIPAMAGSILLIAWGLVDHRGIRALLRVSRADFVVMSLTCVATLLL
FT                   ELQTAIYAGVLASLFFYLKRTSQPRVQHWRDGEDDVLRVGGSIFFGASHYLQVRLQRMQ
FT                   GARVVIEAQQINFIDYSGVEMLHQEARRLLRQDRSLTLRQARPQVVEELRKLEGPEKCP
FT                   IRFED"
FT   gene            complement(27584..28501)
FT                   /locus_tag="Pfl01_0025"
FT   CDS_pept        complement(27584..28501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0025"
FT                   /product="putative ABC transport system, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71769"
FT                   /db_xref="GOA:Q3KKD7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD7"
FT                   /protein_id="ABA71769.1"
FT                   /translation="MVKLSTVVTVSLLALGSASAFAESCDTVKMADPGWSDIAATNAIT
FT                   GFLLDGMGYKAKVDTLAVPITFGGLKDGQVDVFLGNWMPAQQGFYDKFVATGDVTQLAK
FT                   NLDGTEFTLAVPDYVWDAGVHNFADLNKYADKFEKKIYGIGSGAPANISLQEIIKKNDF
FT                   DLGQWKLIESSEQAMLAEVSRAVKKQKFVTFLGWTPHPMNVQLKMHYLKGGEKYFGDTG
FT                   SVYTLTRKGYAEACPNVGKLLTNLAFTQEMENSIMAEVVNKKVSNAEAVKAWIKANPGV
FT                   LDKWLDGVKTVDGKDALPAVKAKL"
FT   sig_peptide     complement(28433..28501)
FT                   /locus_tag="Pfl01_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 23"
FT   gene            complement(28518..30050)
FT                   /locus_tag="Pfl01_0026"
FT   CDS_pept        complement(28518..30050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0026"
FT                   /product="putative choline sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71770"
FT                   /db_xref="GOA:Q3KKD6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD6"
FT                   /protein_id="ABA71770.1"
FT                   /translation="MECRDHMKRKNILFIMADQMAAPMLPFYGPSPIKLPNLSRLAEQG
FT                   VVFDAAYCNSPLCAPSRFTLVSGQLPSKIGAYDNAADFPADIPTYAHYLRRLGYRTALS
FT                   GKMHFCGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTN
FT                   QLDFDEEVVFKAQQYLFDHIREDGDQPFCLTVSMTHPHDPYTIPKAFWDLYDDADIPLP
FT                   TTPDQHSLDPHSQRLLKVYDLWDKPLPVDKIRDARRAYFGACSYIDANVGKLLQTLEDC
FT                   GLMDDTVIVFSGDHGDMLGEKGLWYKMHWFEMAARVPLLISAPGQFKSGRVSAAVSTAD
FT                   LLPTFVELAGGSLEPNLPLDGRSLVPHLNGQGGHDEVFGEYMAEGTVSPLMMIRRGAYK
FT                   FIYSETDPCLLFDVDNDPREQEELSQSPQHRQLFDDFLAEARAKWDIPAIHRKVLESQR
FT                   RRRFVAEALTIGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPCQNQ"
FT   gene            30147..31097
FT                   /locus_tag="Pfl01_0027"
FT   CDS_pept        30147..31097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0027"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71771"
FT                   /db_xref="GOA:Q3KKD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD5"
FT                   /protein_id="ABA71771.1"
FT                   /translation="MYDALGDLSLDLLRAFEAAARHRSFTAAAVELGTTQPAISQQIKR
FT                   LEEQLGTRLFDRIYRGIELTEVGSILFEQVTLGLQNIDAGLSAISTQQQHEVLQVATDF
FT                   AFAAYWLMPRLHRFHEAYPQVDVSLVTSERNHNMLRPDIDVAVLFGDGRFKQGESHWLF
FT                   SEEVFPVCSPQLLKDCSLPLPAQALMEFPLLHLRGENSSNWFDWSGLFRALNISTPPAP
FT                   GQLRFDNYTLLIQAAIGGQGVAIGWRHLVDNLLTQGLLCRPIAETTLSRLGYYVVLPQR
FT                   KRRGALIQTFVDWLMAEQASSAESLAGLPLPSIAV"
FT   gene            complement(31102..31761)
FT                   /locus_tag="Pfl01_0028"
FT   CDS_pept        complement(31102..31761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71772"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD4"
FT                   /protein_id="ABA71772.1"
FT                   /translation="MKNAETPAVKVVLYGAMSSLGSALMAELLRRQHEVIAILDDLTAL
FT                   APRPGLRTKSGDLLDAERVNQSVAGSSAVICLLNAPGLPLSSDHVEKSVVLGPVEQVLA
FT                   VDALIDGLQAANVSRLFVIGEFEALDDPENADPLQRHAAQEVREALQSSPLHWTLVNAP
FT                   RSVAGLTIEHFSQVGRTLEPGLAEPLERLNRVAVGIADELRLNLHLRQHVDFVAAS"
FT   gene            31846..32172
FT                   /locus_tag="Pfl01_0029"
FT   CDS_pept        31846..32172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71773"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD3"
FT                   /protein_id="ABA71773.1"
FT                   /translation="MQTIKGYHAHVYYDASTIKQARALCEQAAALFPLKMGRVHERPVG
FT                   PHPDWSCQLAFGPELIGDVLPWLALNRKGLVVFLHPDTGDDLLDHTEHAIWMGAMRPLD
FT                   LSVF"
FT   gene            complement(32173..32574)
FT                   /locus_tag="Pfl01_0030"
FT   CDS_pept        complement(32173..32574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71774"
FT                   /db_xref="GOA:Q3KKD2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD2"
FT                   /protein_id="ABA71774.1"
FT                   /translation="MTELHGGGCHCGHIRYQFSGPLHDIAHCHCSICRKVSGGIVTTWI
FT                   TLPAANFQWLTGKPSRYDSSTSCARFFCPNCGAHLALVTLLSPESIDLTIATLDHPEQA
FT                   AAERHIWTDSQLPWLHLDEHLPGEPEETI"
FT   gene            32899..34206
FT                   /locus_tag="Pfl01_0031"
FT   CDS_pept        32899..34206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0031"
FT                   /product="putative anion transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71775"
FT                   /db_xref="GOA:Q3KKD1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD1"
FT                   /protein_id="ABA71775.1"
FT                   /translation="MLTFLGFAMVITFMFLIMTKRLSALIALIIIPILFALFGGFAPKI
FT                   GPMMLEGITKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTAVL
FT                   ALVVSLDGDGATTYMICVAAMLPLYSRIGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDPSDIFVPMIPAMAAGVVAILIIAYFYGKRERARLGELHLIGDEIDHSEISVSQ
FT                   FPDARRPKLIWFNGLLTLALMCTLIAGLLPLPVLFMVAFSIAMIVNYPCLQMQKDRVAA
FT                   HAGSVLSVVSLIFAAGIFTGILSGTGMVDAMSKSLLAVIPDFLGPYLAVITALVSMPFT
FT                   FFMSNDAFYYGVLPVLSEAASHYGITAVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAVLVCLCILVAALLLGTFPLFSTL"
FT   sig_peptide     32899..32970
FT                   /locus_tag="Pfl01_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.450 at
FT                   residue 24"
FT   gene            34278..35045
FT                   /locus_tag="Pfl01_0032"
FT   CDS_pept        34278..35045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0032"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71776"
FT                   /db_xref="GOA:Q3KKD0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD0"
FT                   /protein_id="ABA71776.1"
FT                   /translation="MEWLTNPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQQR
FT                   TRIFGLGLAMITRILLLLSITWVMRLTADLFEVFGQGISGRDLILFFGGLFLLWKSSQE
FT                   MYHALEGEDESDDEPSGKGGNFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVAAII
FT                   VAVLVMMAASGKISEFIDKHPSLKMLALSFLLVVGTVLIAESFDVHVPKGYVYFAMAFS
FT                   LAVEAINIKMRTAIAKKRKQQDPVKLRKDIPGQ"
FT   repeat_region   35080..35095
FT                   /note="Left IR of the IS element"
FT   gene            35160..36578
FT                   /locus_tag="Pfl01_0033"
FT   CDS_pept        35160..36578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0033"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71777"
FT                   /db_xref="GOA:Q3KCH0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KCH0"
FT                   /protein_id="ABA71777.1"
FT                   /translation="MAYIQGESRSQTSLFPVSLEELIPEDHLVRVIDLYVAKLDLGQLG
FT                   FEKAQPKASGRPAYDPADQLKLYLYGYFQRIRSSRRLEAECQRNIEVMWLINRLKPDFK
FT                   TIADFRKNNKVAFVTTCRAFVQFCRSVGLIAGDLVAIDGSKFQAVASSRRHLNLNQLKR
FT                   QEEKLDKRIAQYLADLDAADKAEGEQVVDRTAIKAALAKLEAKQQDNRSCQALMKSMSL
FT                   EQFNTHESDARMMRTPKGARVAYNVQTAVDAEHCLILHHEVTQDGDDRKQLEPIAKAAK
FT                   AELGQDTLTVTADMGYSNGQQFQACEEASITVYVPPNRTSNPGGETLFERQDFTYDAEQ
FT                   DRYQCPAGQWLTLKQRYKGDRIYQAAVSDCAGCALKAQCTTAQRRYVSRHAQEEAFERM
FT                   AQRMQLHPEMMERRRSIVEHPFGNLKQWLFGNGRFLLRQLEGTKAEMALAVTAYNFKRA
FT                   ISVLGAKKMMQLMG"
FT   repeat_region   36649..36664
FT                   /note="Right IR of the IS element"
FT   gene            36849..38507
FT                   /locus_tag="Pfl01_0034"
FT   CDS_pept        36849..38507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0034"
FT                   /product="putative cation transport-related membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71778"
FT                   /db_xref="GOA:Q3KKC8"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC8"
FT                   /protein_id="ABA71778.1"
FT                   /translation="MLTLLNLLSAVALLIWGTHIVRTGILRVYGTNLRHVIGQNMSRRW
FT                   LAFVAGIVVTAMVQSSNATAMLVTSFVGQGLMALTPALATMLGADVGTALMARVLTFDL
FT                   SWLSPLLIFIGVIFFLSRKQTRLGQMGRVSIGLGLIILALQLIVEAAAPITHAQGVKVI
FT                   FASLTGDILLDALVGALFAMISYSSLAAVLLTATLAGAAVISLPVAIGLVIGANIGSGV
FT                   LAFMSTSMQNAAGRQVALGSLLYKLIGLLLIIPVLDPLVHWIDSLDFSPQEMVIGFHLL
FT                   YNTARCLILLPSVGPMARLCAWLLPERPEVNGTAKPRHLDPTALVTPSLALANAARETL
FT                   RMGDLIDNMLDATLDVLRGKQTAVTQEMRKLTDDVEALYSAIKLYLAQMPREDLGEQDS
FT                   RRWAEIIELAINLKLASDLIERMLRKVQQQKTSQRRSFSEDGLEELAGLHQQLIANLRL
FT                   GLSVFLSGDKESARQLLREKRRFRAQERRLAHAHVSRLQRKIVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLETSDTGALAADDMADITHSP"
FT   gene            38602..39993
FT                   /locus_tag="Pfl01_0035"
FT   CDS_pept        38602..39993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0035"
FT                   /product="putative membrane-bound peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71779"
FT                   /db_xref="GOA:Q3KKC7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC7"
FT                   /protein_id="ABA71779.1"
FT                   /translation="MRCLLFACLLLGSLPAFALDRFQVEGYALPNGLQLLLKPGTERGH
FT                   VAIRLVIGVGLDDFDCNEKELPHLLEHLLFSGIDATGEGGLEERMQALGGDWNAFTSNA
FT                   DTTFVIEAPAKNQRKVLDLLLDLLTQTRFDDNAINAAKRVVEREDGGHYTRLQRFLDRQ
FT                   DLGHTASNQLAVELGLKCPQRAEVDGLTREQLDKVRKAWYAPNNMTLIVVGDLDKLLPA
FT                   YLERAWGTLEAVDPSEHRPLPDIRASAAHERTITRGFIGNSAKLHWLVPEPVLDDQYDE
FT                   TFDLLKEYLEWALYRQLRLNHGLSYGPWAEREVFGGVGFMSLNADLDRGDIAEAEQVLE
FT                   DLKAGLLKNGLDADTFNRLKQAAIAHQAWAVQGTSALADYYWSALGDYEDGRFADPARE
FT                   LQGVTLEAANKAMRELLLQPGYLRIEKPLLSDDQVLWLLAGGLGVLVLILLGWHLHRRN
FT                   SVDPE"
FT   sig_peptide     38602..38658
FT                   /locus_tag="Pfl01_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            40070..41098
FT                   /locus_tag="Pfl01_0036"
FT   CDS_pept        40070..41098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0036"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71780"
FT                   /db_xref="GOA:Q3KKC6"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC6"
FT                   /protein_id="ABA71780.1"
FT                   /translation="MSKLTLLIQRILELMKRYPGVIALGGFISGVGSFILVDRQQGLAS
FT                   WITTIMLLSWIWLMLENSLTRLFTRIFKREIPQPLLRYATQMIHQESLFFVLPFFFITT
FT                   TWNSGQLFFTGLLCIAALISIVDPLYYKWLAPRRWAFLALHTLTLFAALLTALPVIMHL
FT                   TTSQSFKWALGIAVLLSFPSLASIFPIRTVRNALAILCITVGIGGVGWVLRSWVPPATL
FT                   WMTDVAISTQVQDRVPGASLKEVSAEQIRGGGLYAYTAINAPRGLDERIYHVWQFNGKE
FT                   VDRIALDIHGGRKEGYRAWTHKQNFPGNPAGKWQVRVLTEDGQVIGVLRFEVTDSTPTK
FT                   EK"
FT   gene            41154..42302
FT                   /locus_tag="Pfl01_0037"
FT   CDS_pept        41154..42302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0037"
FT                   /product="putative ABC transport system, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71781"
FT                   /db_xref="GOA:Q3KKC5"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC5"
FT                   /protein_id="ABA71781.1"
FT                   /translation="MTSSPTTGSARLDTSITPARLRVTGDWTLAHYAELKQLSETLNGQ
FT                   YDANTPIDLNGLGALDTAGASLLVELLGSERLGKSAEHPDCTISSADRALLQTVYRSLT
FT                   DFCVPIKEPEISVSVQLLTRIGRAVDTVWQDTLQLLGFVGLILETIARSLFRPKRWRIT
FT                   PMIAHIEQTGLDAAPIVALLTFLVGAVVAFLGATVLASFGASVFTVDLVGFAFLREFGV
FT                   LLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLGLDPMELLVVPRVLALLVALPMLTF
FT                   LAMICGIVGGAVVCAVSLDISPAMFLSLLQSDIGIQHFLVGLVKAPIFAFLIAAIGCLE
FT                   GFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAALFFMEMGW"
FT   gene            42299..43102
FT                   /locus_tag="Pfl01_0038"
FT   CDS_pept        42299..43102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0038"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71782"
FT                   /db_xref="GOA:Q3KKC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC4"
FT                   /protein_id="ABA71782.1"
FT                   /translation="MSRLPRTPSEAVIEVRGLCNRFGHQSVHENLDLDLYKGEILAVVG
FT                   GSGSGKSVLLRSIVGLRRPSEGMVKVFGQNLPSLPEHERSLIERRFGVLFQKGALFSSL
FT                   TVTENVALPLIEHAGLSRDDAEHLAAVKLALAGLPLSAADKYPASLSGGMIKRAALARA
FT                   LALDPDILFLDEPTAGLDPIGAAQFDQLILTLRDALGLSVFLVTHDLDTLYTITDRVAV
FT                   LAQKKVLVAGPIDVVSETDDAWIHEYFHGPRGRSALDAATQLNEV"
FT   gene            43104..44042
FT                   /locus_tag="Pfl01_0039"
FT   CDS_pept        43104..44042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71783"
FT                   /db_xref="GOA:Q3KKC3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC3"
FT                   /protein_id="ABA71783.1"
FT                   /translation="METRAHHVLIGLFTVIVVAGALLFGLWLAKSSVDTEFKDYEVVFN
FT                   EAVSGLSRGSPVQYSGIKVGDVVSLRLDPKDPRRVLARIRLAGDTPVKEDTEAKLALAG
FT                   ITGTSIIQLSGGTPQSSKLKGHDGNLPTIVASPSPISRLLSDSNDLMSGVTTLLSNANQ
FT                   MFSADNIERVSKTLEHLEQTTGSINDQRGDLRQAMQQLATVGKQAGNMLEQTSALMRNA
FT                   NGLLNDQGKQALGSAEQAMKSLEQSSVTINGLLSKNQNSLDSGMQGLNGLAPAIRELRE
FT                   TLNSLRAISQRLEANPSGYLLGSDKNKEFTP"
FT   gene            44039..44665
FT                   /locus_tag="Pfl01_0040"
FT   CDS_pept        44039..44665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0040"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71784"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC2"
FT                   /protein_id="ABA71784.1"
FT                   /translation="MKLTRLALLAGFTLISACSILPKSEPLDVYRLPAAQAPASAGSSA
FT                   TQHWSLRLNKLQASEALNRPSIAVIPQGDVISSYKASRWSDPAPVLVRNRLLDGFQRDG
FT                   RVSLLSTDDSNFQADLELGGSLQAFQTEYQGTQASVVVRVDALLVRGYDQRILASRRFE
FT                   ERQPLSDVQVPAVVAGFGQASDRLTAKVVAWAVEQGQKVAPPARP"
FT   sig_peptide     44039..44113
FT                   /locus_tag="Pfl01_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.814 at
FT                   residue 25"
FT   gene            complement(44669..45898)
FT                   /locus_tag="Pfl01_0041"
FT   CDS_pept        complement(44669..45898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71785"
FT                   /db_xref="GOA:Q3KKC1"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC1"
FT                   /protein_id="ABA71785.1"
FT                   /translation="MLNGLWLGFFVVAAVSALGQWLIGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVEWLAKVLGPLFLRLMPEVPAGHPALGLITLNFA
FT                   ANGLGLDNAATPIGLKAMKALQELNPSSTIASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTLVFLPILLATSCSTIVGFLSVAFMQRLRVWDPVVLAYLIPGALILGGFMALL
FT                   ATMSATALAGLSSILGNLTLFGLIMLFLVIGALRKVKVYEAFVEGAKEGFDVAKNLLPY
FT                   LVAMLCAIGVLRASGALDFGLDGIRHLVEWAGWDTRFVDALPTAMVKPFSGSAARAMLI
FT                   ETMKTSGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRARHAVGCALLAELAGVLG
FT                   AIGVCYWFFG"
FT   sig_peptide     complement(45839..45898)
FT                   /locus_tag="Pfl01_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.972 at
FT                   residue 20"
FT   gene            complement(46001..47332)
FT                   /locus_tag="Pfl01_0042"
FT   CDS_pept        complement(46001..47332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0042"
FT                   /product="proton glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71786"
FT                   /db_xref="GOA:Q3KKC0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC0"
FT                   /protein_id="ABA71786.1"
FT                   /translation="MKKAKLSLAWQILIGLVLGIAIGALLNHFSAEKAWWISNVLQPAG
FT                   DIFIRLIKMIVIPIVISSLIVGIAGVGDAKKLGRIGLKTIIYFEIVTTIAIVVGLLLAN
FT                   LFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETILNLIPSNIFAAMARGEMLPII
FT                   FFSVLFGLGLSSLQSDLREPLVKMFQGVSESMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FASLLPLAKLVILVYVAIAFFAFVILGLIAKMFGFSVIKLMRIFKDELVLAYSTASSET
FT                   VLPRVIEKMEAYGAPKAICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSISQQL
FT                   LLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRVMDMARTALNVIG
FT                   NALAVLVIARWEGMYDDAKGQRYWNSLPHWRSKEKLPAGDVSKN"
FT   sig_peptide     complement(47231..47332)
FT                   /locus_tag="Pfl01_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.317 at
FT                   residue 34"
FT   gene            complement(48030..48494)
FT                   /locus_tag="Pfl01_0043"
FT   CDS_pept        complement(48030..48494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71787"
FT                   /db_xref="GOA:Q3KKB9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB9"
FT                   /protein_id="ABA71787.1"
FT                   /translation="MKGLKTLAAALLLGGSAMAMAANDGQARVNELLSSDPQYRETWEG
FT                   VVKKEERLPEWVMNLSGAPDQQMNAVTEDGDQYLVGPLCESQDKCLNHRLIVAFSFDKK
FT                   HAYAMLVDVPEGLPADKSPTRHATYRFLGKPDQGMQDLLMETLKKDPNWY"
FT   sig_peptide     complement(48429..48494)
FT                   /locus_tag="Pfl01_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            complement(48497..48661)
FT                   /locus_tag="Pfl01_0044"
FT   CDS_pept        complement(48497..48661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71788"
FT                   /db_xref="GOA:Q3KKB8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKB8"
FT                   /protein_id="ABA71788.1"
FT                   /translation="MLSWAITFLIIAIIAAVLGFGGIAGTATGIAKILFVVFLVMFIAS
FT                   FFFGRRGRG"
FT   sig_peptide     complement(48581..48661)
FT                   /locus_tag="Pfl01_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.487 at
FT                   residue 27"
FT   gene            complement(48729..49013)
FT                   /locus_tag="Pfl01_0045"
FT   CDS_pept        complement(48729..49013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71789"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB7"
FT                   /protein_id="ABA71789.1"
FT                   /translation="MTRPRAAQMRISPLHLQQALFGALALLITLIACQQYLRWEHSQQP
FT                   EPLISMQHATQTHFSAVSSSQADNGAMRMMDVDQPQPLGDMPREERWVF"
FT   gene            49441..50787
FT                   /locus_tag="Pfl01_0046"
FT   CDS_pept        49441..50787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0046"
FT                   /product="alginate biosynthesis transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71790"
FT                   /db_xref="GOA:Q3KKB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB6"
FT                   /protein_id="ABA71790.1"
FT                   /translation="MESATEHQGRILLVDDESAILRTFRYCLEDEGYTVATANSAAQAD
FT                   ALLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMKVVLETARQ
FT                   VAGTDANILILGESGTGKGELARAIHGWSKREKKSCVTINCPSLTAELMESELFGHSRG
FT                   AFTGASESTLGRVNQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEDMVRDGRFREDLLYRLNVITLHLPPLRERAEDILTLADRFLARFVKEY
FT                   ARPARGFSDEAREALLGYRWPGNIRELRNVVERASIICPQERVEISHLGMAEQPANNAP
FT                   RVGAALSLDELEKAHIGAVLATAGTLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            50798..52588
FT                   /locus_tag="Pfl01_0047"
FT   CDS_pept        50798..52588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0047"
FT                   /product="putative two-component system, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71791"
FT                   /db_xref="GOA:Q3KKB5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB5"
FT                   /protein_id="ABA71791.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLMLGLVSVMQMAGTQEALIR
FT                   NNFVTLDLGLKLRQTLGDQLIMMLAEKPDPVAFEASKQHYFQLLDEGIAQEQKDDDRQY
FT                   GFSQAKADYLSFLQAFDISRDPAAALSGGGDLRERFNTLRNGLITEHKHALNNINSVQH
FT                   AARDRALLIAGLLGLVGLAVLIIGFVTAQGIARRFGAPIEALAKAADNIGQGNFEVTLP
FT                   VSSAMEINLLTRRFGLMAEALREHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRQGRL
FT                   EHLNPVAQRQLGWDSDRFGEGLGTALQRPELDAQLQLVLRGGTLERAPEDLSIEVDGES
FT                   RLLTYSLTPVSHTQGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAF
FT                   GLFRERAKFPEESRESDLLDTVNEEMQRLMQLINDLLNFSRYQSGLQKLTLAPCSIEEL
FT                   LERARLRFADSAAQKGVALNVEAQGSLPRLQADQAQLDRVLDNLIDNALRHTARDGLIR
FT                   LQARRHGERVIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGG
FT                   RMGVYSRPGQGTQFYMALAV"
FT   sig_peptide     50798..50911
FT                   /locus_tag="Pfl01_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 38"
FT   gene            complement(52585..54201)
FT                   /locus_tag="Pfl01_0048"
FT   CDS_pept        complement(52585..54201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71792"
FT                   /db_xref="GOA:Q3KKB4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB4"
FT                   /protein_id="ABA71792.1"
FT                   /translation="MMVATRETLRSWFYRPWFLAMIAAVLSASLLITGGLFVAMRQVEQ
FT                   SESQEMNAQGERFLARLEQLFGQLRESLDDLEAQPLRSCDDEMIATLQQVTFNYRFVYE
FT                   AAYMDATRICSNRPRQEGLSVIRPPDIKGPTYSYWLNTTTEPDENRAALMLGRGNFRVA
FT                   TSRGHLTDMVDLSPGSSLLVVLDHGTRAIPVLGVPQAWPPTEPWPPKTPNALQVTQSHL
FT                   IYRMPTDNPEYQLVLISPRTGMHIPELWWWMVPFCLVLGAFVGVLVFWIVRQRQSLDAE
FT                   LHGAIRRGELQVLYQPIFDLDSRNCVGAEALLRWRRPDGTLTSPDLFIPMAENTGQIRQ
FT                   MTDFVLQRLLEQLGQLLRANPQLYISVNLAACDVMVPRIGQVMARLLTLHRVAARQIAF
FT                   EVTERGLIDVVVARENLQALRDVGHQVLIDDFGTGYCSLAYLQTLPVDCLKIDKAFIDA
FT                   LGHDAASSGVAPHIIHMAQALDLKVIAEGIEFESQAALLSSEGVKFGQGWLFAHALSAV
FT                   QFIELITRGRRLAGRRLDDEA"
FT   sig_peptide     complement(54085..54201)
FT                   /locus_tag="Pfl01_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.654 at
FT                   residue 39"
FT   gene            complement(54274..55053)
FT                   /locus_tag="Pfl01_0049"
FT   CDS_pept        complement(54274..55053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0049"
FT                   /product="putative membrane-bound
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71793"
FT                   /db_xref="GOA:Q3KKB3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB3"
FT                   /protein_id="ABA71793.1"
FT                   /translation="MKFFTLLASLLLLAGCASGPRFDTSHPSVNHDSRVQFVIVHYTSA
FT                   SLERSLQLLTHGEVSSHYLIGDDKSATIYKLMDENLRAWHAGESEWQGRTWLNSSSIGI
FT                   EIVNPGFKDTPTGRLWYPYSEAQVQSLIVLLKDISKRQGISPRHIIGHSDIAPLRKLDP
FT                   GPLFPWKRLAAEGLGLWPNEQAVARQQAQFDAELPSITWFQSQLARLGYSTPQTGELDV
FT                   ATRHVLAAFQMHYRPARFDGTPDAQTAALLLVLNQTK"
FT   sig_peptide     complement(54976..55053)
FT                   /locus_tag="Pfl01_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.634 at
FT                   residue 26"
FT   gene            complement(55155..57245)
FT                   /locus_tag="Pfl01_0050"
FT   CDS_pept        complement(55155..57245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0050"
FT                   /product="conserved GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71794"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB2"
FT                   /protein_id="ABA71794.1"
FT                   /translation="MSDEAQRWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAE
FT                   GTDRVVDQCMKEMRDVVRTDDMDAGLAALLPRLEKAVLDSEQRRETRIEQVSTALTALV
FT                   TQLQSLPLPREVAQPLKKFAKQLDGRVSQAREMPLLLSELSGLQGKALSQLATPTEPGR
FT                   PGLLQRLFGSRDSEETPAQVAQAPAVTPSVQPEQPPVTHEAVPAPQAPVTSAEQVATAP
FT                   VSPALIAAPVAEPSKAPEPIPEDFTEPEVVAFEPARILTEAPSAPSEPEPVEPESKLQP
FT                   FTPPPVFAPAVPTAINPDELILPGDTPPPVILDSLPLPEPIAQALAAIDPEQSEHDILY
FT                   ALPDSPEPSYSSVARHIEDTLIGLLDDLTLPERHRPQAEAMRDRLKNGLNWYELLPILD
FT                   DLATLMLAITDSGQHEFEAYLQQLNERLEAFQSNLQAASEGHADNSSAARAMDTQIREQ
FT                   VDGLQTSVQEAADLNDLKQVLENHLEGLLGTMDQHQKQRDAREQEVAGRLKSLAERVAH
FT                   MEQEALGYREHLEEQRQKALIDPLTGLPNRAAWTERLEHEIAQWQQHGNTLSLAMLDLD
FT                   HFKRINDNYGHLAGDKVLKIIATVLRKRMRGNDFIARFGGEEFVLLLPATPPAVGAKLL
FT                   ENLRASIEACPFHFKGERVTITISMGLAAFRPGEHSDLVLKRADQALYRAKNAGRNRVE
FT                   LG"
FT   gene            complement(57242..58120)
FT                   /locus_tag="Pfl01_0051"
FT   CDS_pept        complement(57242..58120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0051"
FT                   /product="putative endonuclease/exonuclease/phosphatase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71795"
FT                   /db_xref="GOA:Q3KKB1"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB1"
FT                   /protein_id="ABA71795.1"
FT                   /translation="MRRWGTERVVGLHEPQVNEHHLESTGLPADSRLRLLSFNIQVGIS
FT                   TERYRHYLTRSWQHLLPHPGRSSNLQKIGNLLGDFDLVALQEADGGSLRSGYVNQVEHL
FT                   AQLGAFPYWYQQLNRNLGRLAQHSNGVLSRLRPWAIEDHPLPGPKGRGAILVRFGEGPE
FT                   ALVVVMMHLALGARVRSMQLAYIRELIGGYKHQVLMGDMNTHASDLLQHSPLRDLGLLA
FT                   PQLEATFPSWRPQRCLDHILLSPTLTLEKVEVLAQPISDHLPVAVEIRLPGSLTADALP
FT                   ALSTALRGTPE"
FT   gene            complement(58135..58776)
FT                   /locus_tag="Pfl01_0052"
FT   CDS_pept        complement(58135..58776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0052"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71796"
FT                   /db_xref="GOA:Q3KKB0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB0"
FT                   /protein_id="ABA71796.1"
FT                   /translation="MRNLIISAALVAASLFGVTAQAAEAPAAPYVELSNPVPVAVPGKI
FT                   EVVELFWYGCPHCYAFEPVINPWVEKLPSDVNFVRIPAMFGGPWDAHGQMFLTLEAMGV
FT                   EHNVHAAVFNAIQKEHKKLTDKNDMADFLATQGVDKDKFLATFDSFAIKGQIVKARELA
FT                   KKYEISGVPTMIVNGKYRFDIGSAGGAEQALKLADQLVAKERATNKAAAN"
FT   sig_peptide     complement(58708..58776)
FT                   /locus_tag="Pfl01_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(58977..59588)
FT                   /locus_tag="Pfl01_0053"
FT   CDS_pept        complement(58977..59588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0053"
FT                   /product="cytochrome c4 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71797"
FT                   /db_xref="GOA:Q3KKA9"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA9"
FT                   /protein_id="ABA71797.1"
FT                   /translation="MNKLIVSLLLTVGISGFAHASGDAAAGQAKAAVCGACHGPDGNSM
FT                   APNFPKLAGQGERYLTKQLHDIKSGKRTVLEMTGLLTNLSDQDLADIAAYFASQKGSVG
FT                   AADPKIVARGEALFRGGNLEKGLPACTGCHSPNGAGNAAAGFPHLGGQHAQYIAKQLTD
FT                   FRKEEAGRNNDGDAMTMRTIARKLSDEDIAAVSSYIQGLH"
FT   sig_peptide     complement(59526..59588)
FT                   /locus_tag="Pfl01_0053"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 21"
FT   gene            complement(59621..59893)
FT                   /locus_tag="Pfl01_0054"
FT   CDS_pept        complement(59621..59893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0054"
FT                   /product="putative cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71798"
FT                   /db_xref="GOA:Q3KKA8"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA8"
FT                   /protein_id="ABA71798.1"
FT                   /translation="MPLYSAQATQDPEAVYNRVCGACHSGQLPMAPKRGDQAAWTPRLA
FT                   KGMETLVQHVTQGFKAMPPRGLCMDCSAEDYQALILWMSESKPGP"
FT   gene            60118..60762
FT                   /locus_tag="Pfl01_0055"
FT   CDS_pept        60118..60762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0055"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71799"
FT                   /db_xref="GOA:Q3KKA7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKA7"
FT                   /protein_id="ABA71799.1"
FT                   /translation="MQLKNPILGLCQQSTFMLSAAKVDQCPDDEGFEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFKLDDERRLVDLPGYGYAKVPIPLKQHWQRHLE
FT                   AYLGGRESLKGLILMMDIRHPMTDFDLLMLDWAVAAGMPMHILLTKADKLTYGAAKNTL
FT                   LKVQSEIRKGWGDQVTIQLFSAPKRMGLEEAYTVLAGWMELADKGAELPAE"
FT   gene            complement(61047..63854)
FT                   /locus_tag="Pfl01_0056"
FT   CDS_pept        complement(61047..63854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0056"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71800"
FT                   /db_xref="GOA:Q3KKA6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA6"
FT                   /protein_id="ABA71800.1"
FT                   /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGLPTGAVKGVLNMLKS
FT                   LRKQYPDSPFAVVFDAKGGTFRDEMYAEYKANRPSMPDDMRVQIEPLHQSVIALGFPLL
FT                   CVEGVEADDVIGTLARSSAAADRPVIISTGDKDMAQLVDGHITLVNTMSGSSMDVDGVK
FT                   EKFGVAPEQIIDYLALMGDSSDNIPGVPGIGPKTASGLLVGVNGGLTELYAQLDIVPTL
FT                   PIRGAKTLPAKLEEHKEMAFLSYQLATIKVDVPLDIGLDDLQMGPEDPAKLYELYTLLE
FT                   FKSWLNDLDRDAKRQELSAAAEPVPAGDLFSAPAEEEAPAAPAEAAYETILDQARFDVW
FT                   LEKLKNAKLFAFDTETTGIDAQQAQLVGLSFAVQANEAAYIPLTHSYIGVPEQLDRDTV
FT                   LRALKPILEDPNKLKVGQHAKFDMNILANCAIGGDQNEGITVRGIAFDTMLESYVLNST
FT                   ATRHDMDSLAQKYLDHTTVSFQDIAGKGAKQLTFDQIALEQAGPYAAEDADVTLRLHQT
FT                   LFDKLSAIPSLASVLTDIEIPLVPVLARIERQGAFVDAELLGIQSIELGNKMIALEREA
FT                   FEIAGEEFNLGSPKQLGVILYEKLGLPVLKKTAKGQPSTAEEVLAKLAEDDHRLPKVLM
FT                   EHRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVASTGRLSSSDPNLQNIPVRTAEGR
FT                   RIRQAFVAPKGYKLLAADYSQIELRIMAHLSRDEGLMNAFRNNLDVHTATAAEVFKVEL
FT                   NEVTSDQRRGAKAINFGLIYGMGAQKLGKDIGVDTKTAKAYIDTYFARYPGVREYMDRT
FT                   RAQAADQGFVETIFGRRLYLPDINSNKPQERAAAERTAINAPMQGTAADIIKKAMVAVD
FT                   NWLCASGLDAKVILQVHDELVLEVREDLVDQVREEIRVHMSEAAKLDVPLLVEVGVGNN
FT                   WDEAH"
FT   gene            63929..64225
FT                   /locus_tag="Pfl01_0057"
FT   CDS_pept        63929..64225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71801"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA5"
FT                   /protein_id="ABA71801.1"
FT                   /translation="MRTLNRLLLVSLIAVSPLAAIAADDAPSSEPEVTISTHTEGDKVI
FT                   QEYSRSGFVYAIKVTPKGGKPYFLVRADGTDANYIRSDQPDMLIPSWEIFTWK"
FT   sig_peptide     63929..63997
FT                   /locus_tag="Pfl01_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            64287..65240
FT                   /gene="thrB"
FT                   /locus_tag="Pfl01_0058"
FT   CDS_pept        64287..65240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="Pfl01_0058"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71802"
FT                   /db_xref="GOA:Q3KKA4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA4"
FT                   /protein_id="ABA71802.1"
FT                   /translation="MSVFTPLARPELETFLAPYGLGRLLDFQGIAAGSENTNFFISMEK
FT                   GEFVLTLVERGPVQEMPFFIDLLDVLHEADLPVPYALRTTDGVALRELKGKPALLQPRL
FT                   AGKHIKQANAQHCAQVGDLQAHLHLATQGDNMIKRKTDRGLDWMLEEGTQFLSHLSDEP
FT                   RALLQKALDEITQQREKILALPRANIHADLFRDNAMFEGTHLTGLIDFYNACSGPMLYD
FT                   VAIALNDWCSDDNGLIDGPRARAFLGAYAALRPFTAAEAELWPTMLRVACVRFWLSRLI
FT                   AAESFAGQDVLIHDPKEFEQRLAQRQTVSTPLPFAL"
FT   gene            complement(65282..66211)
FT                   /locus_tag="Pfl01_0059"
FT   CDS_pept        complement(65282..66211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0059"
FT                   /product="putative zinc ABC transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71803"
FT                   /db_xref="GOA:Q3KKA3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA3"
FT                   /protein_id="ABA71803.1"
FT                   /translation="MVIVSRLFSVFVVFITGFLLIGPAQAEVRVLTSIKPLQLIAAAVQ
FT                   DGVAIPEVLLPPGASPHNYALRPSDVRKVQSVDLLYWIGPDMEGFLPRVLNGRTLPSVA
FT                   VQDLPGMKLRRFAADSHSHAEEADEHDHDHRPGSLDAHLWLSPVNARVIADKMAADLSA
FT                   ADPANAERYQSNAKAFDERLDALDQRLKKRLASVEGKPYFVFHEAFDYFEDAYGLKHTG
FT                   VFSVAAEVQPGAQHVAAMRARLQEVGKTCVFSEPPLRPRLAETLVAGLPVKLAELDALG
FT                   GYTPATAQGYEQVLEKLGNDLAGCLESL"
FT   sig_peptide     complement(66131..66211)
FT                   /locus_tag="Pfl01_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            66269..66751
FT                   /locus_tag="Pfl01_0060"
FT   CDS_pept        66269..66751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0060"
FT                   /product="putative zinc transport-related regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71804"
FT                   /db_xref="GOA:Q3KKA2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA2"
FT                   /protein_id="ABA71804.1"
FT                   /translation="MPITPIASRPHDHSHCVHSALSEADALCAQKGLRLTALRRRVLEL
FT                   VWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRISSLNAFVGCVHPK
FT                   HSHQGQFLICRECHAAIELEQKTISDAIVHSAKDVGFIVEAQTVEVVGLCSGCRGA"
FT   gene            66751..67536
FT                   /locus_tag="Pfl01_0061"
FT   CDS_pept        66751..67536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0061"
FT                   /product="high-affinity zinc ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71805"
FT                   /db_xref="GOA:Q3KKA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKA1"
FT                   /protein_id="ABA71805.1"
FT                   /translation="MSDALIRLEKVAVRFAGQNVLDNIHLSVEPGQIVTLIGPNGAGKT
FT                   TLVRAVLGLLKPDSGSVWRKPKLRVGYMPQKLHVDPTLPLSVLRFLRLVPGVDRPRALA
FT                   ALKEVGAEHVIDSPVQSVSGGEMQRVLLARALLREPELLVLDEPVQGVDVAGQAELYSL
FT                   ITRLRDRHGCGVLMVSHDLHLVMSTTDQVVCLNRHVCCSGHPEQVSGDPAFVELFGNNA
FT                   PSLAIYHHHHDHAHDLHGSVVKGPVTGQPHVHGDSCKHG"
FT   gene            67529..68317
FT                   /locus_tag="Pfl01_0062"
FT   CDS_pept        67529..68317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0062"
FT                   /product="high-affinity zinc ABC transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71806"
FT                   /db_xref="GOA:Q3KKA0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA0"
FT                   /protein_id="ABA71806.1"
FT                   /translation="MADFLFYALLAGLALAVVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFLLDVSPTVAVTVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HEVRIDLMAYLFGDLLAISPTDLAWILGGSAAVLVLLVTLWRPLLAITVHEELARVEGL
FT                   SVAGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGM
FT                   LAVCGGLALSWFKDTPAGPSIVVTAAALFLLSFVLPRRGV"
FT   sig_peptide     67529..67588
FT                   /locus_tag="Pfl01_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.853 at
FT                   residue 20"
FT   gene            68355..69068
FT                   /locus_tag="Pfl01_0063"
FT   CDS_pept        68355..69068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0063"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK99"
FT                   /protein_id="ABA71807.1"
FT                   /translation="MKPFASRYLLLVAFSVLLGACQSTPPVAEVPDARATAIAQLEQSL
FT                   ASSELATAEDQLAALQAETPNDQSLEQYQRQLAEAYLRRSQIVLQKGDVNAAATALARA
FT                   RVLMPKAPALTGGVNGAITEARKAELEKAEAALQAAEAKPKAKVIDPTAESTTVALNIT
FT                   DSRKLRRQLDAIAADVVNYDCAVSIQAPRTNDYPWLATLITKRVKKLDPDFDLKIEKQI
FT                   LRTVPAQMVLSPRKP"
FT   sig_peptide     68355..68441
FT                   /locus_tag="Pfl01_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.976 at
FT                   residue 29"
FT   gene            complement(69108..71249)
FT                   /locus_tag="Pfl01_0064"
FT   CDS_pept        complement(69108..71249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0064"
FT                   /product="catalase HPII"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71808"
FT                   /db_xref="GOA:Q3KK98"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK98"
FT                   /protein_id="ABA71808.1"
FT                   /translation="MSTKKPANDKSQLAGTDTPDRANTNAKLDSLEKFRSDATGQALRT
FT                   NQGVKVADNQNTLKAGARGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGFFQSY
FT                   ENHSTLTKAGFLQDPGKKTPVFVRFSTVQGPRGSGDTVRDVRGFAVKFFTDEGNFDLVG
FT                   NNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVIWAMSD
FT                   RAIPKSLRSMQGFGVHTFRLINAEGKSRFVKFHWRPTAGTCSLVWDEAQKLAGKDTDYH
FT                   RRDLWEAIEMGDYPEWELGVQVIEEENEHDFDFDILDPTKLIPEEIVPITPLGKMTLNR
FT                   NPDNFFAETEQVAFCPGHIVPGIDFSNDPLLQGRLFSYTDTQISRLGGPNFHELPINRP
FT                   VAPFHNGQRDAQHRTVIDKGRASYEPNSIDGGWPKETPPAAQDGGFESYPERIDANKIR
FT                   QRSESFSDHFSQARLFFNSMSAHEKEHIIAAYSFELGKVEREFIRARQVNEILANIDLE
FT                   LAKRVAANLGLPAPGKGTVDVPKTSLDRSPSLSQANLLPENIKTRKVAILAANGVDGAA
FT                   IDAMKKALAAEGAHAKLLGPTSAPVKTADGKSLAVDASMEGLPSVAFDAVFVPGGAASV
FT                   KALSGDGVALHYLLEAYKHLKAIALQGEAKQLLDVLKLEADAGLLEGKDVGALTKPFFS
FT                   AIGQHRVWDREAKAKAIPA"
FT   gene            71510..72517
FT                   /locus_tag="Pfl01_0065"
FT   CDS_pept        71510..72517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0065"
FT                   /product="D-methionine ABC transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71809"
FT                   /db_xref="GOA:Q3KK97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KK97"
FT                   /protein_id="ABA71809.1"
FT                   /translation="MIEFQNVHKTYRVAGKDITALHPTSFSIENGQVFGLIGHSGAGKS
FT                   TLLRLINRLEQSSGGKIIVDGEEVTALDANGLRRFRQQVGMIFQHFNLLASKTVADNVA
FT                   LPLTLAGELSRAEIDQRVAELLARVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKIL
FT                   LCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVGVMDAGVIVE
FT                   QGSVADVFLHPKHPTTKRFVQESEQIDESEQRDDFAHVPGRIVRLTFQGEATYAPLLGT
FT                   VARETGVDYSILAGRIDRIKDIPYGQLTLAVTGGDMDAAFARFTAADVHMEVLR"
FT   gene            72517..73191
FT                   /locus_tag="Pfl01_0066"
FT   CDS_pept        72517..73191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0066"
FT                   /product="D-methionine ABC transport system, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71810"
FT                   /db_xref="GOA:Q3KK96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK96"
FT                   /protein_id="ABA71810.1"
FT                   /translation="MEDLMSFFTNIDWYEIWLATGDTLMMLGGSLLFTVLLGLPLGVLL
FT                   FLCSPRQLLEAKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPLV
FT                   VGATPFFARLVETALREVDRGIIEATQSMGATTRQIIMNALLPEARPGIFAAITVTAIT
FT                   LVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMIVTVVLLLILVQVLQMVGDRLVVHFS
FT                   RK"
FT   gene            73266..74039
FT                   /locus_tag="Pfl01_0067"
FT   CDS_pept        73266..74039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0067"
FT                   /product="putative D-methionine ABC transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71811"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK95"
FT                   /protein_id="ABA71811.1"
FT                   /translation="MKKLIVALAAVAAFSAHADETLTVAATPVPHAEILEFVKPALAKE
FT                   GVDLKVKVFTDYVQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTSLVSVTGVHLEPLGA
FT                   YSSKFKKIEELPSGANVVIPNDATNGGRALLLLAKAGVITLKDPNNILSTVKDIAQNPK
FT                   DLKIRELEAATIPRVLTQVDLALINTNYALEAKLDPSKDALVIEGSDSPYVNILVSRAD
FT                   NKDSDAMKKLAAALHSPEVKKFITEKYKGAVLPAF"
FT   sig_peptide     73266..73322
FT                   /locus_tag="Pfl01_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   repeat_region   complement(74052..74079)
FT                   /note="Left IR of the IS element; not perfect repeat of
FT                   other end"
FT   gene            complement(74089..74886)
FT                   /locus_tag="Pfl01_0068"
FT   CDS_pept        complement(74089..74886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0068"
FT                   /product="putative transposase for insertion element
FT                   IS1669"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71812"
FT                   /db_xref="GOA:Q3KGL6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KGL6"
FT                   /protein_id="ABA71812.1"
FT                   /translation="MGISRQAYYKRNRACDARARHAQEVMGFVREKRLRQPRLGTRKLH
FT                   NLMHTEPEVSVKVGRDRLFDILRDRRELVPRRRAYHKTTDSHHRFRRHPNLLKDGPIQV
FT                   VAKAPEQVWVADITYLPTQTGVAYLSLITDAYSRKIVGHHVHESLHTESVIQAFNKALK
FT                   QRTTKQCLVHHSDRGVQYCSELYQRLHAKYGITCSMTDGYDCYQNALAERVNGILKNEL
FT                   LLHRPKNFAEAIRMVDESVQIYNNERPHLSLKYKTPDAVHRAF"
FT   gene            complement(74910..75311)
FT                   /locus_tag="Pfl01_0069"
FT   CDS_pept        complement(74910..75311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0069"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71813"
FT                   /db_xref="GOA:Q3KGL7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KGL7"
FT                   /protein_id="ABA71813.1"
FT                   /translation="MNTGKRRSQRDYTRTFKLSVVDQVEKGELSYKEAQERYGIQGKST
FT                   VLNWLRRHGRQDWSQGASIRSKRPRSMDEPDKPLTPEQRIKELEEKLAQANQKAQFFEA
FT                   VVDVLKNDFGVSVVKKRSGKSSPKGRSKT"
FT   repeat_region   complement(75337..75364)
FT                   /note="Right IR of the IS element; not perfect repeat of
FT                   other end"
FT   gene            complement(75636..76271)
FT                   /locus_tag="Pfl01_0070"
FT   CDS_pept        complement(75636..76271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0070"
FT                   /product="putative copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71814"
FT                   /db_xref="GOA:Q3KK92"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK92"
FT                   /protein_id="ABA71814.1"
FT                   /translation="MTRTQKTVFILVAVIALILGLTVNKVLSGKGQGDPTALIDAGIIL
FT                   LPQSRNLPDVTMTNQDGQPVTVNELKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPK
FT                   DAVDKLQIVLVSVDPNRDNPAQLKQYLGYFDPQFIGLTPKSIDELQKVANAVSIPFIPA
FT                   DTSKPNYTVDHSGNLAVIGPDGTQRGFIRAPLNNAKLVAQLPVMLNRK"
FT   sig_peptide     complement(76185..76271)
FT                   /locus_tag="Pfl01_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.495 at
FT                   residue 29"
FT   gene            complement(76268..77158)
FT                   /locus_tag="Pfl01_0071"
FT   CDS_pept        complement(76268..77158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0071"
FT                   /product="putative protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71815"
FT                   /db_xref="GOA:Q3KK91"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KK91"
FT                   /protein_id="ABA71815.1"
FT                   /translation="MIGERPAQALWRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWT
FT                   VLVFGNLGIALCAGGAAAVNHVVDRRIDAVMARTHKRPLADGRVSPTGALTFALVLALL
FT                   GQALLLTFTNPLTAWLTLASLLGYAVIYTGFLKRATPQNIVIGGLAGAAPPLLGWTAAT
FT                   GHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGEHYTKVHILLYTF
FT                   ALLAVSLLPYVIHMSGLLYLICALGLGARFLQWAVVLYRGTRPHAAINTFKYSIWYLFL
FT                   LFIALLVDHYLLLNL"
FT   gene            complement(77155..78234)
FT                   /locus_tag="Pfl01_0072"
FT   CDS_pept        complement(77155..78234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71816"
FT                   /db_xref="GOA:Q3KK90"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK90"
FT                   /protein_id="ABA71816.1"
FT                   /translation="MAKPGFRLALFATLLALIVVLLGAYTRLTHAGLGCPDWPGCYGFI
FT                   SVPKSEAQLAHAELHYPDSPVEAHKGWNEMIHRYFAGTLGLLISILAGRAWVNRRHPGQ
FT                   PLKLPLFLLAVVFAQAAFGMWTVTLKLWPQVVTGHLLGGFATLSLLFLLTLRLSGVLPA
FT                   LTVPKRLQYWATAGLLLVIGQIALGGWVSSNYAAVACIDFPTCHGQWLPPADFANGFHL
FT                   TQHIGPNYLGGQLDSDARTAIHLTHRIGALLVTVVLLGLAWQLKVVGMTRLAGLVLIAL
FT                   GAQITLGISNVLFHLPLPVAVAHNAGGAALLLTMVLVNYHARTSLVRVRQPMIARWRLS
FT                   PRKHSAAPITIKGETPWRF"
FT   sig_peptide     complement(78139..78234)
FT                   /locus_tag="Pfl01_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.493 at
FT                   residue 32"
FT   gene            complement(78245..78811)
FT                   /locus_tag="Pfl01_0073"
FT   CDS_pept        complement(78245..78811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK89"
FT                   /protein_id="ABA71817.1"
FT                   /translation="MSEAKAPASRRRGRIQLLLIVLGVVGPMILATGMYKLQFWVPEGR
FT                   SYHGELIGNGQTRADLGIQADETRWQMLVTAPKDCAVDCQQLVYLARQIQIGLGREAGR
FT                   ASHALAAAQPLAADYEGKLTREYPQLQRYPLDAATFSKATGDKATPQLWIIDPHGNLVL
FT                   RYDPSVKGKDLLNDLRHLLKLSNIG"
FT   gene            complement(78804..79544)
FT                   /locus_tag="Pfl01_0074"
FT   CDS_pept        complement(78804..79544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71818"
FT                   /db_xref="GOA:Q3KK88"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK88"
FT                   /protein_id="ABA71818.1"
FT                   /translation="MKRFRPGVVPTLVVGLLLPLLISLGFWQLGRGAEKTALLASYAER
FT                   RAAEPMASTELLHSADPAFRRVHLHGQFDAAHSLLLDNRQRNGKVGVELLQPFQDQRSG
FT                   QWLLVNRGWLPWPDRRTAPQFNTPVDAVDVDAWVYVAPGATFQLHADPVSSTWPQTVTA
FT                   VEPTKLWKTLERDGFAYELRAEPGPASYQADWPVVAMGPEKHLGYAVQWFAMATALLGL
FT                   YLYLGWHNAKEKHHGSGHESTQHV"
FT   sig_peptide     complement(79446..79544)
FT                   /locus_tag="Pfl01_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.364 at
FT                   residue 33"
FT   gene            79617..79820
FT                   /locus_tag="Pfl01_0075"
FT   CDS_pept        79617..79820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71819"
FT                   /db_xref="GOA:Q3KK87"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK87"
FT                   /protein_id="ABA71819.1"
FT                   /translation="MLKAAIVLMLIATVVSLFSGLFFLVKDDSSSNRLVIALSVRVALA
FT                   AVTVGLIAWGFYSGQLVSHVPW"
FT   sig_peptide     79617..79676
FT                   /locus_tag="Pfl01_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.575 at
FT                   residue 20"
FT   gene            complement(79897..80784)
FT                   /locus_tag="Pfl01_0076"
FT   CDS_pept        complement(79897..80784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0076"
FT                   /product="putative cytochrome C oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71820"
FT                   /db_xref="GOA:Q3KK86"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK86"
FT                   /protein_id="ABA71820.1"
FT                   /translation="MATHEHYYVPAQSKWPIVATVGMFVTVYGLATWFNDLKAARPESH
FT                   GPLIFFVGGLLLAYMLFGWFGTVIKESRAGLYSPQLDRSFRWGMSWFIFSEVMFFIAFF
FT                   GALFYVRHISGPALGGEGTKGIAHMLWPNFQFTWPLLHTPDPKLFPPPKEVISPWGLPL
FT                   INTILLVSSSVTITIAHHALKKGHRGALKLWLAITVLLGCAFLGFQAEEYIHAYHELGL
FT                   TLGSGIYGATFFMLTGFHGAHVTIGTIILFVMLMRIMKGHFDNEHQFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVL"
FT   gene            complement(80810..81361)
FT                   /locus_tag="Pfl01_0077"
FT   CDS_pept        complement(80810..81361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0077"
FT                   /product="putative cytochrome C oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71821"
FT                   /db_xref="GOA:Q3KK85"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK85"
FT                   /protein_id="ABA71821.1"
FT                   /translation="MADSISMKKLVTRLLGVVVAMFVFGFALVPIYDVMCKAFGINGKT
FT                   AGQYEGEQTVDASRQVRVQFLSTNTADMPWDFYPKHDELTANPGAVNEMIFIARNPTDK
FT                   PMSAQAVPSIAPSNAAAYFHKTECFCFTQQVLQPGQQIEMPVRFIVDRDMPKDVKHLTL
FT                   SYTLFDITARHPPVAANTGG"
FT   gene            complement(81389..82981)
FT                   /locus_tag="Pfl01_0078"
FT   CDS_pept        complement(81389..82981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0078"
FT                   /product="putative cytochrome C oxydase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71822"
FT                   /db_xref="GOA:Q3KK84"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK84"
FT                   /protein_id="ABA71822.1"
FT                   /translation="MSAVIDDHGHADHDHAHGPAKGLMRWVLTTNHKDIGTLYLWFAFC
FT                   MFLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLVMVFGAVMPAFVGLANWMIPL
FT                   MVGAPDMALPRMNNFSFWLLPAAFLLLVSTLFTAGGGPNFGWTFYAPLSTTYAPESVTF
FT                   FIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   CVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSQIIPTFSR
FT                   KPLFGYTSMVYATASIAFLSFIVWAHHMFVVGIPLVGELFFMYATMLIAVPTGVKVFNW
FT                   ASTMWQGSMTFETPMLFAVAFVILFSIGGFSGLMLAIAPADFQYQDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFVGMNLTFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKTIRGGEPAPAKPWDGAEGLEWSVPSP
FT                   APYHTFTTPPEVK"
FT   gene            complement(83064..84191)
FT                   /locus_tag="Pfl01_0079"
FT   CDS_pept        complement(83064..84191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0079"
FT                   /product="putative cytochrome C oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71823"
FT                   /db_xref="GOA:Q3KK83"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK83"
FT                   /protein_id="ABA71823.1"
FT                   /translation="MMRHPHVWMGLLLWSIFSPVQAAWTVNMAPGATEISHAVFDLHMT
FT                   IFWICVVIGIIVFGAMFWSMMVHRRSTGQVAAKFHESTTVEILWTVVPLLILVAMAVPA
FT                   TATLIKMYDTSEPDIDIQITGYQWKWHYKYLGQDVEFFSNLATPAEQIHNKEAKGEHYL
FT                   LEVDKPLVLPTGAKVRFLVTSADVIHSWWVPAFAVKRDAIPGFVNEAWTRIDKPGLYRG
FT                   QCAELCGKDHGFMPIVVDVKEKADYEKWLAERKAEALQLKELTSKEWTLDELKERGDKI
FT                   YHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEAHLSIVFHGKPGTAMAAFGKQLSEV
FT                   DIAAVVTYERNAWGNNKGDMVTPKEVLELKQAESK"
FT   sig_peptide     complement(84123..84191)
FT                   /locus_tag="Pfl01_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            84561..85193
FT                   /locus_tag="Pfl01_0080"
FT   CDS_pept        84561..85193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK82"
FT                   /protein_id="ABA71824.1"
FT                   /translation="MNTAALREQIHIARQHEIETGKLTRQLEAQMQHLHPAIQLPETDA
FT                   NGVLTRFVAAYIDEVPDLLDAANEVAREAGIESQIKPVLKIAEQYFLQPPVGLDSLLDE
FT                   AYLAHRFVEEVNDLYIKHLGQPLIPLDMTVANLIAHQLIGEEFANQLDEVVHHAVDSML
FT                   DDDSFALESVEAYREKLSSPDTGAAWKRWPCMSRRLGVGLELDQPAA"
FT   gene            complement(85244..86770)
FT                   /locus_tag="Pfl01_0081"
FT   CDS_pept        complement(85244..86770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0081"
FT                   /product="putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71825"
FT                   /db_xref="GOA:Q3KK81"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK81"
FT                   /protein_id="ABA71825.1"
FT                   /translation="MRAAQLKAVLPRELLASVVVFLVALPLCMGIAIASGLPPAKGLIT
FT                   GIIGGLVVGWLAGSPLQVSGPAAGLAVLVFELVRQHGIEMLGPILLLAGFLQLVAGRLK
FT                   LGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMLDASPKPSGLDNLTAFPGAVAQALPSL
FT                   GWQAGLLGLSTIAVMWLWEKFRPHSLRFIPGALLGVGLATGASLLLALQVKRVEVPENL
FT                   AEAIDWLKPADLLSLADPTLLIAAFAVAFIASAETLLSAAAVDRMHSGPRSDFDRELSA
FT                   QGVGNMLCGLVGALPMTGVIVRSSANVQAGATTRYSTIFHGLWLLAFVLLLSSLLQSIP
FT                   VASLAGVLVYTGFKLVNLKAFRGLGRYGRMPMFTYAATALAIIFTDLLTGVLIGFGLTL
FT                   LKLAFKASRLKISLIDLPQEGEMELRLVGAATFLKVPALTQVLGSIPPGTTVHVPLNNL
FT                   SYIDHSCLELLEEWGRANAAKGAKLLIESRGLKRRLEGRIRTTTGIGAAG"
FT   sig_peptide     complement(86666..86770)
FT                   /locus_tag="Pfl01_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.945 at
FT                   residue 35"
FT   gene            complement(86861..87592)
FT                   /locus_tag="Pfl01_0082"
FT   CDS_pept        complement(86861..87592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0082"
FT                   /product="carbonic anhydrase 1"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71826"
FT                   /db_xref="GOA:Q3KK80"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK80"
FT                   /protein_id="ABA71826.1"
FT                   /translation="MSDKDKQPLAASAQAAPVAESADAALKRIVDGFLHFHHEVFPQQE
FT                   ELFKKLATAQSPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVST
FT                   AIEYAVLALGVQHIIICGHSDCGAMRAVLNPDSLEKMPTVKAWLRHAEVAKTMVHDNCN
FT                   CTDEKESMPILTEENVIAQLQHLRTHPSVASRMANGHLFIHGWVYNIETSEIKAYDADQ
FT                   GCFLPLDGSHPIPVATPKARF"
FT   gene            complement(87830..88888)
FT                   /locus_tag="Pfl01_0083"
FT   CDS_pept        complement(87830..88888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71827"
FT                   /db_xref="GOA:Q3KK79"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK79"
FT                   /protein_id="ABA71827.1"
FT                   /translation="MSTPLPPRGRGTATNPHNRFAPSRSVAEDDGWFQEVPLTQGTEVS
FT                   FETAKTIITRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDMSPGLDFETKLIAK
FT                   TNAAQLLEEQLGKKGYQCAPINLGSNTDPYQPIEREHRITRQTLEVLLRYRHPVTIVTK
FT                   GSLILRDLDLLTELAQQRLVAVMISLTTLDDELKRILEPRAAAPKARLRAIRVMREAGI
FT                   PVGVLCSPMIPMINDSEIESLLTEAHAAGAQSAAYMMLRLPLEVAPLFEEWLEAHYPQR
FT                   AAHVLSLIRQSRGGELYDSRFGTRMRGEGPFADLLAQRFAKALKRLGLNHREGFNLDCT
FT                   AFCPPGRQMALI"
FT   gene            complement(88963..90264)
FT                   /locus_tag="Pfl01_0084"
FT   CDS_pept        complement(88963..90264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0084"
FT                   /product="alcohol dehydrogenase cytochrome C subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71828"
FT                   /db_xref="GOA:Q3KK78"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK78"
FT                   /protein_id="ABA71828.1"
FT                   /translation="MKTLVIATLALLGSAAVHGAEVDQSLIKKGEYLARAGDCVACHTA
FT                   KDGKPFAGGLPMETPIGTIYSTNITPDKTGVGDYSFEDFDQALRHGVAKNGSTLYPAMP
FT                   YPSYARVSEPDMQALYAYFMHGVEPVAQENKASDIPWPLSMRWPLMGWRWLFAPKVEDY
FT                   KPASDDAVVSRGAYLVEGLGHCGACHTPRALTMQEKSLSAAEGSSFLSGSAPLEGWIAK
FT                   SLRGDHKDGLGSWSEEQLVQFLKTGRSDRSAVFGGMSDVVTHSMQYMTDADLTAIARYL
FT                   KSLPANDPADQPHQYDEKAAKALWNGDDSQRGASVYIDNCAACHRTDGHGYTRVFPALA
FT                   GNPVLQSDDPTSLIHIVLKGGTLPATHAAPSTFTMPGFAWRLSDQEVADVVSFIRGSWG
FT                   NKGAPVKAADVAELRKDDMKQTSNDDLGQVTQHN"
FT   sig_peptide     complement(90205..90264)
FT                   /locus_tag="Pfl01_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(90277..92061)
FT                   /locus_tag="Pfl01_0085"
FT   CDS_pept        complement(90277..92061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0085"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71829"
FT                   /db_xref="GOA:Q3KK77"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK77"
FT                   /protein_id="ABA71829.1"
FT                   /translation="MATVMKKVDAVIVGFGWTGAIMAKELTEAGLNVLALERGPMQDTY
FT                   PDGNYPQVIDELTYSVRKKLFQDISKETVTIRHSVNDIALPNRQLGAFLPGNGVGGAGL
FT                   HWSGVHFRVDPIELRMRSHYEERYGKSFIPKDMTIQDFGVSYEELEPFFDFAEKVFGTS
FT                   GQAWTVKGQLVGQGKGGNPYAPDRSNPFPLQAQKNTVSAQLFGKAATEVGYKPYNLPSA
FT                   NTSGPYTNPYGAQMGPCNFCGFCSGYVCYMYSKASPNVNILPALKPLPNFELRPNAHVL
FT                   RVNLDSTKTKATGVTYIDGQGREIEQPADLVILGAFQLHNVRLMLLSGIGKPYDPVSGE
FT                   GVVGRNFAYQNMATIKAFFDKNTHTNNFIGAGGNGVAVDDFNADNFDHGPHGFVGGSPM
FT                   WVNQAGSRPIAGTSNPPGTPAWGSAWKRATADYYTHQVSMDAHGAHQSYRGNYLDLDPV
FT                   YRDAYGMPLLRMTFDWQENDIKMNRFMVEKMGKIAEAMGPKAIAVIGKKVGDHFNTASY
FT                   QTTHLNGGAIMGTDPKTSALNRYLQSWDVHNVFVPGASAFPQGLGYNPTGLVAALTYWS
FT                   AKAIREQYLKNPGPLVQA"
FT   gene            complement(92064..92810)
FT                   /locus_tag="Pfl01_0086"
FT   CDS_pept        complement(92064..92810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0086"
FT                   /product="putative membrane-bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71830"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK76"
FT                   /protein_id="ABA71830.1"
FT                   /translation="MSDEDRDNPRREFLRKSLTLIPVVTLAGSGLGSTVLQAAPESAPA
FT                   TAPAKTAAVEASTYQPSYFTAEEWAFINAAVAQLIPNDAQGPGALEAGVPEYIDRQMNT
FT                   PYAAGALWYMQGPFNADAAPEMGWQSKLVPKEIYRLGIAATDQWAKSINGKTFAEQDSA
FT                   TRDDLLKQLEAGKPQFDAVPAKIFFSLLLQNTKEGFFCDPIHGGNKGMVGWTMIGFPGA
FT                   RADFMDWVERNEQYPFPAVSIRGKRA"
FT   sig_peptide     complement(92694..92810)
FT                   /locus_tag="Pfl01_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.864 at
FT                   residue 39"
FT   gene            93107..93751
FT                   /locus_tag="Pfl01_0087"
FT   CDS_pept        93107..93751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0087"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71831"
FT                   /db_xref="GOA:Q3KK75"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK75"
FT                   /protein_id="ABA71831.1"
FT                   /translation="MFLTRFSSVLCLSLLALFGWTSAQAADTLASRPVEWAQPVEVQYN
FT                   LFQMSPTLYRSALPDDGAVPLLNNLKVVTVINFLPEADSNWLKAPGIHQVQLPYRTNHV
FT                   DDSDVLKTLRAIQSAEAEGPVLMHCKHGSDRTGLMAAMYRIVVQGWSKEDALNEMTQGG
FT                   FGESGHFRDSVRYVMQADVDKLRTALANGDCSTSAFATCSMKSWFQTVNLK"
FT   sig_peptide     93107..93184
FT                   /locus_tag="Pfl01_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 26"
FT   gene            complement(93738..95780)
FT                   /locus_tag="Pfl01_0088"
FT   CDS_pept        complement(93738..95780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0088"
FT                   /product="putative oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71832"
FT                   /db_xref="GOA:Q3KK74"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK74"
FT                   /protein_id="ABA71832.1"
FT                   /translation="MPDTNPLLQHWTLPPWPAIHAEHLLPAVNSIIADNRRIIAQVIAS
FT                   QTEHPGWDDLVLSIDEADARLGEVRSILETLSMVRSDDPVWLVESAKAHLAINQYRSEK
FT                   AHNRRLYETYQRLAQSSIAGSFDEARNIALSRILRRFKQSGIELPTEQQQELARLNREI
FT                   GGLEFVFLDNLERWAEAWSKRVDDVALLTGLPPAMKDRLALAARQTGHDGWLIRLDQNT
FT                   FQHILKYAENRALREECYVAYMTRASDRGPLAGRFDNAPVLKKLLALRQQKARLLGHEN
FT                   AAQLSLAKNSAGTTAWVSGFLQRQAAQLAPTLAQDAEQLTDFAQQRGIDRVQPWDEDFL
FT                   AEQWRQQQFPGALENLRDYFPLEGTLRRLLLFCERMFGIRIVEQSGGGHLHDDVRLLEI
FT                   SEDEQVIGYIYLDPFHRDGAADFPGTFTLRNRRINAEGRPALPIALLYSNFTPASDTHP
FT                   CRLELHDLRVLFHEFGHCLQHVLTRSPHHSLSGILQLGHEAAEFSGQLFEQWCLSREFL
FT                   LWLGAHFQTGKRLSAARVDAALSASQAHSARQQAFLLMGAMIDFELHLTHGDGRSVEET
FT                   CTDVQRSLGHLQLPDDHRFANGFDYMVTQYDASVYAYVWSGVLAQEAFKRFSQDWVFNA
FT                   QTGREFRATFFAPGAGRPLLDAVEAFIGRPVAGLVDGEAGRVTSD"
FT   gene            complement(95893..96183)
FT                   /locus_tag="Pfl01_0089"
FT   CDS_pept        complement(95893..96183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71833"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK73"
FT                   /protein_id="ABA71833.1"
FT                   /translation="MSEAPVKTKKRFIAGAVCPACSEPDKLMMWSEDDVPHRECVACGY
FT                   SDTLNAQGLSVPKELGTRVNTSALKPAPDKTVQAVQFFPNPKLKKKPDEQH"
FT   gene            complement(96180..98258)
FT                   /locus_tag="Pfl01_0090"
FT   CDS_pept        complement(96180..98258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0090"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71834"
FT                   /db_xref="GOA:Q3KK72"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK72"
FT                   /protein_id="ABA71834.1"
FT                   /translation="MFLPAKVPTVSVNNPLLQSYDLPPFSAIRAEHVQPAIETILADNR
FT                   AAIAEILKTQGQNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYESCLPA
FT                   LSAYSTEMGQNRELFQAYEALANSPAAAGFDVAQKTILEHALRDFRLSGIDLPEAEQKR
FT                   YAEVQSKLSELGSRFSNQLLDATQAWTKHLTDEAALAGLTDSAKAQMAAAAQAKGLDGW
FT                   LITLEFPSYYAVMTYAQDRALREEVYAAYCTRASDQGPNAGQNDNGPVMDEILDLRQEL
FT                   AKLLGFSSFSELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAYAAEQGCADL
FT                   QSWDSGFYGEKLREQRYSVAQETLRAYFPIDKVLGGLFAIVQRLYGIEIAELKGFDTWH
FT                   PDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTVDGVLQSPVANLVCNF
FT                   TPADSGKPALLTHDEVTTLFHEFGHGLHHLLTRVEHAGVSGINGVAWDAVELPSQFMEN
FT                   WCWEPEGLALISGHYETGEPLPQDLLEKMLAAKNFQSGLMMVRQLEFSLFDFELHATHG
FT                   DGRSVAQVLEGVRNEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADAFSK
FT                   FEEDGVLNADTGRAFREAILARGGSQEPMVLFVDFRGREPSIDALLRHSGLSEDAAA"
FT   gene            98321..98866
FT                   /locus_tag="Pfl01_0091"
FT   CDS_pept        98321..98866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71835"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK71"
FT                   /protein_id="ABA71835.1"
FT                   /translation="MSLRKYQNHTPRLGQGAFVDGSAVVIGDVEIGEDSSVWPLTVIRG
FT                   DMHRIRIGARTSVQDGCVLHITHAGPFNPDGFPLLIGDDVTIAHKVMLHGCTVGSRVLI
FT                   GMGSIVMDGAVVEDDVIIGAGSLVPPGKHLESGFLYVGSPVKQIRQLTDKENAFFTYSA
FT                   ANYVKLKDLHLAEGYDQL"
FT   gene            98895..99545
FT                   /locus_tag="Pfl01_0092"
FT   CDS_pept        98895..99545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0092"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71836"
FT                   /db_xref="GOA:Q3KK70"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK70"
FT                   /protein_id="ABA71836.1"
FT                   /translation="MHYQTVLFDLDGTLTDPREGITRSIQFALSKLGIDEPDLTRLEHF
FT                   IGPPLLQAFMQFYGFDEAKAWEAVNYYRERFKVTGLYENRVFDGVTPLLETLGSQGRQL
FT                   YIATSKPWVFAREIARHFDFAKHFKVIYGSELDGTRTNKVELIAHLIAEERLDPASTLM
FT                   IGDRKHDLIGARSNGLDAAAVGYGFGSHEELSAEAPAYHFETLAELHQAFLQR"
FT   gene            complement(99549..100679)
FT                   /locus_tag="Pfl01_0093"
FT   CDS_pept        complement(99549..100679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0093"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71837"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK69"
FT                   /protein_id="ABA71837.1"
FT                   /translation="MGGIVLGRLSGGFLILIRPLPSHGLLDRVLRVLFPGVMILLLNGC
FT                   SSLSYYGQLASGQLQLLRAREPVAKVIADPARDAKLRTHLAQSQKARAFASEHLHLPDN
FT                   QSYRLYADIGRPFVVWNVFATPEFSLSPQNHCFPIAGCVAYRGYYSQSAARGEAAIQRL
FT                   QGMDVSIGGVEAYSTLGWFNDPILNSMMGWGDERLATLIFHELAHQRFYVKDDTEFNES
FT                   FATFVEQEGTRQWRAFRGLPPENDSKLKQRDQFIQLILDTRSRLEKLYAQPLATAQMRE
FT                   RKAAEFERFRHDYRMMRDGQWAGDKRYDAWVNAPLNNARLLPFGLYDQWVPAFAALFGQ
FT                   VKGDWPQFYARVEQLGKLPADKRKAALRELAALRPD"
FT   gene            100692..101114
FT                   /locus_tag="Pfl01_0094"
FT   CDS_pept        100692..101114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0094"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK68"
FT                   /protein_id="ABA71838.1"
FT                   /translation="MRMLILTGSVLTLAGCAGFGMPTPDPSQAWIDLDARQQDTALQAL
FT                   EVDNKASVDHRYFEVQPGSHELRVRYQFPVEATNIGPDAEPLWRDCQLSVKFKDFNAGQ
FT                   RYQLQAGSIGFRPWAKLYDQQRNVVGQGTPAGCQRT"
FT   sig_peptide     100692..100754
FT                   /locus_tag="Pfl01_0094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.494 at
FT                   residue 21"
FT   gene            101155..101574
FT                   /locus_tag="Pfl01_0095"
FT   CDS_pept        101155..101574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0095"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71839"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK67"
FT                   /protein_id="ABA71839.1"
FT                   /translation="MRTLMLLLAAGLLAGCQTPLPPADPNMAWVEFSTPSPGGKLLMAE
FT                   RLDNQRLTDGRFFQVTPGSHELRVRFDFEVFGGGGSLMTGPVERLCYLTIRYDHFEAGQ
FT                   RYRLEGRSLAFTPSARLYNDKREIVAEDREVNCII"
FT   gene            complement(101581..101820)
FT                   /locus_tag="Pfl01_0096"
FT   CDS_pept        complement(101581..101820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71840"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK66"
FT                   /protein_id="ABA71840.1"
FT                   /translation="MKRFALAVICGVLATSAFAAPKDCEELKQEIEIKIQANAVPSYTL
FT                   EIVSKEEAEKHDIAMIVGTCDNGTKAIIYQKNDR"
FT   sig_peptide     complement(101761..101820)
FT                   /locus_tag="Pfl01_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(101933..102364)
FT                   /locus_tag="Pfl01_0097"
FT   CDS_pept        complement(101933..102364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0097"
FT                   /product="osmotically inducible protein c"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71841"
FT                   /db_xref="GOA:Q3KK65"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK65"
FT                   /protein_id="ABA71841.1"
FT                   /translation="MAIVKKASAHWEGDLKTGIGSISTETGVLREAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMAFSMILGDAGLKADSIDTQAEVTLDQVDGGFAITAVKLILKA
FT                   KIPGATQAQFEELSNKAKEGCPVSKVLNAKISLDASLVS"
FT   gene            102608..103609
FT                   /locus_tag="Pfl01_0098"
FT   CDS_pept        102608..103609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0098"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71842"
FT                   /db_xref="GOA:Q3KK64"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK64"
FT                   /protein_id="ABA71842.1"
FT                   /translation="MKQLSDVKFSTLDLVPVRENGSPAQSLRNSLDLAQHVEKFGYTRF
FT                   WVAEHHNMDGIASSATSVLLGYLAGGTSTIRVGSGGVMLPNHAPLVIAEQFGTLESLYP
FT                   GRIDLGLGRAPGSDQMTARALRRERSGSADDFPEDVAELARYLGPRTPDQRVIAMPGTG
FT                   TNVPIWLLGSSLFSAQLAGERGLPYAFASHFAPRFMHEAIRVYRNHFKPSAVLDKPYVM
FT                   LGVPLVAADTDEQADYLATSVYQRILALMRGQSLVQRPPVKTMDGLWLPHEREAVGDFL
FT                   GLAMVGSPQKIRAKLEVLIEQTQADELIFTSDLYEHADRLHSYELLAQVMKG"
FT   gene            complement(103672..103896)
FT                   /locus_tag="Pfl01_0099"
FT   CDS_pept        complement(103672..103896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71843"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK63"
FT                   /protein_id="ABA71843.1"
FT                   /translation="MKKLILAVGLLSLAGGAFAAGKPCEELKAEIAAKLDAKGVSGYSL
FT                   EVVDKGAASGGKVVGTCEGGAKEIVYTRG"
FT   sig_peptide     complement(103837..103896)
FT                   /locus_tag="Pfl01_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(104025..104240)
FT                   /locus_tag="Pfl01_0100"
FT   CDS_pept        complement(104025..104240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71844"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK62"
FT                   /protein_id="ABA71844.1"
FT                   /translation="MSDHHTYKKVELVGSSTTSIEDAINNALAEANKSIKHLEWFEVTE
FT                   TRGHIKDGKAAHFQVTLKVGFRIASS"
FT   gene            104397..104723
FT                   /locus_tag="Pfl01_0101"
FT   CDS_pept        104397..104723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71845"
FT                   /db_xref="GOA:Q3KK61"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK61"
FT                   /protein_id="ABA71845.1"
FT                   /translation="MANTSLRKASLQSMEAEIESLLKSLESLKDDASDESRKTLKALKS
FT                   NAESALKHSRSLLSDAYEEVKVKTRETGIATRDYAQEHPWTTAGVAVGALGLLAAYLLF
FT                   KRGE"
FT   gene            complement(104696..105613)
FT                   /locus_tag="Pfl01_0102"
FT   CDS_pept        complement(104696..105613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0102"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71846"
FT                   /db_xref="GOA:Q3KK60"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK60"
FT                   /protein_id="ABA71846.1"
FT                   /translation="MSHDLPPLNALRAFEATARLNSVSQAAEQLHVTHGAVSRQLKVLE
FT                   EHLGVSLFVKDGRGLKLTDAGIRLRDASGEAFDRLRSVCAELTQSTADAPFVLGCSGSL
FT                   LARWFIPRLGRLNADLPDLRLHLSAGEGDLDPRRPGLDALLLFAEPPWPADMQVYELAS
FT                   ERIGPVMSPLFSGYQRLQSAPPIALLDEPLLHTTSRPQAWPSWAQQSGLDAKALKLGQG
FT                   FEHLYYLLEAAVAGLGVAIAPEPLVTEDLKAGRLVAPWGFSETSAQLALWLPKRAADGR
FT                   ARQLAQWLRNELRQADHSPRLNSR"
FT   gene            105726..106958
FT                   /locus_tag="Pfl01_0103"
FT   CDS_pept        105726..106958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0103"
FT                   /product="tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71847"
FT                   /db_xref="GOA:Q3KK59"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KK59"
FT                   /protein_id="ABA71847.1"
FT                   /translation="MTQTSNNSDLRNGPDANGLFGSFGGRYVAETLMPLILDLAREYEA
FT                   AKEDPAFKEELAYFQRDYVGRPSPLYFAERLTEFCGGAKIYLKREELNHTGAHKINNCI
FT                   GQILLARRMGKKRIIAETGAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKL
FT                   LGAEVIPVVAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGK
FT                   ETRDQLQAQEGRLPDSLVACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAA
FT                   SLNGGVPGVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVT
FT                   DDEALAAFHQCCRLEGIIPALESAHALAEVFKRAPKLPKDHLMVVNLSGRGDKDMQTVM
FT                   HHMETSKQEKH"
FT   gene            106958..107770
FT                   /locus_tag="Pfl01_0104"
FT   CDS_pept        106958..107770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0104"
FT                   /product="tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71848"
FT                   /db_xref="GOA:Q3KK58"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KK58"
FT                   /protein_id="ABA71848.1"
FT                   /translation="MSRLQTRFAELKEQNRAALVTFVTAGDPDYDTSLAILKGLPKAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALGAKQNLTKTLQMVREFREGNSDTPLVLMGYFN
FT                   PIHKFGVERFIAEAKEAGVDGLIVVDMPPEHNSELCDPAQAAGIDFIRLTTPTTDDARL
FT                   PKVLNGSSGFVYYVSVAGVTGAGAATLEHVEEAVARLRRHTDLPISIGFGIRTPEQAAS
FT                   IARLADGVVVGSALIDHIANATTPDQAIDGVLSLCSALSEGVRKARVS"
FT   gene            107893..108336
FT                   /locus_tag="Pfl01_0105"
FT   CDS_pept        107893..108336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0105"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71849"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK57"
FT                   /protein_id="ABA71849.1"
FT                   /translation="MKMPKRLIASLGVLMISAAPLLASADPRDDHDHGGPQQGHYDNRG
FT                   GDHHDWQSNHRGGPPPRDFGPVRQVIRDNHGYFVRGAPPPPGIHLVRGRPLPHGYYGER
FT                   LDNRALSRLPYYPGYEWRRAGGDIVLIAVGTGIVYEVLDGVLY"
FT   sig_peptide     107893..107970
FT                   /locus_tag="Pfl01_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.750 at
FT                   residue 26"
FT   gene            complement(108407..110368)
FT                   /locus_tag="Pfl01_0106"
FT   CDS_pept        complement(108407..110368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0106"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71850"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK56"
FT                   /protein_id="ABA71850.1"
FT                   /translation="MRSLGAWLLAGALLLLGNSAHAGLQLRLKTDGLSPAQQQASQALL
FT                   DEAMQALPPSFIERLDRRIDVGWTDDMPGNAYGQATLVSELDLNRKLLASLTDGSAATQ
FT                   KTNRPHGTVRRELLATVLHEITHIYDRARLWPAAERTLIQRCTRRNNSAGLIGIPDECR
FT                   GQNGRRFTLSDDPRLLDLAGWQQYVGRRGEREQHNRQIARSPDLYEISSPKEFVAVNME
FT                   YFLLDPSYACRRPALYRYYQQHFSWAPPAKDACAKTFAFLNAGNDFAKQPLGQVDPERV
FT                   YAVDYLLAEANQNWVSRWGHSMLRLVICAPGRPRGPDCRLDLDQHLVLSYRAFVGDVQL
FT                   SSWDGLVGKYPSRLFVLPLAQVIDEYTKTELRSLASVPLNLSRSEIEGVVEHAAEMHWS
FT                   YDGNYFFLSNNCAVEGLKLLRSGSNNARLTGLDSIMPNGLLEVLKGRGLADTSVLDDPK
FT                   EALRLGYRFDSFRDRYQAMFDVLKKQLPIKQTTVEEWLSLSAEERRPWFERADLRTSAA
FT                   LLLLEQASFRRQLLLAQDEVKQRYLGARELENGGMDKANATLQQILANSGFLSRPAELL
FT                   DSRGYGLPQPSEFSRLEAESSQRQKQLLALTGDLDKEVRALLEPKRAAEIAASEANVKQ
FT                   IGEHLRKLHKASGGLELP"
FT   sig_peptide     complement(110300..110368)
FT                   /locus_tag="Pfl01_0106"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(110365..110685)
FT                   /locus_tag="Pfl01_0107"
FT   CDS_pept        complement(110365..110685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0107"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71851"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK55"
FT                   /protein_id="ABA71851.1"
FT                   /translation="MRSPLIAATLGLLLLADMAQAHTLVATSNIIVRASQRTIDFTSDT
FT                   TTSIRDSKIIREAHDDAASFVASDGDIRGANLEAAFNTLRTRVPEARDASDQVLAEAIL
FT                   AL"
FT   sig_peptide     complement(110620..110685)
FT                   /locus_tag="Pfl01_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.751 at
FT                   residue 22"
FT   gene            complement(110713..111021)
FT                   /locus_tag="Pfl01_0108"
FT   CDS_pept        complement(110713..111021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0108"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71852"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK54"
FT                   /protein_id="ABA71852.1"
FT                   /translation="MRFLTNLLIPSVLITACWVPLADAFDVSTQNTVVSVWATGMVSSA
FT                   PFDRKLIVAAHDDAAAFVASDGQMRGAQLESALHYLRKSRPKLHVSDLELAQAILVQ"
FT   sig_peptide     complement(110947..111021)
FT                   /locus_tag="Pfl01_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.711 at
FT                   residue 25"
FT   gene            complement(111129..111446)
FT                   /locus_tag="Pfl01_0109"
FT   CDS_pept        complement(111129..111446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0109"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71853"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK53"
FT                   /protein_id="ABA71853.1"
FT                   /translation="MSRLRLLSAAALLAVAANASATSFIVTTDAVVGALKSSSDATSDV
FT                   TSSFRDDKIVLAARDDAASFVASEGEIRGVKLESALDHIRHQAPQLNATDAQLAQAILT
FT                   I"
FT   sig_peptide     complement(111381..111446)
FT                   /locus_tag="Pfl01_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 22"
FT   gene            complement(111780..111995)
FT                   /locus_tag="Pfl01_0110"
FT   CDS_pept        complement(111780..111995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71854"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK52"
FT                   /protein_id="ABA71854.1"
FT                   /translation="MERTLSSELFFEDKAVKTQASLPLRVIANLMLWQRRISSRHQLAR
FT                   LDSRLLADAGISEAQRYEELSKPFWR"
FT   gene            complement(112317..113810)
FT                   /locus_tag="Pfl01_0111"
FT   CDS_pept        complement(112317..113810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0111"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71855"
FT                   /db_xref="GOA:Q3KK51"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK51"
FT                   /protein_id="ABA71855.1"
FT                   /translation="MYRDRIRLPSLLDKVMSAADAAALIEDGMTVGMSGFTRAGEAKAV
FT                   PHALAERAKVTPLKISLMTGASLGNDLDKQLTEAGVLSRRMPFQVDSTLRKAINAGEVM
FT                   FIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKHVIVE
FT                   INLAHNANLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIPPEKIVAIVITQQSDS
FT                   PSTVSSPDVDTKAIADHLITFLKQEVDAGRMTNKLGPLQAGIGNIANAVMCGLIDSPFE
FT                   ELTMYSEVLQDSTFDLIDAGKLSFASGSSITLSERRNSDVFGNLEKYKDKLVLRPQEIS
FT                   NHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAVFVTKS
FT                   IAKGGAISSVVPMVSHVDHTEHDVDILVTEVGLADLRGLAPRERARVIIDNCVHPDYRS
FT                   ALNDYFEKACAIGGHTPHILRDALSWHINLEETGRMLAV"
FT   gene            complement(114025..115458)
FT                   /locus_tag="Pfl01_0112"
FT   CDS_pept        complement(114025..115458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0112"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71856"
FT                   /db_xref="GOA:Q3KK50"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK50"
FT                   /protein_id="ABA71856.1"
FT                   /translation="MSMNLVTTLYLIASICFIQALKGLSHPTTSRRGNLFGMLGMALAI
FT                   ITTIGLIYKLGAELATAGIGYVIVGLLIGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVKQLGDSIPAGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGAPVQFSGQHKLNAVLGLATLILGVTFMLTGNLAAFALMLALAFVMGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVLLGGFGNTADAGPAGEKEARPVKSGSADDATFLLTNADTVIIVPGYGLAVARAQHAL
FT                   KELTEKLTHHGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQADVV
FT                   LVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLDNELFYLDKT
FT                   MMVFGDAKKVIEDMVKAVE"
FT   gene            complement(115458..115778)
FT                   /locus_tag="Pfl01_0113"
FT   CDS_pept        complement(115458..115778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0113"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71857"
FT                   /db_xref="GOA:Q3KK49"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK49"
FT                   /protein_id="ABA71857.1"
FT                   /translation="MEELISPGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAIS
FT                   AIVIVGAMLAAALTVTPLGKTMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAKEEA
FT                   PK"
FT   gene            complement(115794..116915)
FT                   /locus_tag="Pfl01_0114"
FT   CDS_pept        complement(115794..116915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0114"
FT                   /product="NAD(P) transhydrogenase subunit alpha 1"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71858"
FT                   /db_xref="GOA:Q3KK48"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK48"
FT                   /protein_id="ABA71858.1"
FT                   /translation="MHIGVPLETQTGETRVAATPETIKKLISQGHKVTVQTGAGVKASV
FT                   VDSAYEAAGATIGSANDAFGAELILKVVAPSDAELTLIKRGTVLVGMLNPFNNDTIAKM
FT                   AECGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHYYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAVGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSADTVAQMKP
FT                   GSVVIDLAAAQGGNCPLTVADQVVIENGVTIVGPTNLAGEVAADASALYARNLLDFLKL
FT                   VFTKEGQFEVNLEDDIVAACLMCRDGQVIRKNA"
FT   gene            116962..117201
FT                   /locus_tag="Pfl01_0115"
FT   CDS_pept        116962..117201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71859"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK47"
FT                   /protein_id="ABA71859.1"
FT                   /translation="MVRLGRPISTIPPNQGGARHFAGEVYALQGIMTGDGKLTTSHPVT
FT                   ECRRWPVESLAGRAFQGVWMNLKIFLIGDVNRPQ"
FT   gene            complement(117350..118249)
FT                   /locus_tag="Pfl01_0116"
FT   CDS_pept        complement(117350..118249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0116"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71860"
FT                   /db_xref="GOA:Q3KK46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK46"
FT                   /protein_id="ABA71860.1"
FT                   /translation="MRRKIPSTTALISFEAAARHESFTKAAEELSLTQGAICRQIASLE
FT                   DFLSVELFRRSRRGVKLTEAGLSYSRRVATQLDAVERDTLSVMGQQGTNVIELAVVPTF
FT                   GTQWLLPRLKDFQLKHPEVTVNLTNRTRPFLFADTDFDAAIYFGDADWSGTESHRLMGE
FT                   NPMPVCSPALLGNKTHLTPDEIADLPLLQQTTRPYAWRQWFNSQHLNIPRDMTGPRYEL
FT                   FSMLAQAAMHDMGIALIPPFLIQRELAEKRLVIANPNALSSIKAYYLMIPERKVESASL
FT                   KAFRDWLVSQAHSYNLEE"
FT   gene            118408..119589
FT                   /locus_tag="Pfl01_0117"
FT   CDS_pept        118408..119589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0117"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71861"
FT                   /db_xref="GOA:Q3KK45"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK45"
FT                   /protein_id="ABA71861.1"
FT                   /translation="MGGKASFNWIDPLLLDQQLTEEERMIRDTAEQFAQQSLAPRVLEA
FT                   FRHEKTDPAIFREMGEVGLLGATIPEQYGGSGLNYVSYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGAMITRARKVDGGYS
FT                   LTGAKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWKGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGALGAAEFCWHTARQYTLDRQQFG
FT                   RPLAATQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKSLEIA
FT                   RMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGLQAFY"
FT   gene            119603..120823
FT                   /locus_tag="Pfl01_0118"
FT   CDS_pept        119603..120823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0118"
FT                   /product="putative CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71862"
FT                   /db_xref="GOA:Q3KK44"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK44"
FT                   /protein_id="ABA71862.1"
FT                   /translation="MGALSHLRVLDLSRVLAGPWAGQILADLGAEVIKVERPGNGDDTR
FT                   AWGPPFLKDAYGENTSEAAYYLSANRNKQSVTIDFTRPEGQKLVRELAAKSDILIENFK
FT                   VGGLAAYGLDYESLKAINPDLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPE
FT                   GDEGAGPVKVGVALTDILTGLYSTVAILAALAHRDHDGGGQHIDMALLDVQVACLANQA
FT                   MNYLTTGTAPKRLGNAHPNIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDP
FT                   RFATNKLRVANRAVLIPLIRQATVFKTTAEWVAQLEQAGVPCGPINDLSQVFEDPQVKS
FT                   RGLAIELPHALAGMVPQVASPIRLSRTPVEYRHAPPLLGEHTLEVLQRVLGLGAGAVAA
FT                   MKEDGVL"
FT   gene            complement(121036..121407)
FT                   /locus_tag="Pfl01_0119"
FT   CDS_pept        complement(121036..121407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK43"
FT                   /protein_id="ABA71863.1"
FT                   /translation="MISRGVTCDADNLVDYQSDSTSTHTNCLIQLLKSGWLRSFVSTEA
FT                   RILQQPHLLSSDYFQKFSKISSTTSTTCASDLSLAGGEFYSVTRCCQHLFFSVFDREDR
FT                   TVESAKQTGISNSFQSSMN"
FT   gene            121476..123002
FT                   /locus_tag="Pfl01_R0001"
FT   rRNA            121476..123002
FT                   /locus_tag="Pfl01_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            123085..123161
FT                   /locus_tag="Pfl01_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            123085..123161
FT                   /locus_tag="Pfl01_R0002"
FT                   /product="tRNA-Ile"
FT   gene            123192..123267
FT                   /locus_tag="Pfl01_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            123192..123267
FT                   /locus_tag="Pfl01_R0003"
FT                   /product="tRNA-Ala"
FT   gene            123512..126403
FT                   /locus_tag="Pfl01_R0004"
FT   rRNA            123512..126403
FT                   /locus_tag="Pfl01_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            126568..126682
FT                   /locus_tag="Pfl01_R0005"
FT   rRNA            126568..126682
FT                   /locus_tag="Pfl01_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            126790..126904
FT                   /locus_tag="Pfl01_R0006"
FT   rRNA            126790..126904
FT                   /locus_tag="Pfl01_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(126979..128157)
FT                   /locus_tag="Pfl01_0120"
FT   CDS_pept        complement(126979..128157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0120"
FT                   /product="putative iron-regulated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71864"
FT                   /db_xref="GOA:Q3KK42"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK42"
FT                   /protein_id="ABA71864.1"
FT                   /translation="MRSFLVLLHRYIGLATAVFLLLAGITGSILAFNHELDEWLNPEFY
FT                   AASAEGERLAPGELVDALQSAHPKLQVWYMEYPNEAGHTALLAAVARNGPATGEPFEER
FT                   NQVFYLDPVNGEQKGQRYWGECCFQRENFVPFILEFHYNLTLPGNWGLLLMGLVAIAWV
FT                   IDCFIALWLTLPRGKPFWKKWSMAWKIKGGHAYRLNFDLHRAGGLWLWLLLLPIAVSSV
FT                   AMNLPSQVFKPVVSLFSPIEPSVYEARGRMPAEELGITRLSYQQAYERAQQEGKRLGLT
FT                   AAIGELYYSFEYNFYGAGFGEHDTEAHGKSWLFFHGTDGRLLGQEIAGEGTLGERFYRL
FT                   QLPIHGGRIIGFTGQVMIAILGVLIAGLSGTGVYIWWRKWQARRCSMARRAG"
FT   sig_peptide     complement(128056..128157)
FT                   /locus_tag="Pfl01_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.702 at
FT                   residue 34"
FT   gene            complement(128233..130626)
FT                   /locus_tag="Pfl01_0121"
FT   CDS_pept        complement(128233..130626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0121"
FT                   /product="putative TonB-dependent siderophore
FT                   receptorferrioxamine B receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71865"
FT                   /db_xref="GOA:Q3KK41"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK41"
FT                   /protein_id="ABA71865.1"
FT                   /translation="MLPGLSMAANASEVSSHRYNIAAGPLGEALNQFARQAGITLSMTP
FT                   QQTQGRQSPGVQGEYSTDQALSHLLGGSGLEAVSQDGSSYVLRSVAETEALALPTTDIK
FT                   GFALGNALGSMDGYNATHSQIATKTSTALLETSQSVSVVTREQMDDQGSQTVSQAMRYT
FT                   PGVLTNPYGATHRYDYVAMRGFNDGSVDNIYLDGLKSMGDSGTYSTMQVDPYFLERVDI
FT                   LKGPSSVLYGRSSPGGLVALTSKKPLYEAYHQVQATVGTQGQRGVGFDFSGPVDDDKRI
FT                   AYRLIGLTDQSDTQFDHNKEKRFALAPTVSIDFNEDTSLTLQAYLQHDPDGGYHGGVPA
FT                   DGTIHQRNGNRISPHFFEGEPGIDGYSRDQQSFGYQFEHRFNDVFTARQNFRYLDSKVN
FT                   MDQVYAYGWTSPTSNELNRYYTGGDERLHAFIVDNMLQAEFFTGATKHTVLMGADYQRR
FT                   KTVVDWTSGGLAPINAFNPESGNSAITPYGETSYLRRLEQTGVYLQDLIEMNKWRFSLG
FT                   LRQDWVETSDENRIAEAGRPVGTEINDRRTKLTGRAGALYLFDNGLAPYVSYSESFNPN
FT                   SYADSAGNPLAPTDGTQWEMGLKYQPPGTDNLFTASLFRIDQENLATKLPQENFYRAVG
FT                   AVRSQGLELEAHMQLTDNLKVLGSYTFTDIEYSKSMTSTLSTPTNVIENKGNSPTQAPR
FT                   HMASLWADYKFDSAALDGLRLGGGVRYVGYSWADAENTMKVPSYTLFDASIGYDLGKVG
FT                   LKGVDVRLNANNLTNESYVASCASLDFCYMGEERNVAATVSYQF"
FT   gene            complement(130822..131823)
FT                   /gene="fecR"
FT                   /locus_tag="Pfl01_0122"
FT   CDS_pept        complement(130822..131823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecR"
FT                   /locus_tag="Pfl01_0122"
FT                   /product="regulator of iron dicitrate transport"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71866"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK40"
FT                   /protein_id="ABA71866.1"
FT                   /translation="MPVDNLSLGRRAEPPQQVVRQAIHWLLRLRNNHGNPRLNRQCEQW
FT                   RAEHHDHELAWQRVQSLQAELTHNLRAVPGAQVAFNTLENSAQGLGRRQALKLLSGALL
FT                   MGSAGWLASDTSAWQQWSADYATATGERRGFQLPDGTRIELNTASSVDLDYTAQQRLIR
FT                   LTRGEIIVTCGGADAGAPIDRPLRVQSRHGSYEPFKARFILRQEDGCTRLSVTSGRVAI
FT                   HSAGNSMEAIAGQSYLIDHHQIRPAPPLDMDAGAWVDGLIVTRNMRLGDFLNEVGRYRQ
FT                   GFLSCASDIADLRLSGVFRLEDTDKLLAILPQTLPVQLRYRTRWWVTLESVA"
FT   gene            complement(131823..132371)
FT                   /gene="fecI"
FT                   /locus_tag="Pfl01_0123"
FT   CDS_pept        complement(131823..132371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecI"
FT                   /locus_tag="Pfl01_0123"
FT                   /product="putative sigma 24 factor, FecI"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71867"
FT                   /db_xref="GOA:Q3KK39"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK39"
FT                   /protein_id="ABA71867.1"
FT                   /translation="MTMRLIIICDVRAVAFMSSSEFAVQALYSSHHGWLNGWLRARLGN
FT                   AADAADLAQDTFVRLLQRTERLELKAPRAFLRTVARGLVIDHWRREEIERAYLETIAHL
FT                   PEAETPSGESRALVIELLEGIARMLEGLKPKVRQAFLLAQCEGLTHKQIAEQMGLSLRS
FT                   VERYVADALFHCYVLRYEN"
FT   gene            132635..134515
FT                   /locus_tag="Pfl01_0124"
FT   CDS_pept        132635..134515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0124"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71868"
FT                   /db_xref="GOA:Q3KK38"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK38"
FT                   /protein_id="ABA71868.1"
FT                   /translation="MNLKFSHKILLAASGVVVLAFALFTLYNDYLQRNTIRQNLQSSVQ
FT                   QAGDLTASSVQNWMSGRILVLENLAQNVAHQGKNADFPGLVDQPAFTSNFQFTYVGQAN
FT                   GVFTQRPDAKMPDGYDPRQRPWYKQAVAADQTMLTPPYMAAVGGLVVTIAMPVKKNGEL
FT                   LGVVGGDLSLETLVKIINSVDFGGLGHAFLVSGDGQVIVSPDKDQVMKNLKDIYPNAGV
FT                   RIEKGNQNVVLNGQERILSFTPVAGLPNAEWYIGLSIDRDKAYAALSQFRTSAVIAMFV
FT                   AVGAIAVFLSLLITVLMRPLITMGRAMQDIAQGEGDLTRRLVVESKDEFGELGSSFNQF
FT                   VERIHASISEVSSATRHVHDLSQRVMASSNASIIGSDEQSARTNSVAAAINQLGAATQE
FT                   IARNAADASQHASGASEQADDGRQVVEQTIQAMTELSQKISLSCTQIETLNASTDNIGH
FT                   ILDVIKGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQESAEEIHKMIT
FT                   SLQVGSREAVTTMNASQASSEETVEVANQAGLRLVSVTQRIGEIDGMNQSVAAATEEQT
FT                   AVVETLNVDVNQINLLNQQSVANLNETLKDCDALSQQANRLKQLVDSFKI"
FT   sig_peptide     132635..132703
FT                   /locus_tag="Pfl01_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.424 at
FT                   residue 23"
FT   gene            complement(134574..135041)
FT                   /locus_tag="Pfl01_0125"
FT   CDS_pept        complement(134574..135041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71869"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK37"
FT                   /protein_id="ABA71869.1"
FT                   /translation="MSNLQPDTLIKNPHGCHVVSSVEVPVDARQVWAVVGKFDGFDRFI
FT                   PALSHIEMTGEGVSSLRKKFFKDGNVVVEQLNSRDDQALSMTWTTIYNTLGVANLWAAM
FT                   NVESLGAGKSRATWTIIAEPASGGPEALPGFKDFVQGFADDAMGNVLKLFV"
FT   gene            complement(135065..138454)
FT                   /locus_tag="Pfl01_0126"
FT   CDS_pept        complement(135065..138454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0126"
FT                   /product="putative amino acid activating peptide synthase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71870"
FT                   /db_xref="GOA:Q3KK36"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK36"
FT                   /protein_id="ABA71870.1"
FT                   /translation="MRRLDILLRGRSQALTDLAQELEQHGHSLLTETAPSMDLVIDDGS
FT                   LAPQDHGTTPYLTLRLGIGATGAGGLPVLDLLCLCNSTLLSRVPIADEPSGNGQALRQR
FT                   ALAQVVDEVALLVSRFSRDAEYFQHAETARAPDFEQVENLLFLDSLAYVHRFNATANPA
FT                   LLQQAQIPVIERLQRSLIEHAERPALHLAEQSISYRQLHDHSRAIQQRLLAMLEAQPQP
FT                   WVVGICLPKCDALFASILAILGSGAVYLPLEPSHPLQRQQYILENAGAVLLLHDGEHPL
FT                   SGSMPGLDVCRIDSTDADLSQPLMHHRPELDTPCMALYTSGTTGHPKGVLLSQANLAHF
FT                   TAWYADYVQLHAESRVLQFSSLSFDSSLIDIFPTLLEGAELVVPDDNQRRDPLQLVALI
FT                   RRRQLTHAFLPPALLSILPLEQLQSVGQIMTGGDVCEPFVIEQLTRQGKLHNLYGPTEA
FT                   TVLITARQLQPGDSNRTLGGPIANSQVLILDDDLQPVPEQTVGELFIVGPGVCLGYLNN
FT                   PQQTAERYLDLELPDGQRLRAYRSGDMAKWGEDGIELCGRRDNQVKIRGFRVEPEEIER
FT                   CLRESQLYRQIAVVIDSQRRILAFLAQPQSDAARETLKAHAQQFLPDYMQPVAWTELPN
FT                   MPFAANGKVDRKALLELPVSVQDSGPKCLPANADEALLLEIWGELLELPISDISTDESF
FT                   FNLGGHSILLSRMLLRLREEFGRSISINRFIELPTITKLATLVRGTDDSAVLSAQAMAD
FT                   AERPLEIEPLPISRMGDVHKVIVTGANSFVGVHIVEALLGWGASEVACLVRDGGGQTAA
FT                   QRFAQSLRENRLEHLDLSRVRIYSADITQPQLGLADGDFERLDREFGALVHNAANVNHV
FT                   LDYESLAADNVEPIFELVRLCEGRSKKVFNFVSTLSASSTVDDAGRVLELPAAPTPPIY
FT                   IRNGYNLSKWVGERILERARERGVRVNLYRPGNISFNSLSGVCQPHKNRLMLMLKGSIQ
FT                   LGQVPAFALNFDLMPVDFLARFIAFHASRYSPERAVFNLHNPEPLSWDAYVASFRETGS
FT                   EFSLVSVADWQQQLGRVDADNALFGVLGFYLNGFEEDIGDISLIGHANAQAGVQQMGAH
FT                   YPEKSPALLRRGCDYLKEINFI"
FT   gene            complement(138468..139397)
FT                   /locus_tag="Pfl01_0127"
FT   CDS_pept        complement(138468..139397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71871"
FT                   /db_xref="GOA:Q3KK35"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK35"
FT                   /protein_id="ABA71871.1"
FT                   /translation="MNAADYQSFADAWESRATIRTRPRRVLEGDARLIYPLSRQPLVLS
FT                   ETFLRECPEQRDFALVQTLYKFINDVVIFETEIVDKTARSIAKNRFAVAFPFACRYDAM
FT                   TVVVDEDYHALVAMDFMQQTVAMTGVEPIELPNEIELSRAIPAAVELAPEHLRSAVELI
FT                   CVAIAENTVTGDVAAFARDDTVKPSIKGLMADHLLDEGRHSNFWARMVRIYWHTASDAD
FT                   RECIAQILPVFIGHYLTNDIQKSFDLRLIDALPVNDATRRALKDEMAGLAFPINRHHPL
FT                   VGNIVRFFHNSSLLDTPCVQHALRDYLV"
FT   gene            complement(139394..140167)
FT                   /locus_tag="Pfl01_0128"
FT   CDS_pept        complement(139394..140167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71872"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR024423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK34"
FT                   /protein_id="ABA71872.1"
FT                   /translation="MPTKEQLTLKKAELSVHPIFSEIDSLATLRRFMESHVFAVWDFMS
FT                   LTKRLQQELTCTRLPWLPPRDPRAARLINEIVLGEESDDRLSHGHYSHFELYLDAMREV
FT                   GADTTAVERFVTLQQEGVSYDVALQSVEVDPAAARFVRDTLHTALNAPGHSVAAAFLHG
FT                   RESVIPTMFQRMLDAWGIGVEQAPTFRYYLERHIEVDSEDHGPAAEQLLDRLVDGDPQR
FT                   EAEVYASAIAAVESRIALWDGLRLSMREPLAEVAQ"
FT   gene            complement(140922..141632)
FT                   /locus_tag="Pfl01_0129"
FT   CDS_pept        complement(140922..141632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0129"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71873"
FT                   /db_xref="GOA:Q3KK33"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK33"
FT                   /protein_id="ABA71873.1"
FT                   /translation="MTQKPKPLHSIKVDGPIPAHLARSVIEETLRAAILDGRLPCGTAV
FT                   RQQDLADLFGVSRMPVREALRQLEAQGLLNVIAHKGAVVAPLIQGDATETYELRILLES
FT                   EALRQSIPLLSPADHERAAGYIEELEIEHDYTEIGRLNRLFHMALYSKAPNGRLLRLVE
FT                   DGLNEEERFLRFNLEAMGLGKLSQDDHRALLQAVKERDTPHAVTLLEQHLNRGVEVITR
FT                   YLASSAGQSRKAAR"
FT   gene            141764..142519
FT                   /gene="lapF"
FT                   /locus_tag="Pfl01_0130"
FT   CDS_pept        141764..142519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapF"
FT                   /locus_tag="Pfl01_0130"
FT                   /product="putative cystine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71874"
FT                   /db_xref="GOA:Q3KK32"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PDB:4U65"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK32"
FT                   /protein_id="ABA71874.1"
FT                   /translation="MFFAGLTFTIKRFLLCPGCLALAVRFAIPRIARWLACALLLAGIM
FT                   LGGLHADWDFSAISRKATALYGPLGAGQQRIDAWQNLLATQKQVSEMEKLKVVNLFFNK
FT                   QMRYVEDIDLWHEVDYWETPIEALWKGAGDCEDYAIAKYFSLRHLGVASDKLRITYVKA
FT                   LRQNRAHMVLTYYSSPDAMPLVLDSLIDPIKPAAERTDLLPVYSFNAEGLYLPGAKGNK
FT                   KVGDTKRLSRWQDVLKKMQAEGFPVETTN"
FT   sig_peptide     141764..141919
FT                   /gene="lapF"
FT                   /locus_tag="Pfl01_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.473 at
FT                   residue 52"
FT   gene            142534..144480
FT                   /gene="lapD"
FT                   /locus_tag="Pfl01_0131"
FT   CDS_pept        142534..144480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapD"
FT                   /locus_tag="Pfl01_0131"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71875"
FT                   /db_xref="GOA:Q3KK31"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:3PJT"
FT                   /db_xref="PDB:3PJU"
FT                   /db_xref="PDB:3PJV"
FT                   /db_xref="PDB:3PJW"
FT                   /db_xref="PDB:3PJX"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK31"
FT                   /protein_id="ABA71875.1"
FT                   /translation="MSLFKQLLIAICLFLVVAFTGSFMVSLESSRTQYVNQLRSHAQDA
FT                   ATALALSLTPNIDDPAMVELLVSSIFDSGYYSSIRVVDLKTDQTIVERNGIPAVTNVPD
FT                   WFVKLIGLEPAGGDALVSRGWEQAARVEVVSHPMFALAKLWQSALGSLGWLLVCGAVSA
FT                   VLGALLLRRQLKPLDYMVKQSHAIARREFLSLPDLPRTPELRRVVLAMNQMVEKLKALF
FT                   QEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLN
FT                   QRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQS
FT                   LDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLD
FT                   QSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQT
FT                   IPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEI
FT                   LRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLG
FT                   LAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYG
FT                   VQGQLFGEPKPWG"
FT   sig_peptide     142534..142617
FT                   /gene="lapD"
FT                   /locus_tag="Pfl01_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.473 at
FT                   residue 28"
FT   gene            complement(144521..144859)
FT                   /locus_tag="Pfl01_0132"
FT   CDS_pept        complement(144521..144859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71876"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK30"
FT                   /protein_id="ABA71876.1"
FT                   /translation="MFYVQRDAQGQLIRVEAAAYAEATETLPADHHEIQAWYANEAVEN
FT                   SLKQLKQSDLEMIRVLDDLIQVLTSKGVIRVTDLPPAAQAKLMDRTQAREALGGLSQLI
FT                   DEDEGGLI"
FT   gene            complement(145006..160662)
FT                   /gene="lapA"
FT                   /locus_tag="Pfl01_0133"
FT   CDS_pept        complement(145006..160662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapA"
FT                   /locus_tag="Pfl01_0133"
FT                   /product="Large adhesive protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71877"
FT                   /db_xref="GOA:Q3KK29"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK29"
FT                   /protein_id="ABA71877.1"
FT                   /translation="MTPGESSMSSVVAIVKSIVGQVFVVSPEGVRRVLVEGDRLFAGDQ
FT                   VDTGVSGAVSLELADGRTIDLGRDTQWSADTPDSSTDLAEATAQAAPSVEELQQAIAAG
FT                   VDPTTALESTAAGPSAAGTGGAAGGGHSFVMLDATAGRVDPTIGFPTAGINAAGQAAQN
FT                   ITGGQNTDTTANALRESTLSLSATPSITEAGGVLVYTATLTQAPLTDLTITLSNGAVIV
FT                   IPAGSTTGTANVPLAPNDTVYNDPTQIDVTVTGTTGGSGITVTPPTTPATTQVTDTIDT
FT                   TTVTLTAGPSVTEGGQITYTATLTNPAQTPVTVTLSNGSTITIGAGQTTGTVNVPTAPN
FT                   DVYNNGSTVTTTITGATGGNFENLVPNPTPAVTTITDSIDTTGLTLTATGTVVEGGQIT
FT                   YTATLTNPAQTPVTVTLSNGSTITIGAGQTTGSVNVPTAPNDVYNNGGTVSTTITGATG
FT                   GNFENLVPNTTPATTTVTDSIDTTNLSLSATGSVAEGGSIVYTATLTNPAGTPVTVTLS
FT                   NGSVITIEAGKTTGTVTVPAPADDVYKDAGKIEVTIKDATGGNFENLVPSTVPAVTEVT
FT                   DTIDTSTVKLTADSSVAEGGTVTYTATVGAPVTGSPVTVTLANGQTITIEVGKTTGTVT
FT                   TTAPNDALAGNAPLTNSITGVSGGNYENLVADKTPVSTTVTDVADITNLTLSATGTVAE
FT                   GGSIVYTATLTNPAGTPVTVTLSNGSVITIEAGKTTGTVTVPAPADDVYKDAGKVEVTI
FT                   KDASGGNFENLVPSTVPAVTEVTDTIDTSTVKLSADTSVAEGGTVTYTATVGAPVTGSP
FT                   VTVTLANGQTITIEVGKTTGTITTTAPNDVLTGHAPLTNSITGVSGGNYENLVADKTPV
FT                   STTVTDVADTTNLTLSATGTVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIEAGKTT
FT                   GTVTVPAPADDVYKDAGKVEVTIKDATGGNFENLVPSTVPAVTNVTDTIDTTTVKLTAT
FT                   ESAVEGGTVTYTATVGAPVTGSPVTVTLANGQSITIEVGKTTGTITTTAPNDALNGHTP
FT                   LTNAITGVSGGNYENLVADKTPVSTTVTDTVDTTNLTLSASDSVAEGGSIVYTATLTNP
FT                   AGTSVTVTLSNGAVITIEAGKTTGTVTVPAPADDVYKDAGKVEVTIKDASGGNFENLVP
FT                   STVPAVTEVTDTIDTTTVKLTATESAAEGGTVTYTATVGAPVTGSPVTVTLANGQSITI
FT                   EVGKTTGTVTTTAPNDALNGHTPLTNAITGVSGGNYENLVADKTPVSTRVTDTVDTTNL
FT                   TLSATGTVAEGGSIVYTATLTNPAGTPVTVTLSNGSVITIEAGKTTGTVTVPAPADDVY
FT                   KDAGKVEVTIKDATGGNFENLVPSTVPAVTNVTDTIDTSTVKLSADTSVAEGGTVTYTA
FT                   TVGAPVTGSPVTVTLANGQTITIEVGKTTGTITTTAPNDALNGHTPLSNSITGVTGGNY
FT                   ENLVADKTPVSTTVTDTVDTTDLTLTATDSVAEGGSITYTATLTNAAGTPVTVTLSNGA
FT                   VITIEAGKTTGTVTVDAPKDDVYKDAGKVEVTIKDATGGNFENLVPSTVPAVTEVTDTI
FT                   DTTTVKLTATESAAEGGTVTYTATVGAPVTGSPVTVTLANGQSITIEVGKTTGTITTTA
FT                   PNDALNGHTPLTNAITGVSGGNYENLVADKTPVSTTVTDTVDTTNLTLSASDSVAEGGS
FT                   IVYTATLTNPAGTPVTVTLSNGAVITIEAGKTTGTVTVDAPKDDVYKDAGKVEATISTA
FT                   TGGNFENLVPSTVPAVTEVTDTIDTTTVKLTATESAVEGGTVSYTATVGAPVTGSPVTV
FT                   TLANGQSITIEVGKTTGTVTTTAPNDVLNGHAPLTNAITNVTGGNYENLVADKTPVSTT
FT                   VTDTVDTTNLTLSATDSVAEGGSIVYTATLTNPAGTPVTVTLSNGAVITIEAGKTTGTV
FT                   TVDAPKDDVYKDAGKVEVTIKDATGGNFENLVPSTAPAVTEVTDTIDTSTVKLTATESA
FT                   AEGGTVTYTATVGAPVTGSPVTVTLANGQSITIEVGKTTGTVTTTAPNDALNGHTPLTN
FT                   SITDVSGGNYENLVADKTPVSTTVTDTVDTTNLTLSATPEVNEGGQITYTATLTNAAGT
FT                   PVTVTLSNGAVITIEAGKTTGTVTVDAPKDDVYKDAGKVETTISTTTGGNFENLVTSTA
FT                   PAVTTVNDTIDTSTVSLTATANVAEGETVVYTATVTAPVTGSPVVVTLSNGQTITIAVG
FT                   ETTGTVNFVAPNSPLAGGSSLSVTIDKATGGNYENLAVDGKSADTSVSDTVDTTNLNLT
FT                   ATDSVAEGGSITYTATLTNPAGTPVTVTLSNGAVITIEAGKTTGTVTVDAPKDDVYKDA
FT                   GKVEATISTATGGGFENLVPSTVPAVTNVTDTIDTTTVKLTATESAAEGGTVTYTATVG
FT                   APVTGSPVTVTLANGQSITIEVGKTTGTVTTTAPNDALNGHTPLTNSITGVSGGNYENL
FT                   VADKTPVSTTVTDTVDTTNLTLSATGSVAEGGSIVYTATLTNPAGTPVTVTLSNGAVIT
FT                   IEAGKTIGTVTVPAPADDVYKDAGKVEVTIKDATGGNFENLVPSTVPAVTEVTDTIDTT
FT                   TVKLTASETAAEGGTVTYTATVGAPVTGSPVTVTLANGQQITIEVGKTTGTVTTTAPND
FT                   VLNDHAPLTNAITDVSGGNYENLVADKTPVSTTITDTIDTTNLSLTATGTVAEGGSIVY
FT                   TATLTNPAGTPVTVTLSNGSVITIEAGKTTGTVTVPAPADDVYKDAGTVEATIKSATGG
FT                   NFENLVTSTTPAVTNVTDTIDTTTVKLTATESAAEGGTVTYTATVGAPVTGSPVTVTLS
FT                   NGQSITIEVGKTTGTVTTTAPNDALTGHAPLTNAITGVTGGNYENLVADKTPVSTTVTD
FT                   TVDTTNLTLSATNSVAEGGSIIYTATLTNAAGSPVTVTLSNGAVITIEAGKTTGTVTVP
FT                   APADDVYKDAGNVQATITNATGGNFENLVPSTVPAVTQVTDTIDTTTVKLTATESAAEG
FT                   GTVTYTATVGAPVTGSPVTVNLSNGQSITIEVGKTTGTVTTTAPNDVLNGHAPLTNAIT
FT                   GVTGGNYENLVADKTPVSTTVTDTVDTTNLSLSATGTVAEGGSITYTATLTNAAGTPVT
FT                   VTLSNGAVIIIEAGKTTGTVTVAAPADDVYKDAGNVQATITNATGGNFENLVTSTTPAV
FT                   TSVTDTIDTTTVKLTATATAAEGGTVTYTATVGAPVTGSPVTVNLSNGQSITIEVGKTT
FT                   GTVTTTAPNDVLTGHAPLTNAITGVSGGNYENLVADKTPVSTTVTDTVDTTNLSLSATG
FT                   TVAEGGSITYTATLTNAAGSPVTVTLSNGAVITIEAGKTTGTVTVPAPADDVYKDAGNV
FT                   QATITNATGGNFENLVTSTTPAVTSVTDTIDTTTVKLTATATAAEGGNVVYTATVGAPV
FT                   TGSPVTVTLSNGQSITIEVGKTSGTVTTTAPNDVLNGHAPLTNAITGVSGGNYENLVAD
FT                   KTPVSTTVTDTVDTTNLSLSATNSVAEGGSITYTATLTNAAGTPVTVTLSNGAVITIEA
FT                   GKTTGTVTVPAPADDVYKDAGNVQATITNATGGNFENLVTSTTPAVTSVTDTIDTTTVK
FT                   LTATATAAEGGTVTYTATVGAPVTGSPVIVNLANGQSITIEVGKTTGTVTTIAPNDALT
FT                   GQAPLTNSITNVSGGNYENLVADKTPVSTTVTDTVDTTNLSLSATGTVAEGGSITYTAT
FT                   LTNAAGSPVTVTLSNGAVITIEAGKTTGTVTVPAPADDVYKDAGNVQATIKSATGGNFE
FT                   NLVTSTTPAVTSVTDTIDTTTVKLTATTTAAEGGTVTYTATVGAPVTGSPVTVNLANGQ
FT                   SITIEVGKTTGTVTTTAPNDALTGHTPLTNSITNVTGGNYENLVADKTPVSTTVTDTID
FT                   TTNLSLSATGTVAEGGSITYTATLTNAAGSPVTVTLSNGAVITIDAGKTTGTVTVPAPA
FT                   DDVYKDAGNVQATITNATGGNFENLVTSTTPAVTSVTDTIDTTTVSITGSTSVTEGQTA
FT                   SYTVSLTHPAQTEVTLKIVYSGTAADGSDFTGVYTVKIPAGASSAQFNVATIDDKITEG
FT                   TENFVVKIDSATGGNFENLAVSSTNGSVSTSIIDNDAPPVIDLDANNSSGATGADYKVT
FT                   FTEGTTGPGVSIADTDIKITDPDSTMLTGATIVLTNRQDGDALNLGNSVNGITINANST
FT                   NGTVTLTLSGNATLADYMQAIKNISFTNSSEDPSTVPRIITVTVTDGGNYSNTATTTVN
FT                   VVAINDAPVAAPVNVTGTEDTPLILGWSTFGVSDVDSPASSLGVKITQLPGEGKLQYLD
FT                   GSTWKDVANNQTFSKADIDAGKLRFVPDANESGVNGYGGTGVGNNQADYAQIKFQPTDG
FT                   QLLGNTGTIKIDITPVADAPTLSVADNSVKSTGLIKEVWTGLSGLGTDGSGANSTTLKN
FT                   VIDGAGKPNTSGTVNNVQSDGSVTAGTASKTSGLIYLEAGKTYTFSGTGDDSLLVTIGG
FT                   KSVASTTWGAGGNLNGSFTPTTSGYYTLDIYHHNQSGPGSYDVNLSVNGSTPIDLSSAG
FT                   VPIYTGVQDLVNAGVTVSDLHGSNGEGYYDGYKLNTGAEGTTVKLSSISTALTDTDGSE
FT                   TLSIKISGAPVGSVLSDGAGHSFTVTATSGDANVTGWNLGTLTVTPPTYYNGQFNLTVT
FT                   STSTEQVGGSASTTATIPVTVVPAVYNSIVATSADDTVTGTDGNDIMVADIGGLTVVPG
FT                   TNYNIAFMVDSSGSMSASSINAAKDSLTSVFNTLKQSLGGSNSGTVNIFLVDFDTQVNK
FT                   SVSVNLNDPNALTLLKAVLDSMASGGGTNYEDVFKATANFFQSAEAVANTGAKNLTYFI
FT                   TDGQPTYYQSNEQTNPTLYGNVKLDDVVKTSNYKLGSSFATYIDSTHYLSISTSGEVVL
FT                   QTLKNNNWSWNSLGTIHAQGDGTYEISSLAGSGNSTSSNTTDNSAAGFALLSGLSNVEA
FT                   IGLNNGVSLNDLKPYDSDKTPQTNIDPKDLANSIIGHTEATMPGNDTVSGGDGNDILFG
FT                   DLVSFNGIAGEGYQAMQAFVAKETGVDVSKVTTSNVHQYITEHYQAFDVSGAHDGNDTL
FT                   LGGAGNDILFGSGGNDLLDGGKGNDILLGGTGNDTLIGGQGNDILIGGSGADTFVWKAG
FT                   DTGNDVIKDFKASEGDRIDLRDLLQGETGSTIDNFLKITTVDGVSSLQVSSGGKFNSGD
FT                   AAAATPDVTIKLEGNNWSSANIHNLIAGSDPTIKVDHNNS"
FT   gene            161000..162352
FT                   /gene="lapE"
FT                   /locus_tag="Pfl01_0134"
FT   CDS_pept        161000..162352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapE"
FT                   /locus_tag="Pfl01_0134"
FT                   /product="Outer membrane component of ABC transporter
FT                   required for LapA secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71878"
FT                   /db_xref="GOA:Q3KK28"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK28"
FT                   /protein_id="ABA71878.1"
FT                   /translation="MRSHLFKALPFALAASFVQAQSLPEAMQQALDVHPEIQAGVNSRL
FT                   AADYQLKAAKGGYLPKVDLLGGYGREGTDSVTTRANGGGNHWETLNRSESSLRLSQMVF
FT                   DGFATSSEVGRQQATVNSRAYSLLGTSERTALTVAQVYLDVLTRREFVRLAEENLKSHQ
FT                   RIYDQIQLRTQRGVGSGADLDQAEARMAQARNNLITEQTNLADSETNFLSAVGQMPDQL
FT                   ERPAPFMAMMPANLNEARQQMLENSPILRSAESDIAAAEKQYETAKSTFYPRFDAELGR
FT                   TADNDLDGQNGHNNEWQAMLRMRFNLYSGGSNKADLESKSYLSNQALDIRNNALRQLNE
FT                   ELGLAWNALNNANAQVPIAQQYVDHSTSVRTAYQRQFSLGERTLLDLLDSENELFTASR
FT                   RLAEIKNIQLFTQYRIKATMGELLKSQGVVAPLASVVQNDVKPKVQLPGMN"
FT   sig_peptide     161000..161062
FT                   /gene="lapE"
FT                   /locus_tag="Pfl01_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.962 at
FT                   residue 21"
FT   gene            162378..164543
FT                   /gene="lapB"
FT                   /locus_tag="Pfl01_0135"
FT   CDS_pept        162378..164543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapB"
FT                   /locus_tag="Pfl01_0135"
FT                   /product="ATP binding cassette protein component of ABC
FT                   transporter required for LapA secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71879"
FT                   /db_xref="GOA:Q3KK27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK27"
FT                   /protein_id="ABA71879.1"
FT                   /translation="MSSVESEVSRVHLSHDPRALHDDPLLDGLLALCMLHQKPASAAML
FT                   TTGLPLPKQRLSVELLPRAAARAGLQGRVLQRKLEEIPAIAMPALLLLKDGRSAVLLGW
FT                   QGENEARVLLSESDGGESLVSRELLADDYTGKVFFAQPQHKFDVNHGTLIPRARSWFRD
FT                   TLKRSRWLYADAIAASFLINIIAMAAPLFVMNVYDRVVPNQAEATLWVLALGITGAYLF
FT                   DLILKSLRSLCLDLAGKKTDLIISATLFERIVGMAMKYRPARVGSFAQNIHEFQSLRDF
FT                   LASLTLTSLIDLPFTLLIFIVIAILGGHLVWIPVLAFPIALLIGYALQKPLVATMERTM
FT                   ALGAERQSSLIETLAGLDAVKVNNAESERQYQWEQTIGTLSRLELRVKMLSGLAMNITL
FT                   LIQQLAGVIMIVFGVYQIIAGNLSMGGLIACYMLSGRALSPLASLSGLLTRYQQARVTM
FT                   TSVDQMMELPQERNFEERPLSRKVLQGAIECRQLSFTYPEQQNPALKNINLVIRPGEKI
FT                   GIIGRSGSGKSSLAKLLVGLYQPDDGALLVDGVDIRQIDVSELRYNIGYVPQDIQLLAG
FT                   TLRDNLISGARYVEDELVLQAAELAGVHEFARLHPQGYELQVGERGQNLSGGQRQNVAL
FT                   ARALLLNPPILLLDEPTSAMDNTGEERLKQRLAAVVENKTVVLVTHRASLLSLVDRLLV
FT                   VDRGQILADGPKAAVMEALKKGQISVA"
FT   gene            164533..165900
FT                   /gene="lapC"
FT                   /locus_tag="Pfl01_0136"
FT   CDS_pept        164533..165900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapC"
FT                   /locus_tag="Pfl01_0136"
FT                   /product="HylD like membrane fusion protein component of
FT                   ABC transporter required for LapA secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71880"
FT                   /db_xref="GOA:Q3KK26"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK26"
FT                   /protein_id="ABA71880.1"
FT                   /translation="MLLKSGFKDSIRRYFKGSASLQGQPLPEVNKALIEDAPRVVRLTI
FT                   WAIIGFFVFLMLWANFAVIDEVTKGDGKAIPSSKIQKIQNLEGGIVSELFVKEGQIVEA
FT                   GAPLVRLDDTRFASNVGETEADRLSMLLRVERLSAEVDDRPLNFPEDVLKAVPGQAKSE
FT                   ESLYISRRQQLHDEVGGLQEQLIQRQQELREFTSKQAQYRQQLGLQRQEINMSEPLVAQ
FT                   GAVSPVEVLRLKRAEVETRGQLDATTLAIPRAESAIKEVQRKIDETRGKFRSEALTQLN
FT                   EARTDLNKAQATGKALEDRVSRTLVTSPVRGIVNKMLVNTIGGVIQPGSDLLEIVPLDD
FT                   TLLVEAKIRPQDIAFLHPGQEATVKFTAYDYTIYGGLKAKLEQIGADTITDEDKKTTYY
FT                   VIKLRTERSHLGTDEKPLLIIPGMVASVDIITGKKTVLSYLLKPIIRARAEALHER"
FT   gene            166188..167084
FT                   /locus_tag="Pfl01_0137"
FT   CDS_pept        166188..167084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0137"
FT                   /product="putative taurine catabolism dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71881"
FT                   /db_xref="GOA:Q3KK25"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK25"
FT                   /protein_id="ABA71881.1"
FT                   /translation="MSAATATPSAATAAPQTFEIRPFSGAVGAEIIGLDLTRPVNDEDF
FT                   ASIHRAHLDHHVVVFRDQRITPQQQIDFSRRFGVLQIHVLKQFLLANHPEILIVSNIVE
FT                   NGQNIGLGDAGKFWHSDLSYKELPSLGSMLHAQELPPEGGDTLFADMHKAWDSLPDALR
FT                   KAVEGRSAAHSYTARYSETKFEGNWRPTLTPEQLAQVAEVVHPVVRTHPENGRKALFVS
FT                   EGFTTRIVGLPEDESKQLLDELYAHSVLPQNIYRHQWQPHDLVFWDNRSLIHLAAGCPA
FT                   HLRRKLYRTTIQGDAPF"
FT   gene            167103..168128
FT                   /locus_tag="Pfl01_0138"
FT   CDS_pept        167103..168128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0138"
FT                   /product="puative ABC transport system, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK24"
FT                   /protein_id="ABA71882.1"
FT                   /translation="MSKRLPFAPLAAAIGLGFSLIAGSLVAPTVAHAEGEIRIAEQFGI
FT                   VYLLLNVVRDQGLIEKYGKQEGLDIKVDWTQLSGGAAVNDALLSGSIDIAGAGVGPLLT
FT                   IWDRTHGKQNVKAVASLGNFPYYLVSNNPKVKTIADFTEKDRIAVPAVGVSVQSRFLQY
FT                   AAAKQWGDKEFNRLDKYTIAVPHPDATAALIAGGTELTGHFSNPPFQDQALENPNVHVV
FT                   LNSYDVLGPNSPTVLFATEKFRNENPKTYKAFVEALTEAAQFAQNDKGAAADTYIRVTK
FT                   AKIDRAALLKIIDNPQFEFSVTPKNTYPLAEFLYGVGAIKNKPESWKDYFFQDAKPLQG
FT                   S"
FT   sig_peptide     167103..167204
FT                   /locus_tag="Pfl01_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 34"
FT   gene            168134..168994
FT                   /locus_tag="Pfl01_0139"
FT   CDS_pept        168134..168994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0139"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71883"
FT                   /db_xref="GOA:Q3KK23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK23"
FT                   /protein_id="ABA71883.1"
FT                   /translation="MNAPLQGHAASNPIATAQALLAVDQVSLEYRTPQRVVRATHQVSF
FT                   EVDQQDRFVLLGPSGCGKSTLLKAVAGFITPCEGEIRLQGQRVDAPGPDRIVVFQEFDQ
FT                   LPPWKTVKQNVMFPLLASRTLKKKEAEERALHYLEKVGLAAFADAYPHTLSGGMKARVA
FT                   IARALAMQPKILLMDEPFAALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEALVVGN
FT                   RILLLSPHPGRVRAEVHSHQYDLHSLGSVAFQESARRIHRLLFDEGQSPETERELDFTD
FT                   IRIAY"
FT   gene            169015..169881
FT                   /locus_tag="Pfl01_0140"
FT   CDS_pept        169015..169881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0140"
FT                   /product="putative ABC transport system, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71884"
FT                   /db_xref="GOA:Q3KK22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK22"
FT                   /protein_id="ABA71884.1"
FT                   /translation="MSHSSSVRQEFENDLQPLTSVPVERELPLGQRLWQQGWLRKSVIL
FT                   ILLAVLWEVVARVQNNDLLLPSFLQTSHALYDGLLSGELLGKVWISLVVLIKGYLIGIV
FT                   LAFALTTLAVSTQVGRDLLSTLTSMFNPLPAIALLPLALLWFGLGQNSLIFVLVHSVLW
FT                   ALALNTYAGFLGVSETLRMAGRNYGLKGMRFVLFILIPAALPSILAGLKIGWAFAWRTL
FT                   IAAELVFGATSGKGGLGWYIFQNRNELYTDKVFAGLAVVILIGLLVENLVFDTLERVTV
FT                   KRWGMQR"
FT   gene            169940..170857
FT                   /locus_tag="Pfl01_0141"
FT   CDS_pept        169940..170857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0141"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71885"
FT                   /db_xref="GOA:Q3KK21"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK21"
FT                   /protein_id="ABA71885.1"
FT                   /translation="MQLPDMNLLVALDALLDEGSVVGAARRMNLSPAAMSRTLTRIREA
FT                   IGDPILVRAGRGLVPTPKALELREQVRDVVEQAALLFRSADAVELGTLRRRFSIRANDF
FT                   FVGVYGGKLFDTLDQLAPHCELRFVPEGDGDDEALREGRIDLSVSNTRPVTPEVKVQNL
FT                   FSTHFVGLVREDHPLLDGEITAERYAGFSHISMSRRGIARGPIDTALNALGLERRVAVI
FT                   APSFHAAMFALPDSDLILPVPKEALLSVRRLGLKLRSFDLPIPLPTLMLTQAWHPRFDK
FT                   DPAHRWLRETLKTCCDETWLAAQP"
FT   gene            170960..172495
FT                   /locus_tag="Pfl01_0142"
FT   CDS_pept        170960..172495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0142"
FT                   /product="putative ABC transport system, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71886"
FT                   /db_xref="GOA:Q3KK20"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK20"
FT                   /protein_id="ABA71886.1"
FT                   /translation="MTSLTVTAPIATAAPMAAAPPVFGARIIIGLVGVLLAVLVSGLNE
FT                   MVTKVALADIRGALSIGYDEGTWLVASYTATSVAAMAFAPWCSVTFSLRRFTLCAIGVF
FT                   TLLGVLCPFAPNYESLLLMRILQGLAGGALPPMLMTVALRFLPANIKLYGLAGYALTAT
FT                   FGPGLGTPLAGLWTEYVGWQWTFWQIIVPCLIAMAMVAWGIPQDPLRLERLNSFNWKGL
FT                   LLGFPAICMLVIGLLQGNRLDWFESNLICALLGAGSLLLVAFLINEWSQPIPFFKLQML
FT                   GIRNLSFALMTLAGVLVVLLAVVLIPSSYLAQVQGYRPVQTAPIMLIAALPQLIALPLV
FT                   AALCNLRWVDCRWVLGIGLGMLTLSCLGGSQLTSEWIRDDFYVLQWLQIFGQPMAVLPL
FT                   LMLSTGSIQPQDGPFASAWFNTVKGLAAVVATGVIEALTTSRLHFHSTMLVDRLGNSPL
FT                   AASNDPGLAHRLHEQAVVLTSSDLYLCMAGVAVALILLILWLPTRIYPPRAPT"
FT   sig_peptide     170960..171034
FT                   /locus_tag="Pfl01_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.842 at
FT                   residue 25"
FT   gene            172515..173585
FT                   /locus_tag="Pfl01_0143"
FT   CDS_pept        172515..173585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0143"
FT                   /product="putative HlyD family efflux pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71887"
FT                   /db_xref="GOA:Q3KK19"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK19"
FT                   /protein_id="ABA71887.1"
FT                   /translation="MTTQAKQKLAVAVAAALAVGVLVYLAMPGLFGKRTQQNTNDAFVS
FT                   ADFTLVVPRVAGFIKEVLVEDNQQVKAGQLLALIDDRDLRAAAEAADAQTLVARAQLQN
FT                   AKATLERQSSVIAQAQASVVSAKAEMAFAQQELNRYNHLAGVGAGTVQNAQQARTRIDQ
FT                   ASARLDTATAKLAAERKQVEILTAQRDAAEGSLKHAQAALEIASFELSYTRITAPQDGM
FT                   IGERAVRVGAYVTPGSKLLAVVPLKQAYVVANFQETQLTDVQPGQDVVVRVDSLGGEAL
FT                   TGRVESIAPATGVTFAAVKPDNATGNFTKVVQRIPVKVLLYPGQPLAERLRVGMSVEAS
FT                   IDTKSSATSVREVTQR"
FT   sig_peptide     172515..172595
FT                   /locus_tag="Pfl01_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.696 at
FT                   residue 27"
FT   gene            173582..175033
FT                   /locus_tag="Pfl01_0144"
FT   CDS_pept        173582..175033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0144"
FT                   /product="putative ABC transport system, lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71888"
FT                   /db_xref="GOA:Q3KK18"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK18"
FT                   /protein_id="ABA71888.1"
FT                   /translation="MKRFQSLTVVLSLSALAACTVGPDFQKPQATQIAEWAKPSKTAVS
FT                   QAVSEPLNERWWEVFHDAQLSALTQRALRSNLDLQLASSRLQQSRAARQVITADRYPTT
FT                   AATGSYARKRNSGEGLNDPSGHNGDSAFNLWDAGFSASWELDFWGRVRRETEAADANLE
FT                   VAENDRRGVLLAVLADTAQNYIQLRGVQNTRAVTEQNLDVARHSLKLSQLRLNDGVATD
FT                   LDVAEAAAQVAAIESRLPALEQRQAQLINAISLLMGEPPQTLAKELSTDAPVPQSPLTV
FT                   AIGLPSQLAERRPDIRQAEARLHAATANIGVAKGDFYPRITLSGNLGSQAMQLSDFGSW
FT                   GSRAFGIGPQFSLPLFDGGRLRGVLQLREAQQQEAAIGYQQTVLRAWHEIDDQLTAYNA
FT                   SQRRRDSLAEAVRQNQIALRTAQQQYVEGVVDFVNVLTVQGALLATQEQWVESSTGVSL
FT                   AMIGLYRALGGGWESVYPVGEMAQR"
FT   sig_peptide     173582..173662
FT                   /locus_tag="Pfl01_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.403 at
FT                   residue 27"
FT   gene            175117..175896
FT                   /locus_tag="Pfl01_0145"
FT   CDS_pept        175117..175896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0145"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71889"
FT                   /db_xref="GOA:Q3KK17"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK17"
FT                   /protein_id="ABA71889.1"
FT                   /translation="MRRFRGWVVGLTFVTCAVQAQTPAPDDPLLDNGGAANASASSEAR
FT                   GVLRARDQATLASELSGRIVELPFSEGESFKKGDTLARFDCSAYQAQLNAAQAASRGAG
FT                   EELAHNRQLAALNSVGRFEVARAEAKVSETQAQSQVYQVQVKRCSVVAPFDGQVVERKV
FT                   QRYESVPAGAPLLDVVDNRTLEIHLLVPSRWMARLKPGQSFSFVPDETGQPIDATVKRL
FT                   GARIDEGSQTLLLVATLPEAKGLLAGMSGTAHFPEFK"
FT   sig_peptide     175117..175179
FT                   /locus_tag="Pfl01_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            175893..177212
FT                   /locus_tag="Pfl01_0146"
FT   CDS_pept        175893..177212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0146"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71890"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK16"
FT                   /protein_id="ABA71890.1"
FT                   /translation="MNAPVSGAAEQVFARFLDLERQTRAAHDISQLAYSLVNDGQSLFG
FT                   FRHAALLIAGKVQAVTGVSAVEPNAPFVAFVEQAVAQLFKQDVLKQARVITPEMVGESI
FT                   QADWRSLSAMQVFWLPLIDRQGQVFGGLWLARDLPWNPSEQVLLSQLGDTYSHAWLALQ
FT                   PRKPWRLRWTRKRQVALVAVLLLGLLIPVRQSVLAPAEVVPQGGRVVAAPLDGVIAEFL
FT                   VKPNQSVKTGDLLLRFESTTLKAQADVAERALGVAEAELKANSQRSFVDAESSSRVDLL
FT                   AARAEQKRAERDYARELLNRSEVRAERDGIAVFADAERWTGKPVQTGERLMEIADPSQA
FT                   ELRIELAVGDAISLEPGAEVALFLDSDPLQRHLATLERSAYEAQPTAGGQLAYRLDANF
FT                   ADAPPRIGLRGTAKIFGERAPLALYLLRRPLAGLRQSVGL"
FT   gene            177213..179309
FT                   /locus_tag="Pfl01_0147"
FT   CDS_pept        177213..179309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0147"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71891"
FT                   /db_xref="GOA:Q3KK15"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK15"
FT                   /protein_id="ABA71891.1"
FT                   /translation="MTLPNLRADLQLSPAAPALDGSPRWTLADPVRGRYFKLGAAAMRL
FT                   LRHWSLGDPEQVLRAANREPGLPLDGVELEQLLTFLRGHDLISALDDQQRASYSLKALA
FT                   QRQSLWTILLHQYLFFRIPLWRPDAFLNRAWPWLERFGPRVLRYVLPATLALGVFLVSR
FT                   DWQRFVGTFPHLFSLGGAIAFGISLFFAKLCHEFGHAFMAKRAGCRVQSMGVAFMVLLP
FT                   MFYTDVSDAWRVNDRRARLLIGAGGVLAELLLASIALLVWSFLPDGPGRTAAFMLASAT
FT                   WITTLVVNLNPFMRFDGYFLLSDLWEVDNLQGRAFAFCRWRLREFLFGYGAPAPEPWSP
FT                   TMQRRLLIWGYGSWLWRAALFFGIALAVYHLFFKVLGIFLMLVELVWFIFLPIMSEWRQ
FT                   WWSRREQAHGPRVLLSSLAVLGLLLVLIVPWRSSVELPTMLEGGRASALHAPTAARVKA
FT                   VRVADGQTVAQGDVLIELESPDLDSRQAIVRREIRIQQLLMRRQAGRSETAADAGIVEQ
FT                   RLAEAVAEYRGLTAQRERLLLRAPHAGTVRDLLPNLTPGRWLSSKDALARVVEDGTRLR
FT                   GYLAEAELWRVKPGATGRFIADDPMHAAIAVQLNEIDTNGVAYVDQEALTSDHHGPIAV
FT                   RRDQQHRAEPVQAQYGVRLTTLDQAATPVQPLRGVVVLQGSGESVLGVAWRRMAALGVR
FT                   ESGF"
FT   gene            179321..179812
FT                   /locus_tag="Pfl01_0148"
FT   CDS_pept        179321..179812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0148"
FT                   /product="Putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71892"
FT                   /db_xref="GOA:Q3KK14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK14"
FT                   /protein_id="ABA71892.1"
FT                   /translation="MTENLAADGLVVRPSRASDGPFLQSLYQSARPDLQWIDGEQEQVQ
FT                   QIVAQQFQVQEQGMGENHPNAMHYIVEKLGTAIGALSTDFGANEIRVLYLAFIPQARGK
FT                   GYGRTVLQGVQKAAQQVRCPVATVVWANNPHARQHYLALGFAVEERNPAAERLVWYPQA
FT                   "
FT   gene            complement(179814..181997)
FT                   /locus_tag="Pfl01_0149"
FT   CDS_pept        complement(179814..181997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0149"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71893"
FT                   /db_xref="GOA:Q3KK13"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK13"
FT                   /protein_id="ABA71893.1"
FT                   /translation="MTSFEKDLQSPLGSRMLTCPAGGKWTSFQLIDEFCSGEPYAGLAY
FT                   IVTDSEGHKYTGRLDEAGKGKVNNHFAGPVTLLFDQAYEGKEKLYSYLQGRPHYPLKIT
FT                   ELQVRAEATHYLNPNATRTRERPEIADGGDYFQVEVRHLVRHASHLPPEVYRDYPLDSG
FT                   CAAIMREHGKLGVALMPQRHTILEVRPLRALRPILSTAPAFCALNLYQLALMATLSYCP
FT                   FGQKPKVPCAETRSVKFLLQPSVGNWFGDALPKGEELWKVDSAQTKAYYPLYEDVPYSA
FT                   RLEIIPFDPNLYAVNRHTPERDPEHPASVHFLDDIGSKDSTDTQAFITHNDELILIAVR
FT                   GTAEIVADGLRDADALQVPFAEGEGQVHRGFYEAAKKAAAFAVNYLEKFYTGQTLLICG
FT                   HSLGGAITLLLAEMLRRRPEGYKIQLYTYGAPRAGDADFVKGAADLVHHRMVNHNDPVP
FT                   SVPGSWMNTKADIYGTGAALTFVNVPLGLSVFVAGITNWTGEAYDHHGRLRHAMPVEFG
FT                   RQQVSSILWEPGCDTITQHAACDVAIRQRHGLPDRPTLLKQIFDAGHHSMTGAYIPACW
FT                   AVLRRWQEAQESNRTLVTEREFALVESALQRITDQLRRQRSNLPGRPDSYVRSRKNIVE
FT                   ALNHEIENIRTTRERLASLRHRRLTTTDVYGSLAEQPERLAESLPRWRLHPENLATEQL
FT                   AMAPEAAEDDPLLVTLYGHRIGAPHTFDIDSII"
FT   gene            complement(182010..182834)
FT                   /locus_tag="Pfl01_0150"
FT   CDS_pept        complement(182010..182834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0150"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK12"
FT                   /protein_id="ABA71894.1"
FT                   /translation="MTSLEKDLQSPALTALKTRLTRRVATLGCCLVLIASCKTEPPNTF
FT                   KFTADLPPGFAYVAAVYYVPEKGQTCTLDRRDNLAPVFNSKWRTEYKPDAEITIRKIVK
FT                   GCPLVVRRIELEINSSYGKTRGDFSGDEAMVFIRDDLQEQFKGVFNEAGESTFHGQCEW
FT                   WFRTSGKPRILRKILDCRTVDAQGARAYGKTFGAFNPDQLPGKTVRMKITLAADERPAI
FT                   KDTWVKVTNGWKRCMGDNFEDQYAFCYGNYTDFSTFTMPDGQVCTIYPGCTE"
FT   gene            complement(182847..183620)
FT                   /locus_tag="Pfl01_0151"
FT   CDS_pept        complement(182847..183620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0151"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK11"
FT                   /protein_id="ABA71895.1"
FT                   /translation="MKIQLKSIVLISAFAALGGCQGKPPNTFKFTADLPPGFAYVAAVY
FT                   YAPEKGKTCTLERRDNLAPVFNSKWRTDYKPDAEITIRKIVKGCPLVVRRIELEINSAY
FT                   GKDWSDFSRDEAMVFIRDDLEEQFKGVFNEAGESTFHGQCEWWFRTSGKPRILRKILDC
FT                   RTVDAQGARAYGKTFGAFNPDQLPGKTVRMKITLAADERPAIKDTWVKVTNGWKRCMGD
FT                   NFEDQYAFCYGNYTDFSTFTMPDGQVCTIYPGCTE"
FT   sig_peptide     complement(183552..183620)
FT                   /locus_tag="Pfl01_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            complement(183617..184465)
FT                   /locus_tag="Pfl01_0152"
FT   CDS_pept        complement(183617..184465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71896"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK10"
FT                   /protein_id="ABA71896.1"
FT                   /translation="MTDSVVQRWLFEQHHADRLLCLVLDSQNERDMRQRWLKSSRYEQY
FT                   ASVYGETVVAELADTGPFLFTFDQPDDRRLDALLDRPDSHWGWLASLGQGELNAWVRHW
FT                   QERLLVGTRPHQALYRFHDNRVLARALEHLPSEALPAYLGPAISVCYWQGSHWQSTDNP
FT                   APGTYPLPDSPPWLHLPMPDEQAMEIRLANAHRFLLAEHVQAYAGLACTQDPHIWLRER
FT                   LAQAQAWGWLAPERLEFLLIQSLHTPTLVPHWQPRPDETPDEHFDRVYLLSKSWSGEMP
FT                   S"
FT   gene            complement(184462..186531)
FT                   /locus_tag="Pfl01_0153"
FT   CDS_pept        complement(184462..186531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0153"
FT                   /product="putative VgrG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71897"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK09"
FT                   /protein_id="ABA71897.1"
FT                   /translation="MFNANARLRLNTDDLDHDLQVLSFTGTESISQPYCFNVKLVSSRP
FT                   DIDLPDLMHRQAFLAFDDNGHGVHGQIQHIGRGDIGHRLTQYHLILAPCLANLGHRFNQ
FT                   RIFQNLSIAQIIGQILQEHGIHADGYLFQIGQALPDREYCVQYNESDLHFIQRLCQEDG
FT                   LHYHFRHSLDRHLLVFGDDQTVFPRLARPTPFKKRNAMVADRPVIHRFECGRNTRTNRT
FT                   RRRAYDFKKAHLVLESEARIPNEPRQPDLEDYLYPDRVLNREHGKLLTRRALERHRSDE
FT                   LTGEGDSDEPALVSGHFLSLSEHPDPALNDLWLLTGIRHEGKQPQVLEESGSDIAVKDQ
FT                   SDFVQGYRNHFEVTPWDAIYRPSLRYDKPSIGCTQTAVVTGPEGEDIHCDAYGRVKVQF
FT                   FWDREGRHNDKSSCWLRTTTNWAGNAHGSVIIPRVGMEVLVTFLNGDPDHPVISGCLAN
FT                   SANPVPYELPAHKTRSVFRSRSTPDSNGFNELMIEDRAGQELIYLRAQRDLQQKIEHDS
FT                   HLEVGNERRESIRGNSVSVLHAEEHRTLTGHRKTHLKASDHLHVSDSSHTRIGQSLTME
FT                   VGRQLCFSAGDHLVLEAGKSISLKVGGEHFVLDHGGLFGSSDLLIGGVPIPFLRARLLQ
FT                   PEDIEDLSAPAPLPPLVAPSQQALMAASKSLGADFCPICEACRAGECAIAEAAA"
FT   gene            complement(186693..187004)
FT                   /locus_tag="Pfl01_0154"
FT   CDS_pept        complement(186693..187004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK08"
FT                   /protein_id="ABA71898.1"
FT                   /translation="MLQAVQIQHVQPLLGQQRTLYLPDGTALPIRIEYLDEVPAAKTRY
FT                   SERMPFCLEFNSLVPTEFVDGLCALDLPELGRVEDIFVSRVPALGRDPQLGYFCISFN"
FT   gene            complement(187061..187648)
FT                   /locus_tag="Pfl01_0155"
FT   CDS_pept        complement(187061..187648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0155"
FT                   /product="Putative phage tail collar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71899"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK07"
FT                   /protein_id="ABA71899.1"
FT                   /translation="MEVFMGTIQPFAFNFAPSGWALCNGQILGISQYQALFALLGTYYG
FT                   GNGTTNFQLPNLQGRVPVAQGTGLGLTPRVIGQVYGTENVTATIANMPNHTHAMTGLTA
FT                   NTALSLAVPASNPATVPTATNSYIGASGGGPGSANIYSDAQGATPVPLKGVTTTVTGDI
FT                   SSTGGSQPLPILNPALVLNFSIALNGLFPSRN"
FT   gene            187891..189486
FT                   /locus_tag="Pfl01_0156"
FT   CDS_pept        187891..189486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0156"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71900"
FT                   /db_xref="GOA:Q3KK06"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK06"
FT                   /protein_id="ABA71900.1"
FT                   /translation="MEVLRETPLGDTQDPFAAPNAGVRRLLRWAREHWLIPILLLATAV
FT                   RFYDLTAAAIWGDEGSSLLLARYSPGVIWTHAAFDVHPPLYFMLLHGWIGMFGDGLLAI
FT                   RSFSALAGIATVGLGVSLVDRLATRRAAIIAGVLLALLPTAVRYSQEVRMYALLGLLLI
FT                   GATLVLVKWIRRPQRHRYLLIYALLMTAALYTHYFAVLAALSHWLYLGLIRLLPGYRLK
FT                   HLQRKDWWLANLAIVVLYLPWLPNLIDLLQHMDALKAGGDVGWEDPVTLSSLPSMIWLW
FT                   LIQDEGEHLPLLLFGGVPLALLVLAGVAVARDRSVNHGSVLLAVYTGMPLLLVFAVSFI
FT                   TPVFIERYLTAYALGLPMLAALAIDRLYSSVRVLAMAVLLSLVGVEMIGVNNNATVDRN
FT                   DQFNVMVDYVNRHFASGDRIVTSDMLWYLSYVYYNRTEAQVRLFTPPTAEGRSTRPNHY
FT                   GFGTLVSDEVYLDRLGDLPKDSARVWLIGDLDVEVPDPFLPLPAAWHLRDQVQAGGAKA
FT                   RLFSLQTPNGAGEN"
FT   gene            189624..190469
FT                   /locus_tag="Pfl01_0157"
FT   CDS_pept        189624..190469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71901"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK05"
FT                   /protein_id="ABA71901.1"
FT                   /translation="MKGLQQFHFISGLPRSGSTLLSAILLQNPRFHAGMTSPVGALFSG
FT                   VLEQCSAGSEFGAVIDTDMRRRLLRGLFDSYYADKADKPVVFDTNRQWSARLPAINDLF
FT                   PQAKVIACVRNVAWVMDSLERLYRANPFENTKLFGDAVERNTVYSRCETLAQRNRLVGF
FT                   AWAALKEAYYGEHADSLLIVDYDLLTQAPERVLRLVYDFIGEPWFEHDFEHLAYDAPEF
FT                   DQALGVAGLHKVKPKVALQSRRTILPPDLFKQYADLSFWLDGSASAANVIRMKSDAAIS
FT                   "
FT   gene            complement(190462..190953)
FT                   /locus_tag="Pfl01_0158"
FT   CDS_pept        complement(190462..190953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK04"
FT                   /protein_id="ABA71902.1"
FT                   /translation="MGDDLHRAHALMLVQVIGDLLQTVLAGIELDHLGAGGHALDQAVG
FT                   ILDPGIDEHHALPRHGYRAGGGRGIGLAMGVLAGARVVGGRCFRGIGGGMAVSLGGGVG
FT                   DGGRDGAVEQHARFERHDHGRRQRPLAFGNPRLLLAPPHVAHPDSNTVVDASMKNAAIS
FT                   "
FT   gene            complement(191386..191850)
FT                   /locus_tag="Pfl01_0159"
FT   CDS_pept        complement(191386..191850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK03"
FT                   /protein_id="ABA71903.1"
FT                   /translation="MRRVVATAVAADTSAAGLAAQRTGARPGRTAMTTALTAKTTATTT
FT                   GTAVERTGDTAATAATGRRVAGDRDVVQGEDAGVENPPAHGAGCAVAAITAIARDQAPG
FT                   NDQTIQGHRAAGGDFHHSGPVLAIERDVGNPVVVQVTIDSNVLVDQQFRG"
FT   sig_peptide     complement(191791..191850)
FT                   /locus_tag="Pfl01_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.758 at
FT                   residue 20"
FT   gene            192277..198747
FT                   /locus_tag="Pfl01_0160"
FT   CDS_pept        192277..198747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0160"
FT                   /product="putative hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71904"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK02"
FT                   /protein_id="ABA71904.1"
FT                   /translation="MTGSVPLAFAAIYNNGGTLNTAYVEPPTATIVMADTALKIGETSL
FT                   VTITFSRAVTGFTNADLTIANGTLTAVSSSDGGLTWTATFTPTNNITDSTNLITLDNTG
FT                   VTAISDGVAGVGTTSSVNYAIDTARPTVTIVMSDTALKIGDTSLVTFTFSEAVTGFTNA
FT                   DLTIANGTLSAVSSSDGGITWTGTFTPTASITDTTNLISLDNTGIADLAGNAGSGTTDS
FT                   ANYVIDTVRPTATIVVADSNLAAGETSLVTITFSEAVSGFTTADLTVANGTLSALSSSD
FT                   GGITWTVTLTPTSNITDTTNLITLDNTGVVDLAGNAGSGTTNSNNYAIDTARPTATIVV
FT                   ADNSLRIGETSLVTITFSEAITGLTNADLTIANGTLTAVSSSDGGITWTATFTPTASIT
FT                   DATNLITLNNTGIADLNGNAGSGTTDSNNYAIDTVRPTATIVVADNNLRIGETSLVTIT
FT                   FSEAVSGFTNADLTVANGTLSALSSSDGGITWTATFTPSASVTDTTNLITLDNTGIADL
FT                   AGNAGSGTTDSNNYAIDTQRPTATIVVADSNLSAGETSLVTITFSEAVTGFTNADLTVA
FT                   NGTLTAVSSSDGGITWTATFTPNVGVNDATNLITLANTGIADLSGNTGSGTTNSNNYSI
FT                   DTVLPTATIVIADNALKIGETSLVTITFSEAVTGFTNADLTIANGTLSAVSSSDGGITW
FT                   TATFTPTTSITDATNLITLDNSGVQNLSGNAGSGTTDSNNYAIDTVRPTATILVADTAL
FT                   GIGQTTLVTITFSEAVSGFTNADLTIANGTLSAVSSSDGGITWTATFTPSASIADTTNL
FT                   ITLDNTGIADLAGNAGSGTTDSNNYAIDTVRPTATIVVADSNLSAGETSLVTITFSEAV
FT                   TGFTNADLTIANGTLSAVSSSDGGITWTATFTPTVGIHDATNLITLANTGIADLAGNAG
FT                   SGTTNSNNYSIDTVLPTATIIVADPSLKIGETSLVTITFSEAVTGFTNADLTIANGTLS
FT                   AVSSSDGGVTWTATFTPTTSIADATNLITLDNTGVQNLSGNAGSGTTDSNNYSIDTVRP
FT                   TATIVVADTALGVGQTTLVTITFSEAVTGFTNADLTIANGTLSAVSSSDGGITWTATFT
FT                   PAAGITDTTNLITLDNTGIADLAGNAGSGTTDSNNYAVDSQRPTATIVLSDNTLSAGET
FT                   SLVTITFSEAVTGFDNSDLSVANGTLSNVSSSDGGITWTATFTPNIGVIDLTNLIVLNN
FT                   TGITDLAGNTGTGTTNSPNYSIDTVLPTATIVIADNALKIGETSLVTITFSEAVTGFTN
FT                   ADLTIANGTLSAVSSSDGGITWTATFTPTTNITDATNLITLDNTGVQNLSGNAGSGTTD
FT                   SNNYSIDTVRPTATIVVADTALGVGQTSLVTITFSEAVTGFTNADLIIANGTLSAVSSS
FT                   DGGITWTATFTPAAGITDTTNLITLDNTGITDLAGNAGSGTTDSNNYAVDSQRPTATIV
FT                   MSDIDLRPGETALVTITFSEAVTGFDNSDLSVANGTLSNVSSSDGGLTWTATFTPNIGV
FT                   SDLTNLIVLNNTGTTDLAGNTGTGTTNSANYQVQTQVPTATIVVADPALKAGETSLVTI
FT                   TFSEAVSGFDNSDLTIANGTLSNVSSSDGGITWTATFTPTANVTDATNLISLNYAGVTN
FT                   VSGNSGIGTTDSNNFAIDTALPTATIVVADNRLGIGETTTVTFTFNEAVIGFDLGDISV
FT                   ANGSLSNLTSSDGGVTWTATFTPTANVNDPTNLILIDTGGVQDLAGNLGASIAISNNYI
FT                   LDATRPTVNIVVANPNLGIGQSTTVTFTFSEAVSNFDLSDLSVTNGDLSNLSSSDGGKT
FT                   WTATFTPTANVTDPSNFIALDTSNVTDLAGNTGSTVAVSNNYALDSERPTATVVIANPN
FT                   LGVGQTSQVTITFNEAVSGFDLSDLSVANGTLSNLSSSDGGKTWTATLTPNANVNSASN
FT                   AISINTAGVSDLSGNSGSSVSSSGNYVINTVPVPPVTPTTPLIVVTPDPEFRSSDPVAP
FT                   PPPPNVPLQPIVFTAPTGDLGSPLTFAPLFEQRVIGNGIRPLGDIFINRGALSPSFIAQ
FT                   VFTSSDNGGDGSGHGFLGFGGGDGGVFGSSTLSSLFNQDSSAERDSLNAFGSQSIKGGD
FT                   ISQGLRGVFGAPTLGQQLQQIKDSEQHRVDNLAAALQQIGISEMPA"
FT   gene            198796..200310
FT                   /locus_tag="Pfl01_0161"
FT   CDS_pept        198796..200310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71905"
FT                   /db_xref="GOA:Q3KK01"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK01"
FT                   /protein_id="ABA71905.1"
FT                   /translation="MKKSQKLFGASLLALAISGCAVTSEPIERSVSEQRARADLQSMYK
FT                   GQEPLSGPLTLHQAMARAVKYNLEGRLKIMEEALAKRQLDLASFDMLPRMALDAGYVGR
FT                   NNVSASSSQSVRTGTQSLEPSTSQDRDRDVADLTMVWNVLDFGVSYISAKQQGDQRLIV
FT                   QERRRKVINTIVQDVRSAYWRAMAAERLLKQIDSLMARVDTARRNSESMSEQRIGDPVQ
FT                   SLGYQRSLIEATRQLEEQRRALSLAKTELATLINLPLGTNLTLATDDGYRIPELKVDLS
FT                   KLEQEALTSRPELREQDYQTRISAAETRKAMLRLLPGLEFSAGGHYDSNSFLVEQGWAD
FT                   YGVKVTWNLFNVISAPAAIDVAKAGEEVATARRQAMSIAVLAQLYVANANYQEALRQFK
FT                   TNQQLSDIDGQIVGQLRNRRQADGIGELDLIQGELNTLQADLRRDLSYADLRNAYGQIF
FT                   ASAGLDPLPDQVQSTEVQSIATALANREAAWASGDISLPVAHAAAQ"
FT   sig_peptide     198796..198867
FT                   /locus_tag="Pfl01_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 24"
FT   gene            200315..200899
FT                   /locus_tag="Pfl01_0162"
FT   CDS_pept        200315..200899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0162"
FT                   /product="putative adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71906"
FT                   /db_xref="GOA:Q3KK00"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK00"
FT                   /protein_id="ABA71906.1"
FT                   /translation="MAPTASISRAQREARNGHRGTAMLLTGLPAAGKSTLAQALHAELF
FT                   SRGLQSVVLDGDGLRVGLNRDLGFTDADRLENIRRASELAALLVENGQIVILAMIAPLA
FT                   ELREVFARRLGEDYREVWCSAALAVCEQRDPKGHYARARRGELAGFTGVSAPYEAPAQA
FT                   SLVLDTGTLTVEACLDRLLTWLGESAVLPKA"
FT   gene            200896..201681
FT                   /locus_tag="Pfl01_0163"
FT   CDS_pept        200896..201681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71907"
FT                   /db_xref="GOA:Q3KJZ9"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ9"
FT                   /protein_id="ABA71907.1"
FT                   /translation="MSRPAFSRLPLTADLPLLLQALASIDDAAWRGHFNTAYFAGDWSG
FT                   VALISAADALTELSPGSAEPIQRPPWLNDRRWQQALRDLPLEIVSARLLRLGPGGQIHE
FT                   HRDYDLEGADADLRLHIPLLSPPAVDFWLDGQRMPMRAGECWFLDLARPHRVDNRDRTA
FT                   RVHLVLDCRPAPWLEQMIVDGLPSTPLPDATETALQRFQRLLVTEPLLSATLQALHDPE
FT                   AFTVQTLALAAERGLHFSREELLAAMRNGRRSWNEQWRL"
FT   gene            201678..202643
FT                   /locus_tag="Pfl01_0164"
FT   CDS_pept        201678..202643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71908"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ8"
FT                   /protein_id="ABA71908.1"
FT                   /translation="MNFDGWLPIRVWKTAEQWQVDWCWFGDTPLHQPFFREAVEDALHL
FT                   PFNQAFRRQTPLSALMDWQTLSPGLLPSAFILHASRCGSTLISQMLARLDDHIVVSEPP
FT                   PLDALLRSDLPDEERRAAIVGLLSAYGQRRRGTEQRLVIKLDAWNIGEWPLLRECFADT
FT                   PWLFVYRDPLEIAVSHLRRPGLHMVPGALGDCVLDDDLPFEGREDFIARRLGRLLEAGC
FT                   VHCRESAGLAVNYSELPDAMSGRLARFFGLSATQCEQALTATAQHAKQPSQPFVVDGEH
FT                   KRREASALLRARIEDCARAPYVALERLRALTISPTDPPYP"
FT   gene            complement(202609..203366)
FT                   /pseudo
FT                   /locus_tag="Pfl01_0165"
FT                   /note="putative membrane protein"
FT   gene            complement(203369..203896)
FT                   /locus_tag="Pfl01_0167"
FT   CDS_pept        complement(203369..203896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0167"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71911"
FT                   /db_xref="GOA:Q3KJZ5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ5"
FT                   /protein_id="ABA71911.1"
FT                   /translation="MNIRCCALALLLLSGSVIAADNPFTAASPVGLWLITLGITFLIAE
FT                   AALPNYGVIGLGGIVMFVIGALILSNAELPVPMMIGLGLVSALLLIALLIRALKTRPRH
FT                   PVSGDAGLLGSVTAVTVVQLEDSRNGWVQLQGERWQVLSATPLHTGQPVRVVGRKGLLL
FT                   QVAATDAAPLGE"
FT   sig_peptide     complement(203837..203896)
FT                   /locus_tag="Pfl01_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            204093..204554
FT                   /locus_tag="Pfl01_0168"
FT   CDS_pept        204093..204554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71912"
FT                   /db_xref="GOA:Q3KJZ4"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ4"
FT                   /protein_id="ABA71912.1"
FT                   /translation="MRMAKKVQSSLNRAQCEYDIVTHPHSSSSLETARVSGIAAERVAK
FT                   SVILDDRHGHYLMAVLPASRHLDLSKVRSSGEWQITRESNLAHIFDDCERGAVPPLGDS
FT                   YGLDMVIDPLLTRQKDIYLEAGNHNNLLHMSMPEFLKMVPHAQVRELSQ"
FT   gene            204684..204929
FT                   /locus_tag="Pfl01_0169"
FT   CDS_pept        204684..204929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71913"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ3"
FT                   /protein_id="ABA71913.1"
FT                   /translation="MENPTHSLPSLFKQLGLDNDPVSIDQFIATHSPLKPELHLCDAFF
FT                   WSKSQADFLRDEILDDADWAEVVDQLDVMLRKGRGM"
FT   gene            205141..205569
FT                   /locus_tag="Pfl01_0170"
FT   CDS_pept        205141..205569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0170"
FT                   /product="putative MarR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71914"
FT                   /db_xref="GOA:Q3KJZ2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ2"
FT                   /protein_id="ABA71914.1"
FT                   /translation="MNISSAMVVAARHWRKICQTTLVNYGISEACAVPLLMIGRLGEGV
FT                   RQVQVAQAAGMESPSLVRLLDQLCHAGFVCRTEDAQDRRAKCLSLTDTGRELVQAVEAQ
FT                   LVRLRHEVLEGIDQRDLEATLRVLRAFEAATPPTVINP"
FT   gene            205566..207629
FT                   /locus_tag="Pfl01_0171"
FT   CDS_pept        205566..207629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0171"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71915"
FT                   /db_xref="GOA:Q3KJZ1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ1"
FT                   /protein_id="ABA71915.1"
FT                   /translation="MNGFFSGMPPARDWFYGIRTFAASMTALYIALLMQMPRPYWAMAT
FT                   VYIVSSPFLGPTSSKALYRAIGTFLGAAAAVLFVPMFVQSPYVLVVVIALWTGILLFLS
FT                   LHLRTANNYALMLAGYTLPLIALPVVDNPLAVWDVAESRTEEIFLGIAVAAVVGAMFWP
FT                   RRLAPVFNDAVGKWFADATTYSLKFLSRDVQPEAVAALRMAMVGSFNSLELMIGQLPHE
FT                   GARPQTVRNTKELRGRMIHLLPVIDALEDSLYALERRTPELVEKFAPLLISTREWLGHK
FT                   DADLERWQALRDQLEALQPSAEALEDRKQLLFSNALYRLGEFIDLWQDCRSLQDAILCE
FT                   RQDSWRAVYRHWRLGRLTPFIDRGLMLYSVASTILAIIVASVLWILLGWTDGGSAVILA
FT                   AVSCSFFASMDDPAPQIYRFFFWTGMSVLFASLYLFLVLPNLHDFPMLVLAFAVPFICV
FT                   GTLTVQPRFYLGMLLTLVNTSSFISISGAYDADFFAFVNSNLAGPIGLLFAFIWTLIAR
FT                   PFGAELAAKRLTRFSWKDIVSMTEPANLAEHRQLGVQLLDRLMQHLPRLALTGQDTGIA
FT                   MREVRVGLNLLDLLAYTPRVTGAPNALLKQVVAEVGEYFRACLKAGERLPAPSALLMTM
FT                   DRTRRALSGHGDEDTRLNLLHALSGLRLALLPGVEFVSNAEPEEPLPEGAPL"
FT   gene            207626..207835
FT                   /locus_tag="Pfl01_0172"
FT   CDS_pept        207626..207835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71916"
FT                   /db_xref="GOA:Q3KJZ0"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ0"
FT                   /protein_id="ABA71916.1"
FT                   /translation="MIGDLDISGIFLPTLLVLMGITYVLFVLVHGVLTRLHFYRLVWHR
FT                   ALFNVALYAVMLYGVDSLSRYLMT"
FT   gene            207832..208719
FT                   /locus_tag="Pfl01_0173"
FT   CDS_pept        207832..208719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0173"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71917"
FT                   /db_xref="GOA:Q3KJY9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY9"
FT                   /protein_id="ABA71917.1"
FT                   /translation="MKKPFLTLGRVVLTLLIVTFAVVVVWRMVMYYMFAPWTRDGHIRA
FT                   DIVQIAPDVSGLIQQVEVKDNQLVKRGQVLFSIDQDRFKLALRQARAAVADREETLAQA
FT                   QREAKRNRGLGNLVPAEQLEESLSKVARAQSALAEALVAVDSAQLNLDRSVIRSPVDGY
FT                   VNDRAPRSQEFVTAGRPVLSVVDSNSFHIDGYFEETKLDGIHVGQSVDIRVIGDRARLR
FT                   GHVESIVAGIEDRDRSSGSNLLPNVNPAFSWVRLAQRIPVRIAFDDVPDDFRMIAGRTA
FT                   TVSIIDDQPQEPAK"
FT   sig_peptide     207832..207897
FT                   /locus_tag="Pfl01_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.341 at
FT                   residue 22"
FT   gene            208716..210158
FT                   /locus_tag="Pfl01_0174"
FT   CDS_pept        208716..210158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0174"
FT                   /product="outer membrane multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71918"
FT                   /db_xref="GOA:Q3KJY8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY8"
FT                   /protein_id="ABA71918.1"
FT                   /translation="MSRALMIAGLGMMLSACSMVGPDYHVPEDAAIQRKDFQGDLAVAG
FT                   KPVVSAPVPADWWRLYQDPRLDQLVQQAMASNTDLRVAAANLSRARAQVDEAEAAGGWS
FT                   GGVKMGAQRLQESGEAFLLPEKVPVANIGDIGISASYQFDLWGTLQRGIEAAKANADAT
FT                   QAAADTARITLVADVVRAYTQVCAANEEQEIAQHSLDLQSQSTSLIQRLRDAGRGDETQ
FT                   VTRSQTQFKSLRADMPRYEAARQAGLFRLSMLLAKPVDQLPAGTATCAELPKIAQLVPV
FT                   GDGAALLKRRPDIRQAERRLAAATAGIGIATGELYPDISFGATIGTVGILDNLGKPSTN
FT                   RWGFGPSLSWSVPTNGARARIREAEATTQGALAHFDGVVLNAIRETQTGLSQYSALLQR
FT                   RDALADAEQSAKLAADQTHRFFQAGRESFLADLQATRTYTDVTAQLAAANTQVAMSQID
FT                   LFLALGGGWESGRTQASSASKP"
FT   sig_peptide     208716..208778
FT                   /locus_tag="Pfl01_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.572 at
FT                   residue 21"
FT   gene            210252..210887
FT                   /locus_tag="Pfl01_0175"
FT   CDS_pept        210252..210887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0175"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71919"
FT                   /db_xref="GOA:Q3KJY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY7"
FT                   /protein_id="ABA71919.1"
FT                   /translation="MKNPYALGFWCALVALVLLSATYFYGIMLAHQIDKAMVFLDSTVA
FT                   LIAVMAIVVVASALVQTQRLKKRQLEQSKTLLLIWDTKVALRKVETVFDRYFWGGYWQP
FT                   GRTFAEVMGELTGTPLEKSLEALKKQCLALDRQVAGDGWHWLNNARELSDVATAMARER
FT                   YQLDFCDPRSDGPGGAVIDRDFEVLVYTWTARLKSFDHQLDEIEVQYS"
FT   sig_peptide     210252..210314
FT                   /locus_tag="Pfl01_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.796 at
FT                   residue 21"
FT   gene            211087..212592
FT                   /locus_tag="Pfl01_0176"
FT   CDS_pept        211087..212592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0176"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71920"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY6"
FT                   /protein_id="ABA71920.1"
FT                   /translation="MNKSAGVLLGIVVAIGAISVGGAWYTGTKIEGVLNNAVANANSEL
FT                   QTAMAGSNGSASLELVSLERNTFSSTAHYRLKGEGEMFGEAPVELLFVDHIEHGPLPFS
FT                   RLVSLKWLPVMATSHFELEKTPITEKWFAATKGAAPLKGVVNIGYDQSTTGNLELLPLE
FT                   TALDDKSNLKFSGLNMDISASAQAQKVKANGYMDSLHLSTVAEDQTPVQIELNGLTLAS
FT                   NLAKSTYGYYTGENTLELTSSKTTFGAKQSVLGVKNFEMKNRTEENGSNASGRADYKVA
FT                   EVTLNDKKIGSANLAMSLKNLDIPSAMSLMQIYQTKLQPYEKAAAEATAAGLPAPELNL
FT                   TEAESTQVKADLQKLLAAGPQLALEDLSLKTANGESRANLVLDLTKPASMDLPPDQLGK
FT                   QLIALLDINVLVSKPMLVDLLSVQAQIDGQTDAKAIVDQASAGADMFAGMAVGSQLATL
FT                   DGTNVVTKLHYAANQVEFNGQKMTVEQFVGFLMSKFGSIEQPQ"
FT   sig_peptide     211087..211155
FT                   /locus_tag="Pfl01_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.911 at
FT                   residue 23"
FT   gene            212850..215330
FT                   /gene="hmsH"
FT                   /locus_tag="Pfl01_0177"
FT   CDS_pept        212850..215330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmsH"
FT                   /locus_tag="Pfl01_0177"
FT                   /product="poly acetylglucosamine porin"
FT                   /note="TC 1.B.55"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71921"
FT                   /db_xref="GOA:Q3KJY5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY5"
FT                   /protein_id="ABA71921.1"
FT                   /translation="MPRIDGPVLHRGLRPLFRVALCSQLLWPAFAFADTAYDQMVLDAR
FT                   AGHYTPALSVLRQVPPAQASTGQVSDHLQIASWAGLDAEVVQVYETQGRERALPVQALT
FT                   ATARAYRNLKRWDQAIQVYNKALTLEPDNADLQLGLALTQADSGKPDEGVIRARSLVAA
FT                   KPDDPSRRLALGYALNRAGKPYDALFEYDQAFIRAGNKPEVAREYVVALQKARLPEPAL
FT                   RLARQRPGLIDPVTLRRLAGDLAAERVRLAELATRSEKERYVIADRALADYDQLLATWT
FT                   PDATAHDDVTRWRIDRLGALKARARTAEVISEYQKLQAEGVKIPTYALRWVAASYLDQR
FT                   QPEIATDLYRQVLAAPDADVGDRLEDTTALYYSLLESDRAEEARKVAEDQASAQKPRVE
FT                   LKGLPIGNPNDEWMDAQQLAAQAGTYGSDLPHGEERLQTLVDQAPGNIGLRLAQADLYL
FT                   ARNWPRRAENQLKETESIAPRDTGLEVAQARTAMDLQEWRQMDALTDDVVARFLDNRQV
FT                   QRLAREREVHDMSELRVEAYGGKANGGSGGDAGAVSGSRDFGIQTTLYSPPIDEDWRVF
FT                   AGAGYATGDFAEGTGHHRFQRVGLERRTRDMTLEAEVSNHSYGFGDKQGARLAIARDIN
FT                   DHWQYGGSLEYLSAETPLRALNSDIKANGGSGFIRWRANESREWRLAVSPSHFSDGNNR
FT                   VEALLTGKEGVYSAPNLQVDAGLEVGTSHNSKSDDVPYFNPKSDFSVMPLLNVNHVLYH
FT                   RYETAWSQQFQAGAGTYSQRDHGTGGMALLGYGQRYAWNDVFEVGGLFSVINRPYDGDR
FT                   ETDLRLLVDLTFRF"
FT   sig_peptide     212850..212951
FT                   /gene="hmsH"
FT                   /locus_tag="Pfl01_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.821 at
FT                   residue 34"
FT   gene            215343..217340
FT                   /gene="hmsF"
FT                   /locus_tag="Pfl01_0178"
FT   CDS_pept        215343..217340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmsF"
FT                   /locus_tag="Pfl01_0178"
FT                   /product="hemin storage system, HmsF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71922"
FT                   /db_xref="GOA:Q3KJY4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023854"
FT                   /db_xref="InterPro:IPR032772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY4"
FT                   /protein_id="ABA71922.1"
FT                   /translation="MPLISRFILLLGVLLVSACAQQAPAFVPPSERPLAANEKPWPKNH
FT                   VLGIAYHDVEDRDPDQAVVAVRTERLLEQLAWLRENNYQPVTVDQIMAARKGGPELPPK
FT                   AILLSFDDGYSSFYTRVLPVLRAYNWHALLAPVGTWIDTPLNQPVDFAGTPRPRSDFLT
FT                   WAQVREISQSGLVEIAAHTDASHKGILANPQGNLQPAAATRRYDPVSKRYESEADFQAR
FT                   IRADVQAISEKIRKNTGKKPRIWVWPYGTADGTSLTVVSEEGYEMALTLDDGLDALDNL
FT                   MSGPRFLVASDPDGEHFANSVVGVQADFVMRVVHVDLDNVYDPDPAQQEINLGKLIQRM
FT                   ADMGANTVFLQAFADPKGDGLVHSLYFPNRHLPMRADLFDRVAWQLRTRAHVKVFAWMP
FT                   VLSFELDSKLPRVTRWDPKTGTTAVDPDQYKRLSPFDPEVRRIIGEIYEDVARLTSVDG
FT                   ILYHDDAVLSDFEDAGPQALKAYTAQGLPGSIAALRDDPAAMQRWTRFKSRYLIDFTNE
FT                   LTAKVRAIRGPQVLTARNIFAEPVLNPHSEAWFAQNLDDFLGTYDWTAPMAMPLMEKQT
FT                   YAQSGPWLEELVAKIKQRPGALDRTVFELQARDWTKKDQADIDGAQLADWMSRLKRQGA
FT                   TSFGYYPDNFLENLPDLKTVRPALSNKWNP"
FT   sig_peptide     215343..215411
FT                   /gene="hmsF"
FT                   /locus_tag="Pfl01_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.585 at
FT                   residue 23"
FT   gene            217342..218697
FT                   /locus_tag="Pfl01_0179"
FT   CDS_pept        217342..218697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0179"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71923"
FT                   /db_xref="GOA:Q3KJY3"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY3"
FT                   /protein_id="ABA71923.1"
FT                   /translation="MLDRLLALLVLAIVLGVPLGLIFLVTGQFLMDFVFFYPLFMSGLW
FT                   ISGGLYFWLHWERHWPWKDDTLPPPLEGEPLISILIPCYNEGDNAAETIHAALAQHYPN
FT                   IEVIAINDGSRDNTAEVLDALAKEDPRLRVLHLAENQGKAVALRMGAIAARSEYLVCID
FT                   GDALLAPNTAAYLVAPMLDNARLGAVTGNPRIRTRSTLVGRVQVGEFSSIIGLIKRTQR
FT                   VFGRIFTVSGVIVAFRRTALNRVGYWSPDMITEDIDISWKLQLDHWSIFYEPRALCWIL
FT                   MPETLRGLWKQRLRWAQGGAEVLFKNIRGIWQYRHRYLWPLLFEYCLSTGWAFTFLLSV
FT                   IFWAVGKFVVMPEAIAVDHLMPPAFTGLLLAFVCLVQFAVSIVIDRRYEPGLGRTMFWV
FT                   VWYPIAFWLVSLLTTLVSFPKVLFGQHQKRARWVSPDRGIKPLGDDEEEVIK"
FT   sig_peptide     217342..217425
FT                   /locus_tag="Pfl01_0179"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.200 at
FT                   residue 28"
FT   gene            218694..219227
FT                   /gene="hmsS"
FT                   /locus_tag="Pfl01_0180"
FT   CDS_pept        218694..219227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmsS"
FT                   /locus_tag="Pfl01_0180"
FT                   /product="putative hemin storage system"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71924"
FT                   /db_xref="GOA:Q3KJY2"
FT                   /db_xref="InterPro:IPR023829"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY2"
FT                   /protein_id="ABA71924.1"
FT                   /translation="MKIIRTRQRPFLVLLDAFFTVLAWIGLLYLLVRGLWPLIDTHEGG
FT                   PRLDNSAFEALGTLQIYLWVAVVNAVILIGWARYQQRKSRSFAQRRLPSPVVDDEGLSR
FT                   SFKLCDERFQKLRGPGVMTIHNDQDGDVSHVVPHLWPVQPQELPSPLAPLEHPRVIFLH
FT                   AEDDDNREPLNRIT"
FT   gene            complement(219220..220749)
FT                   /locus_tag="Pfl01_0181"
FT   CDS_pept        complement(219220..220749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0181"
FT                   /product="putative ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71925"
FT                   /db_xref="GOA:Q3KJY1"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY1"
FT                   /protein_id="ABA71925.1"
FT                   /translation="MTLHRVARFADVPEDRGLEVKIGDCKIVLLRVAGQLRAFQGQCPH
FT                   AGAPLAEGALCHGRLICPWHKAAFRAEDGALCEPPALDSLKRYPLELRGDEVWVDDQPL
FT                   PDPHTPPQDDPRTFVIVGAGAGGTACAAALREKGFGGRIVLIDREPDAGYDRTVLSKFV
FT                   LSGEMPAAETPPLRDEDFYREQHINRVSGEVSGLDADTKTLHLSDGRTLNYSAAVLATG
FT                   ATPNALELPGVDLPQVFVLRSKAQAQYIMDAAQSGQRAVIIGDSFIALECASALRQHGL
FT                   EVTVLARHAIPFAVQFGEAVGKAIRALHEENGVKFITDHEAREITGDGKVEAVLLDNGL
FT                   RLSADLVLAGIGVHPATEAFGDLPREDDQSLLVDASLRVTESLWAIGDIATFPLNGKPQ
FT                   RIEHWRLAQQHARIAAANLLGGEEHYLDVPYFWTWHFGRNYDYLGHAEGWDAVEFIGKP
FT                   EQPPFIGLFGSKGVVVAAVACEEERAMALLAERMKQPLPMDEAWRLIRAVR"
FT   gene            220889..221449
FT                   /locus_tag="Pfl01_0182"
FT   CDS_pept        220889..221449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0182"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71926"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY0"
FT                   /protein_id="ABA71926.1"
FT                   /translation="MTRLTSLNPWLAAVAVALCVQFPAQAQERFTLSIPGVSDNRLFTS
FT                   AAASDAAGCGGKNQSPALSWNAGPAGTLSYAIVMHDPDGQKGAGVDHWIHYGIKATTRQ
FT                   IPAGVGAKSALEGVGGTNSKGTTSYVGPCPPVGDSAHHYIIQIYALDLAPDALAAGLTR
FT                   AQLMEKIKGHVLRNSSAVRRYHR"
FT   sig_peptide     220889..220969
FT                   /locus_tag="Pfl01_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            221537..223228
FT                   /locus_tag="Pfl01_0183"
FT   CDS_pept        221537..223228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0183"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71927"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX9"
FT                   /protein_id="ABA71927.1"
FT                   /translation="MSLPSTLLRPLAASVLLVVAGCGVSSSPETTVAPPPAQTELKSSV
FT                   QPEAVMADSAMAKRSALTAPIASFAPMPAGESYPQGYRDEQREQYAKLADNPIHSVTET
FT                   PVSTFSADVDTGAYANVRRLLNQGRLPPEGAVRLEEMVNYFPYDYALPSDGSPFGVTTE
FT                   LAASPWNPHTRLLRIGIKASDRAVAELAPANLVFLVDVSGSMDRREGLPLVKSTLKLLV
FT                   DQLREQDRVSLVVYAGESSVVLEPTSGREKAKIRTAIERLTAGGSTAGASGIELAYQMA
FT                   QQAFIPKGINRILLATDGDFNVGTSDFDSLKQMAVDKRKTGISLTTLGFGVDNYNEHLM
FT                   EQLADAGDGNYAYIDNLREARKVLVDQLGSTLAVVAKNVKLQVEFNPAQVSEYRLLGYE
FT                   NRALKREDFSNDKVDAGEIGAGHTVTALYEIVPTGEKGWLEPLRYGKTDAVVSEKRGEL
FT                   AMLRVRYQKPEGGKSLLIERPIASQVAPASEDLRFAAAVAAFSQQLKDGRYTGDFSLKD
FT                   TEALARGARGDDRFGLRNEFVQLVELAQSLRTSTASNGMSTERRIE"
FT   sig_peptide     221537..221617
FT                   /locus_tag="Pfl01_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.526 at
FT                   residue 27"
FT   gene            223228..223839
FT                   /locus_tag="Pfl01_0184"
FT   CDS_pept        223228..223839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0184"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71928"
FT                   /db_xref="GOA:Q3KJX8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX8"
FT                   /protein_id="ABA71928.1"
FT                   /translation="MSRLKGFITQLFAFADSLEASSDESLLARYREGDGKAFEILYARH
FT                   RQSLYRFLLGLSGKPELADEVFQETWLSLIRSSSQPQGRATFRTWLFQIARNRLIDHWR
FT                   KHGARQPLHDSYDEQFHAVSDDASDPEQLLNLSRDSERLESALQSLPADQREVFLLRAH
FT                   GDLDLAQIASLTETPLETVKSRLRYAQQKLRRLLAEEVLT"
FT   gene            223836..224438
FT                   /locus_tag="Pfl01_0185"
FT   CDS_pept        223836..224438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX7"
FT                   /protein_id="ABA71929.1"
FT                   /translation="MTDARPTPEEQVLKHVREQHNAEPPAHLDALILNAARHETPAPRQ
FT                   SLWQRWLKACQQPRYQVAFASLVGIALMLSLVQRAPEPVAQFDFAPAAKPAAPVARSLS
FT                   APAGALSAPAPAMAPAPMAEMAAPMQSESIRADTLDEAKVSKRAAAPVNGLDEQLREVL
FT                   RLRESGQSQAADSLFSNLHKRYPNVNLDLRLEKIRKN"
FT   gene            224459..224728
FT                   /locus_tag="Pfl01_0186"
FT   CDS_pept        224459..224728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX6"
FT                   /protein_id="ABA71930.1"
FT                   /translation="MALTRKNAHYRVIADALEDAVAQKIDRIAQMLNCPVKGEELRRAV
FT                   TESRKEFLLAKQAEEDLEEDVLDDDLIEDEEDDDEYDEFDWTTE"
FT   gene            complement(224796..224872)
FT                   /locus_tag="Pfl01_R0007"
FT                   /note="tRNA-Arg6"
FT   tRNA            complement(224796..224872)
FT                   /locus_tag="Pfl01_R0007"
FT                   /product="tRNA-Arg"
FT   gene            225316..226758
FT                   /locus_tag="Pfl01_0187"
FT   CDS_pept        225316..226758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0187"
FT                   /product="succinate-semialdehyde dehydrogenase, NADP+"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71931"
FT                   /db_xref="GOA:Q3KJX5"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX5"
FT                   /protein_id="ABA71931.1"
FT                   /translation="MQLKDTQLFRQQAFIDGAWVDADNGQTIKVNNPATGEILGTVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERAGKLRRWFELMIENQDDLARLMTLEQGKPLAE
FT                   AKGEIVYAASFIEWFAEEAKRIYGDVIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSAFALAELAQRAGIPKGVFSVVSGSAGDIGSELTS
FT                   NPIVRKLSFTGSTEIGRQLMSECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISK
FT                   YRNNGQTCVCANRLYIQDSVYDAFAEKLKVAVAKLKIGNGLEEGTTTGPLIDEKAVAKV
FT                   QEHIADAVSKGATVLAGGKPMEGNFFEPTILTNVPKDAAVAKEETFGPLAPLFRFKDEA
FT                   DVIAMSNDTEFGLASYFYARDLGRVFRVAEALEYGMVGVNTGLISNEVAPFGGIKASGL
FT                   GREGSKYGIEDYLEIKYLCLGI"
FT   gene            226945..228222
FT                   /locus_tag="Pfl01_0188"
FT   CDS_pept        226945..228222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0188"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71932"
FT                   /db_xref="GOA:Q3KJX4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX4"
FT                   /protein_id="ABA71932.1"
FT                   /translation="MSKTNAELMARRTAAVPRGVGQIHPIFAESAKNATVTDVEGREFI
FT                   DFAGGIAVLNTGHVHPKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINARVPGDFAK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALYPNELHGVSIDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKEF
FT                   MKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPIACAAALAVMEVFEEEKLLDRCKAVGERLVTGLKAIQ
FT                   AKHPVIGEVRALGAMIAVELFENGDSHKPNPTAVAAVVAKARDKGLILLSCGTYGNVLR
FT                   VLVPLTSPDEQLDKGLAIIEECFSEL"
FT   gene            228363..229574
FT                   /locus_tag="Pfl01_0189"
FT   CDS_pept        228363..229574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0189"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71933"
FT                   /db_xref="GOA:Q3KJX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX3"
FT                   /protein_id="ABA71933.1"
FT                   /translation="MTAVDLPAVPRVLIAEADPWSRDLLKQVLLNVRCDARLDLCADGQ
FT                   EAMTLLSEVPYDLAIVDWELPGVDGLSVLRSVRQRKRNPPLPFILMSSRNDSASVREAL
FT                   PLAPTAYLAKPLNMESLTERLQGLLLNAGEEVFCEVPALAPGMTLSVFLERRREQADGA
FT                   PLMTDVQVAVKRSLNPNGLDLKLLEEEIRTDPQITAVLIAAANSAAQHHGAPVQTLAQA
FT                   LHRLGTGQSMNLILGLALKRSARLSDPCLADYAERYWGLSLHTAEYARTLARLLDLDQE
FT                   RCYCAGMLHRLGDLALLRCLQEWKQAGGELDELEEVGDALAEFGAAYGSALRTRWRLPL
FT                   ELRELIASVYQLGGGVYSREALVMNMAAQMARLTEHEGVEELAKSRTARLLKIGLPELM
FT                   RMRK"
FT   gene            complement(229602..230591)
FT                   /locus_tag="Pfl01_0190"
FT   CDS_pept        complement(229602..230591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0190"
FT                   /product="conserved GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71934"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX2"
FT                   /protein_id="ABA71934.1"
FT                   /translation="MVNNNQKDSSPPQWPEAAQTLMALMHAQGEVARLSEREQLFSSLL
FT                   VSVNAVLWAFNWETRQVLYVSPAYERIFGRSAGLLLADYNQWRDSIYPDDLEYAERSLA
FT                   EVLHKGAVEDREYRIIAADGQVRWISDKCFINRQDEPGQPVIIVGIAEDITDKKQMETE
FT                   LQRLATTDVLTQSSNRRHFFECAHREFEQARLQGAQMAFLLLDIDDFKVINDTYGHPEG
FT                   DNVLQRIAECGRASLRRGDLFGRIGGEEFAAVFPGCAPDMAMQVAERLQREIQRLSFNH
FT                   ADQTFGITVSQGLTSLTPEDESLDTLFARADAAMYEAKRQGKNRIISA"
FT   gene            complement(230737..231921)
FT                   /locus_tag="Pfl01_0191"
FT   CDS_pept        complement(230737..231921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0191"
FT                   /product="putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71935"
FT                   /db_xref="GOA:Q3KJX1"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX1"
FT                   /protein_id="ABA71935.1"
FT                   /translation="MWYEGFLGLSAWSLVAVTLVMTHVTIVAVTVYLHRYSAHRSLELN
FT                   AGLKHFFRFWLWLTTAQNTREWTAIHRKHHAKCETEDDPHSPVVKGLSTVLCKGAELYR
FT                   EEAQNPETLRIYGKNCPEDWIERNLYSRYRLLGVAIMAVVDLLLFGTIGITIWAIQMMW
FT                   IPVWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVKK
FT                   WEFDLGWAWIQVFSFLRLAKVQRVAPIAHRVEGKGSLDMDTAMAILNNRFQIMAQYRKL
FT                   VIGPLVKQELAKVDHSVRHQFHRAKRLLSRETSLLEDRHHARIQSMLEHSQALKVIYEK
FT                   RLALQQIWVKTSANGHDMLAAIKEWVHEAEASGIQSLREFADQLKTYSLRPAAV"
FT   gene            232056..233987
FT                   /locus_tag="Pfl01_0192"
FT   CDS_pept        232056..233987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0192"
FT                   /product="putative sensory box GGDEF/EAL domains protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71936"
FT                   /db_xref="GOA:Q3KJX0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX0"
FT                   /protein_id="ABA71936.1"
FT                   /translation="MDGRMSATYRDALRAALLYLVLAVVWLQGTGYLLNSFFDSSDELL
FT                   RWQLINGYLFVALSAGLIFLARARLFECLGIGARLRERQADRERLRQAAAVFDCTREGV
FT                   LVTDRQGLIVHVNRAFMEITGYQRDEVIGQQPSLFKSGHHPPGFYQAMFASLQARDEWS
FT                   GEIWNRRKSGEIYPQWQTIRVIRDDDNRLSHYVAVFSDISAIKDSEHELKHLAHHDPLT
FT                   DLPNRLLFSDRAEQALASAQTHKRGCALLMIDLDHFKLINDSLGHTIGDRLLKAVAARL
FT                   QALFGPGITLARLGGDEFAVLLESCPQPAQAAALAQRILDALKEPFCLDGHELFINASL
FT                   GISLFPSDALSAEQLLRNADAALFKAKSSGRNGYALYTEELTAHAQQRVEIAFELRRAL
FT                   EQQELRVYYQPVHDLQTSRLIGVEALVRWEHPQRGLVSPAEFIPIAERTGLISEIDAWV
FT                   MQQACRQMCQWQQAGVVLSFVAVNVSSRLFARRELYQQVAQVLHETGLDPAYLELEVTE
FT                   SAVMDDPEVALEQMHRLRELGIRLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVAGLPW
FT                   DEDDAAIVRVIIALARSMGMQVHAEGIEQVEQAAFLLGQACDLGQGYWFGRPVPEAQID
FT                   WNRAPLIG"
FT   gene            234178..234360
FT                   /locus_tag="Pfl01_0193"
FT   CDS_pept        234178..234360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71937"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW9"
FT                   /protein_id="ABA71937.1"
FT                   /translation="MSASLRSVDGQDESTILREIQSALRDLRFGAVEITVHNAQVVQIE
FT                   RKEKFRLQQPGNKPA"
FT   gene            234493..235506
FT                   /locus_tag="Pfl01_0194"
FT   CDS_pept        234493..235506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0194"
FT                   /product="sulfate ABC transport system, sulfate-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71938"
FT                   /db_xref="GOA:Q3KJW8"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW8"
FT                   /protein_id="ABA71938.1"
FT                   /translation="MSSIRRYALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNA
FT                   EFVKYWQSEHAGDTVKIQQSHGGSGKQGRAVIDGLRADVVTLALAGDIDEIAKLGKTLP
FT                   ADWQKRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLIKNDVSVITPNPKTSGGARWNFL
FT                   AAWAYGLKANGGNEAKAKEYVQTLFKHVPVLDTGARGSTITFVNNGQGDVLLAWENEAF
FT                   LALKEDGGKDKFDIVVPSLSILAEPPVAVVDKNAEKKGNEQIAEAYLKHLYSPAGQEIA
FT                   AKNFYRPRDKDVAAKYAQQFPKLELVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
FT   sig_peptide     234493..234564
FT                   /locus_tag="Pfl01_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            235577..236395
FT                   /locus_tag="Pfl01_0195"
FT   CDS_pept        235577..236395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0195"
FT                   /product="sulfate ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71939"
FT                   /db_xref="GOA:Q3KJW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW7"
FT                   /protein_id="ABA71939.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWTIISAPRVLAALKLSFGTALCAAIINGIIGTLLAWVLVRYTFPGRKVIDAMIDLPFA
FT                   LPTAVAGIALTALYTPTGLVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGAKPLQVFRHILLPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATSIGVLMLVVSFVLLLLINLLQRRIETP"
FT   sig_peptide     235577..235693
FT                   /locus_tag="Pfl01_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 39"
FT   gene            236409..237281
FT                   /locus_tag="Pfl01_0196"
FT   CDS_pept        236409..237281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0196"
FT                   /product="sulfate ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71940"
FT                   /db_xref="GOA:Q3KJW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW6"
FT                   /protein_id="ABA71940.1"
FT                   /translation="MSQSSIAAASSANAARRGSATSRRILIGLGWLIFFLFLLLPLFIV
FT                   VSQGLKNGLGAFFTAIFEPDALSALKLTVIAVLVSVPLNLVFGVSAAWCVSKYSFRGKS
FT                   MLVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSENRIN
FT                   RLRASAAEE"
FT   gene            237285..238274
FT                   /locus_tag="Pfl01_0197"
FT   CDS_pept        237285..238274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0197"
FT                   /product="sulfate/thiosulfate ABc transport system,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71941"
FT                   /db_xref="GOA:Q3KJW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW5"
FT                   /protein_id="ABA71941.1"
FT                   /translation="MSIEVRNVSKNFNAFKALDNISLDIHSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDNGNIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   NQRPNESQIATKVHELLNMVQLDWLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   DVYENPASDFVYHFLGDSNRLHLGDDNHVLFRPHEVSLSRHELEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQTDLIEAEVVKDHDSLTGLAKGETLFFKPKVWQKVANV"
FT   gene            complement(238398..238922)
FT                   /locus_tag="Pfl01_0198"
FT   CDS_pept        complement(238398..238922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0198"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71942"
FT                   /db_xref="GOA:Q3KJW4"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW4"
FT                   /protein_id="ABA71942.1"
FT                   /translation="MKSLVDHLSQYAAYHRDPRNIASHFIGIPLIVVAVAVLLSRPEWS
FT                   VGGLWISPAVIAALASAWFYLRLELKLGALMTVLMGLSVWAGHVLAQQSTMVWLSSGLA
FT                   MFVIGWAIQFVGHHYEGRKPAFVDDLSGLIVGPLFVVAELAFMLGMRHELKEQIEARAG
FT                   VVRVNPNRAAV"
FT   gene            239008..239691
FT                   /locus_tag="Pfl01_0199"
FT   CDS_pept        239008..239691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0199"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71943"
FT                   /db_xref="GOA:Q3KJW3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW3"
FT                   /protein_id="ABA71943.1"
FT                   /translation="MDKVWRERLLTGQWFSHLPSSFQDSLLAAARERRLAAGQRLFQRG
FT                   DAPCGLYAVLDGAVRIGAVSEQGKEALLSLVEAPHWFGEICLFDGQPRTHDAYAVGPCT
FT                   LLNIPQATLLKLLDEQPVYWRHLALLMSHKLRLTFINLEQLSLLPAPARLAHRLLMIAE
FT                   GYGELDPPRRVLQLPQEQLASMLSLSRQTTNQILKELQGQGVIGLSYGEIEILDAARLR
FT                   ALATL"
FT   gene            complement(239753..240163)
FT                   /locus_tag="Pfl01_0200"
FT   CDS_pept        complement(239753..240163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71944"
FT                   /db_xref="GOA:Q3KJW2"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW2"
FT                   /protein_id="ABA71944.1"
FT                   /translation="MTPLRITFAALGLSAFSSLALAAGNPLSVHVLNLENGLPSPGINV
FT                   TLERHVGQNWQPLAQGTTNEQGRIAELFPANKPFEAGEYRVVFKTGEYFEKTKHETFFP
FT                   EIPVIFKVQQTDQHYHIPLLLSPYGFSTYRGS"
FT   sig_peptide     complement(240095..240163)
FT                   /locus_tag="Pfl01_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(240180..240662)
FT                   /locus_tag="Pfl01_0201"
FT   CDS_pept        complement(240180..240662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0201"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71945"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW1"
FT                   /protein_id="ABA71945.1"
FT                   /translation="MSVKYLLASLAIGLSGAAHATPELPRHADLDLKTARLLADAALEN
FT                   CTATVSVLDRGGNLLVTLRGDGIGPHNTAASQRKAYTALSTKTPTRLFAERARNNPETA
FT                   NLNTLDELLLLGGGIPLFAGKELVGAMGVAGSGGGEQDESCATKAAEAGGLSINRI"
FT   sig_peptide     complement(240600..240662)
FT                   /locus_tag="Pfl01_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            240799..241479
FT                   /locus_tag="Pfl01_0202"
FT   CDS_pept        240799..241479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0202"
FT                   /product="heavy metal sensing two-component sytem,response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71946"
FT                   /db_xref="GOA:Q3KJW0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW0"
FT                   /protein_id="ABA71946.1"
FT                   /translation="MRLLVVEDEAKTANFIAKGLGESGFAVDVALNGLDGRYFIEQQEY
FT                   DLIILDVMLPGLNGWQLLQLIRQRGATPVLFLTAKDAIEDRVRGLELGADDYLLKPFAF
FT                   AELLARVRTLLRRGPLREAESYNIADLEIDVLRRRVSRGGQRIALTNKEFALLHLLASR
FT                   QGEVLSRTLIASQVWNLNFDSDTNMVEVAVRRLRSKVDDPYMPKLIHTVRGVGYQLEAP
FT                   DDAR"
FT   gene            241469..242857
FT                   /locus_tag="Pfl01_0203"
FT   CDS_pept        241469..242857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0203"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71947"
FT                   /db_xref="GOA:Q3KJV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV9"
FT                   /protein_id="ABA71947.1"
FT                   /translation="MRARSIAWRLALAFAAVCALVLSAIGVFLYRSLAAEIAWRDDMAL
FT                   LGRLEQVRALLADSDSLDALQARPRLYQNMLGNLDSLLLVQRADGSNVITINPRQRALP
FT                   SVQAIPRDQPPQRRDVLTWQAADGVELALLSGQAQGPNGEALTVIAGKVLSEREQMLGS
FT                   YRLRLYLAVGLGAVLAFTLGLVLLRRGLRPLRKLSEALRGIDLRSLDQRVPTAGTPAEL
FT                   LEPVHALNGMLGRLDDGFQRLSQFSADLAHEIRTPLHTLLASNGQALNYPRSSAEYQEV
FT                   LASNMEEFERLKRMAENLMFLARAEQAERALDLRTLELHEIGDELCDYFEALADDREIR
FT                   LENTFSGELLADQQLLQRALGNLLANAVRHADAGSVISLRRRDEPGLCWLQVHNLGPVI
FT                   ADEHLGKLFDRFYRVDPSRAEPGDSGGLGLAIVQSIMRLHGGQVRVSSDATGTVFELGF
FT                   VTSR"
FT   sig_peptide     241469..241573
FT                   /locus_tag="Pfl01_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.491 at
FT                   residue 35"
FT   gene            242972..243220
FT                   /locus_tag="Pfl01_0204"
FT   CDS_pept        242972..243220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0204"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71948"
FT                   /db_xref="GOA:Q3KJV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV8"
FT                   /protein_id="ABA71948.1"
FT                   /translation="MEQLGELIRTLRKAQKLSQQALAQRYGMSRATISGIENNTISEIG
FT                   LRKVEAILNGFGYELTAVPVRAQRPTLDALQKANFHD"
FT   gene            243291..244436
FT                   /locus_tag="Pfl01_0205"
FT   CDS_pept        243291..244436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71949"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV7"
FT                   /protein_id="ABA71949.1"
FT                   /translation="MDSVFSYREDAIDENAVSLTMPTRLESYGWERGIHPVFEMNLPEG
FT                   ALRDELVRRFSKAVRGFDDFALLAIVGPHQLGRLAITSESATERQPETSLAELLVHDGA
FT                   QGLFDDLLQKYGQYSGVSGVQPKVLVRDSAAAVDRLTHRGSTHLVKAFRPEEFPELATN
FT                   EYFCMRAAALSGLEVPKFELSEQGKFLVVERFDLIEHGYLGFEDFCVLNGWSSRAKYDG
FT                   SYEGAARQIKAFVSPALLSQALEAFFKIVALSAGLKNGDAHLKNFGVLYDHCGAQASIR
FT                   LAPAYDIITTSVYIRNDSLALLLGGSKAWPKQKALIRFGRTACNLTEGRCNELLQQVVH
FT                   GMQTAMAEMLEHCRTHQSFAEVGTAMIEQWESGIERSLTKG"
FT   gene            complement(244452..245456)
FT                   /locus_tag="Pfl01_0206"
FT   CDS_pept        complement(244452..245456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0206"
FT                   /product="putative AraC-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71950"
FT                   /db_xref="GOA:Q3KJV6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV6"
FT                   /protein_id="ABA71950.1"
FT                   /translation="MKEPTSLASWTRALRKQLDALGLDSTALCQQAGLDPQLMDDPNAR
FT                   YPLSATTRLWEIAVQVSGDPAIGLRVSRFVSPTTFHALGYALVASGSLREVFERIVRYH
FT                   QVVSDALELELTRTEDRYRFHLKIPVGNPAPAFEAIDAFAAIYVRTCRNRLGRDYAPLA
FT                   VYLRRPEPADAHQWHKVFRSPVHFSAEEDRIEFALADFDSHLDDANPELAEHNEAVLKR
FT                   TLAQLKPLTWERKVRDAIEEQLPEGEPSAERIAQALHLSLRSLQRHLADEGCRFDTLLN
FT                   ESRENLALLHLRDPQCSLSEVSYLLGFADTSSFSRAFKRWTGMTPGQFRDQLR"
FT   gene            245557..246630
FT                   /locus_tag="Pfl01_0207"
FT   CDS_pept        245557..246630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0207"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71951"
FT                   /db_xref="GOA:Q3KJV5"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV5"
FT                   /protein_id="ABA71951.1"
FT                   /translation="MDRTSASPQRHNAAQRSAHIREVVLAKGVELRERYPILNHQDALG
FT                   AGILVFALAGMIGSAALYVTGHMAWWACLLLNAFFASLTHELEHDLIHSMYFRKQRVPH
FT                   NLMMGLVWLARPSTINPWIRRHLHLNHHKVSGTETDMEERAITNGEPWGFARLLMVGDN
FT                   VMSAFIRMLRAKTWAHKFSIIKRTLKVYAPLALVHWGAWYVFLGFHAANGIAYLMGSPI
FT                   EWSATTLSVMQVIDIAAVVIIGPNVLRTFCLHFISSNMHYYGDVEPGNVLQQCQVLNPW
FT                   WLWPLQAFCFNFGSSHGIHHFVVKEPFYIRQLTVPVAHKVMREMGVRFNDFGTFGRANR
FT                   FVRKENEGLAGKAIEVN"
FT   gene            complement(246858..248468)
FT                   /locus_tag="Pfl01_0208"
FT   CDS_pept        complement(246858..248468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0208"
FT                   /product="arylsulfatase (aryl-sulfate sulphohydrolase)"
FT                   /EC_number="3.1.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71952"
FT                   /db_xref="GOA:Q3KJV4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV4"
FT                   /protein_id="ABA71952.1"
FT                   /translation="MPQRPNFLVILADDLGFSDIGAFGGEIATPNLDALANNGLRLTDF
FT                   HTAPTCSPTRSMLLTGTDHHIAGIGTMAETLTPELIGKPGYEGYLNDRVVALPELLREA
FT                   GYQTLMSGKWHLGLTAELAPHARGFERSFSLLPGAANHYGFEPTYDEHTPGLLKSTPAL
FT                   YIEDDTFIDELPKDFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPADIVE
FT                   KYRGRYDAGPEVLRLERLEKLKSLGLIEPDVEPHPLIKLTAQWGALSDEQKRISARAME
FT                   VYAAMVERMDWNIGRVVDYLRQQGQLDNTFILFMSDNGAEGALLEAFPKFGPDLVTYLS
FT                   QHYDNSLDNIGRANSYVWYGPNWAQVATAPSRLFKAFTTEGGIRVPALLHYPQLPLKGQ
FT                   ISHGFGTVMDITPTILDLAGVRHPGKQWHGKPVAPLRGKSWLGFLSGETAQVHDEHTVT
FT                   GWELFGRRAIRQGQWKAVWIPGPVGPATWQLYDLGSDPGEIHDLASSQPQKLEALIEHW
FT                   QRYVEETGVILSESPFQPD"
FT   gene            complement(248483..249298)
FT                   /locus_tag="Pfl01_0209"
FT   CDS_pept        complement(248483..249298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0209"
FT                   /product="putative ABC sulfur transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71953"
FT                   /db_xref="GOA:Q3KJV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV3"
FT                   /protein_id="ABA71953.1"
FT                   /translation="MNAPIVSFNHVGKSFDVDGFELEAIREFNLDIAEGEFVAIVGSSG
FT                   CGKSTLLRLLVGLDTQFRGQITVDGKAVSGIGGERGIVFQEHRLFPWLTVADNIGLGLV
FT                   NEPLGAAEKQQRINDFIELVGLRDFTRAYPHQLSGGMAQRVAIARGLVASPRILLLDEP
FT                   FGALDALTRQQMQDELLAIRERAKITTILVTHDVEEAIFLADRVVVMEPRPGRIKQVVD
FT                   IALPHPRQRSSFDFHQLREELLHELTSDDHYQPSVPVQIRDLPLSFIAC"
FT   gene            complement(249295..250893)
FT                   /locus_tag="Pfl01_0210"
FT   CDS_pept        complement(249295..250893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0210"
FT                   /product="putative ABC sulfur transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71954"
FT                   /db_xref="GOA:Q3KJV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV2"
FT                   /protein_id="ABA71954.1"
FT                   /translation="MARESLLSLPLAAPPLKSRRTWPSLSHRVLPWILPLGLFALWWLA
FT                   ARNQWMSEQILPAPSLVWNSAIELSQGELWSHLWISLQRLFWGLLAGVSAGAMLGAALG
FT                   FSRRLERLIFPTFAGLAQVPTLAWIPLFMVFFGIGETLKLVVLVKAIVVPVTLHTLVGV
FT                   RDAQPKLREAAAVLRLPPRLLIRRLVLPAALPAFMAGVRLALAAGWTSLLAVELLASSE
FT                   GIGYLMVWARQLFMLDIVFVCIVVIGLIGVAMDRGIGLLDKKLVHWPHPATAEIRRGPR
FT                   YEGWQRVQPWLLPLALFALWQLAVDQQWIDANILVSPWVVLEATKNGLLDGTLISGMAL
FT                   SLGRTLGGLLIGGGLGLVLGLLLGLSRTSERVLGPTLAALRQIAIFAWVPLLTAWFGLG
FT                   ELAKWVFVALAAFFPLFVATQRSVANLSPQLNEAAQVLRLSLAQRLLRLVLPGAAPGIF
FT                   AGLRLSLIYAWLGTIGAEYFMPSNGGIGSQMIGAQQLLRMDLIMAGMLLVGLTGALLNL
FT                   IGQRLEIRATRWRHA"
FT   gene            251198..252211
FT                   /locus_tag="Pfl01_0211"
FT   CDS_pept        251198..252211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0211"
FT                   /product="putative ABC sulfu transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71955"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV1"
FT                   /protein_id="ABA71955.1"
FT                   /translation="MNLPFKRVISLFAAPALAGLLAFSAQADELKEIRIAVPDLSAGTQ
FT                   HSGGGIVDVLRDQQIFEKAFADQGIKIQWSFFKGAGPVINEAFANGQVDLAYLGDLAAI
FT                   IGKSNGLDTRLLSASARGVKQYLGVVPGSGIKTLQDLKGKRVAIFRGTATQLSFDAALA
FT                   SVGLSEKDVKVINLDFNAAVAALAAKQIDASWGSSGLTALQAKGLAELPLNTKDLGGAG
FT                   SVQSVLVGTGKFVDGHPEAVAKLLKAQQQAVEWLTQDSNKDAYVQLVSGLASYPPVILT
FT                   QDLKDQNLSEVFPSTLDPLFLENLQGKVDLAAQQKLIRKPFKVNEWVAPELAAAKL"
FT   sig_peptide     251198..251281
FT                   /locus_tag="Pfl01_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(252251..253186)
FT                   /locus_tag="Pfl01_0212"
FT   CDS_pept        complement(252251..253186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0212"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71956"
FT                   /db_xref="GOA:Q3KJV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV0"
FT                   /protein_id="ABA71956.1"
FT                   /translation="MPEKHMDLRQLRYFIALNEHRSFVRAADAMGITQPAFSRSIQGLE
FT                   QEFGCVLVDRGNKDLRPTPEGQVVLQHALTLVQGAALLSAEVTQMTKLDAGELHFGCGP
FT                   APAVKLVPDAVAQFINAHPKVRTCFQVDNWEKLSRALSREEIEFFIADIRHFESDPNFQ
FT                   TQPLTPKRGVFFCRPGHPLLAKESLSTNDMFDYPLATTLIPPGIRKLLANLSGRIDFSP
FT                   TIETEHFPALVKVVLQSNAIGVGTEEAFVEDIAQGSLALLHWRNLPQNLESMNARCGIV
FT                   SRTGFRLSPAARAMIETLVAVDKQAISVAV"
FT   gene            253352..254272
FT                   /locus_tag="Pfl01_0213"
FT   CDS_pept        253352..254272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0213"
FT                   /product="putative taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71957"
FT                   /db_xref="GOA:Q3KJU9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU9"
FT                   /protein_id="ABA71957.1"
FT                   /translation="MSNAALAVKPAVHALDIHPVAGRIGAEIRGVHLSGELDAATVEAI
FT                   QQALIQYKVVFFREQTQLDDQRQEAFAHLLGEPVAHPTVPSREGTRYLLELDGAEGQRA
FT                   NSWHTDVTFVDAYPKASILRSVVAPAFGGDTLWANTATAYNELPTELRELADKLVAVHS
FT                   NEYDYAAVKPDVSAEKLERYRKIFTSTVYETEHPVVRVHPISGEKSLLLGHFVKRIKGY
FT                   SQADSAHLFGLLQSHVIRQENVVRWRWKAGDVAIWDNRSTQHYAIDDYGTQDRVVRRVT
FT                   LKGEVPVGANGQRSQTIKGAEIVGV"
FT   gene            complement(254413..256023)
FT                   /locus_tag="Pfl01_0214"
FT   CDS_pept        complement(254413..256023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0214"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71958"
FT                   /db_xref="GOA:Q3KJU8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU8"
FT                   /protein_id="ABA71958.1"
FT                   /translation="MSNPQNPVRNVLYIMCDQLRRDYLSCYGHPHLHTPNIDRLAAAGV
FT                   RFSRAYTQGTICGPSRMSAYTGRYVSSHQVAWNAVPLPLEELTIGDYLRPHGIRTALVG
FT                   KTHATANVDALQRLAINPESAQAEVLNEVGFEAYFRHDGIFPDDPLFDDKRESAPYTHY
FT                   LREQGFEGRNPWHDWANAAEGDNGEILSGWKMRNAHLPARIPEQHSETVYTTNRAIDFI
FT                   GEQGEKPWFLHLSYIKPHWPYIVPAPYHTLYSTKSILEPVRNASPSDHPVYQAFRKHEE
FT                   SLNFSKDPVRLNVIPTYMGLVKQVDDQLGRLFDFLQSNGRWEDTLIVFTSDHGDFLGDH
FT                   WLGEKEFLLEQAVGVPLIVRDPRAAADVTRGTVDERLAETIDGVPTFLEALGVTGAEHR
FT                   LEGRSLIPLLHGENPDWRRYSISEYDYAFQAPARERLGQPIDRCRMTMVRSERWKYLAY
FT                   DGFRPQLFDLLNDPQELQDLGADPAYAAVREEHAGYLFEWVRGLKRRTTISHQEIDLRG
FT                   QRFRYGEPETEKLVQIGVW"
FT   gene            complement(256125..257069)
FT                   /locus_tag="Pfl01_0215"
FT   CDS_pept        complement(256125..257069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0215"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71959"
FT                   /db_xref="GOA:Q3KJU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU7"
FT                   /protein_id="ABA71959.1"
FT                   /translation="MHIDLRQLRHFIALAEQRSFVAGAQAVNLSQSAFSRSIQALEHSV
FT                   GCQLVDRGRKELPPTKQGQVLLEHARRLVSGAQQMANEISQFNGLEAGELRFGCGPAPA
FT                   AGLIPRAIGSFIGRYPKARVHYQVDDWQSLSKRLLSEEFEFFVADTRHFEADPDYLTHR
FT                   LRPRKWHFCCRAGHPLGAFERVTAEQLMSYPLAVSIRPPNLRKVIVDLSGRPDFVPNVE
FT                   CENSASLLGVVLRSDAIGIVGAYSDALHQARGELVCLKVEGLADDLEELYTRYGIVSRA
FT                   GYRLSPLAEAMIEQIKAIDAVEEEVCSLANLAV"
FT   gene            257235..259595
FT                   /locus_tag="Pfl01_0216"
FT   CDS_pept        257235..259595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0216"
FT                   /product="putative TonB-dependent exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71960"
FT                   /db_xref="GOA:Q3KJU6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU6"
FT                   /protein_id="ABA71960.1"
FT                   /translation="MSPLNLASPPPPRRLKRLPLALLLAGSASWTHGYAAETETPVPAP
FT                   AGKTATATSQLETVTVTTRRREESSQDVPTPMSVVSGTTLETQRVYRIQDLQQLVPSVN
FT                   VAYMHARQSSVSIRGLGNNPASDGLEGSVGLYIDNVYLGRPGMAVFDLMDIEQLEVLRG
FT                   PQGTLFGKNTTAGVINISTRAPSFTPERSIETSVGEDGYFQTKGTISGPLNDVLAGRLS
FT                   AYRTRSDGDIKNEFNGHDLNGGSRDGFRAQLLFKPNENFNLRWIGDYNEEDSSAGTRVL
FT                   YNTGPTINGVNLYSARAAAAGATLVNGSHRKVNLDNDQHVTVHQGGTSVEANWTLPSDF
FT                   TLTSVSSYRFWNFTPRNDDGLNVPATYNAGVSVEDKQYSQEFRLASPKGEFFDYVLGAY
FT                   YFGSDLDNKSFAYYGPQADIWNGTPRGALANVNSVGRGHIKTDSFALFAQGTWHLTPRL
FT                   DFTAGVRGTYEEKNAWVNRDAPVGGAAVTGAAATARRGRTGAYDSGDLNQYSSSPSGLL
FT                   NLSYRFTDDLLGYATLSHGEKSGGVNLVVGSAPTAGADSLLIGTERANNAELGFKSTLW
FT                   DRRLQLNANVFWTQVNAYQTNAYDDVNRVQYLTNAGSVRSRGVEFESTVIPLRGLTLNF
FT                   NGSYNDVSYLSYKDAPCPPEVSQAPGAPASCDLSGHQVVGASKWIGNANGKYEWNLDNG
FT                   LQPYVTGSYAFRSKAVGTVEDSDYGQIPSYAVVNLSTGLRGDFNQGQWDVSLWLKNAFD
FT                   KTYYTTLWTGGNGGYEGLLGTPRTLGVSGRYDF"
FT   sig_peptide     257235..257342
FT                   /locus_tag="Pfl01_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.595 at
FT                   residue 36"
FT   gene            complement(259803..260363)
FT                   /locus_tag="Pfl01_0217"
FT   CDS_pept        complement(259803..260363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71961"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU5"
FT                   /protein_id="ABA71961.1"
FT                   /translation="MKLNNFVIALALLSSTLLHAAEESKSADFKTDFKNASQALTLIAK
FT                   IYGHPDTNLLPGENISIPFLPVAGAIINASASGKIQHISISRVGCPQELCVVLSDSKKS
FT                   NSSLNKTAAQRRITPDFEIINKGTSNITARKVDDLSWVTIPPGGSAKIGNINDSGFHID
FT                   GYMKIIQIDKQKCTLEHCFWVLE"
FT   sig_peptide     complement(260301..260363)
FT                   /locus_tag="Pfl01_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            260723..261580
FT                   /locus_tag="Pfl01_0218"
FT   CDS_pept        260723..261580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0218"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71962"
FT                   /db_xref="GOA:Q3KJU4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU4"
FT                   /protein_id="ABA71962.1"
FT                   /translation="MTLRAFRKETAGSKSMGNVQTAASAQEVLWRQAPSGELVDLGRPH
FT                   RVPLGQLRLQRAPKGILSRRETILLGVLALVVHGAVIYWINQHPTPALPIVPPEIPPMT
FT                   IEFSRPAPPAPPVVVPPPPAPVVEPPPPVEDELATKPPPKPKPIPKPKPVAKPVPKPAP
FT                   KAVEQPPAPPQPAAPVAAPAPPAPPAPAPVTPASANAAYLKNPAPEYPSLAQRRGWEGT
FT                   VLLRVHVLASGKPGEIQIQKSSGRQQLDDAALDAVKRWSFVPAKQGDVAQDGWVSVPID
FT                   FKIH"
FT   gene            261626..262351
FT                   /locus_tag="Pfl01_0219"
FT   CDS_pept        261626..262351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0219"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71963"
FT                   /db_xref="GOA:Q3KJU3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU3"
FT                   /protein_id="ABA71963.1"
FT                   /translation="MTLLASPLESIESAVIWLLVVFSVATWGLALLKAVQFGRLKAQDR
FT                   KFHKRFWAASSLDSAAELSETQPGAAARVAQAGYAAIQVGEAPQANDLSQAINHQDRLE
FT                   RALRQQIVRERRSLETGLAVVASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVA
FT                   GPIGAALVATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSSFRVLIH
FT                   PTAHKAAAQGNATKVKEAS"
FT   gene            262353..262754
FT                   /locus_tag="Pfl01_0220"
FT   CDS_pept        262353..262754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0220"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71964"
FT                   /db_xref="GOA:Q3KJU2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU2"
FT                   /protein_id="ABA71964.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNAIPIN
FT                   LPKTEAVAPVEQKDPLVVSIDGAGKLFINKDEIQPDLLEFNLKSAKAKDPEVRVQLQAD
FT                   DGVNYGEVARAMASIERAGITKLSVITAR"
FT   gene            262924..263505
FT                   /locus_tag="Pfl01_0221"
FT   CDS_pept        262924..263505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71965"
FT                   /db_xref="GOA:Q3KJU1"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU1"
FT                   /protein_id="ABA71965.1"
FT                   /translation="MRNESIRYLIVPGWQGSPEDHWQTHWQNSLPNSARVEQADWLTPR
FT                   REDWVAALAEAIAADSSPVILIAHSLGCITVAHWAATAPLHHLRQVRGALLVAPADVER
FT                   PACVPALRNFAPIPTDLLPFPSQVVSSDNDAAVSAPRALELARNWGAEAGVLAGAGHIN
FT                   VKSGHQRWEQGFAYLYRLQNRMEHHARRRA"
FT   gene            263562..264494
FT                   /locus_tag="Pfl01_0222"
FT   CDS_pept        263562..264494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0222"
FT                   /product="putative sigma-54 dependent regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71966"
FT                   /db_xref="GOA:Q3KJU0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU0"
FT                   /protein_id="ABA71966.1"
FT                   /translation="MSLETFGQPLLTFPDAEKSPLSIRAKALVFVDPRSRQLREEMAQL
FT                   APRSISVLIRGETGTGKELLARHIHRASDRSGLFVSVNCGAISPTYADAELFGYAAGSY
FT                   SGSASSRAGWFGSANGGTLYLDEIGDLPLPIQIKLLSALENHEVTRVGAHQPSPVDVRL
FT                   VAATSIDLAQAVAAGKFHERLYHYLSEGHLELPALRARVGDILSLAEYFLGIYSQRLDL
FT                   PVPLISEAAQQVLEQHSWPGNTRELENVIHFALLVSTGDEILPEHLNLPEVSGPQVQIE
FT                   RQVASVSLNGTVDERKALKEWLLSLSEAL"
FT   gene            264659..265456
FT                   /locus_tag="Pfl01_0223"
FT   CDS_pept        264659..265456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0223"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71967"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT9"
FT                   /protein_id="ABA71967.1"
FT                   /translation="MKKVLLFTALAAALTASLAQAGEKLVVAATPVPHAEILELIKPTL
FT                   AKEGVDLEIKVFTDYVQPNVQVGEKRLDANYFQTKPYLDSFNAGKYKDDKAKYLVTVQG
FT                   VHVEPFGGYSSKYKTLAELPDGATIAIPNEGSNSGRALILLQKAGLIELKDPKNALATP
FT                   KDIAKNPHNFKFKELESALLPRVLKEVDLDMINTNYALEAKLNPTKDALVIEGADSPYV
FT                   NFLVAREDNKNSDAIKKLAAALTSPEVKAFIEKKYNGAVLPAF"
FT   sig_peptide     264659..264724
FT                   /locus_tag="Pfl01_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            265510..265818
FT                   /locus_tag="Pfl01_0224"
FT   CDS_pept        265510..265818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71968"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT8"
FT                   /protein_id="ABA71968.1"
FT                   /translation="MVIGVFSCVWLTQAALVFSALRKATSHFTKSCGSGRCGTFTSMFS
FT                   SLLWGWPGESGQKLFVLGGLLRKKDPSYSERKNSLLILSEQTRRIVFCVISICFNGI"
FT   gene            265919..266584
FT                   /locus_tag="Pfl01_0225"
FT   CDS_pept        265919..266584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0225"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71969"
FT                   /db_xref="GOA:Q3KJT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT7"
FT                   /protein_id="ABA71969.1"
FT                   /translation="MTFDYAFILSTLPAFLKAVGVTLQVGLIAIGTSLLVALLNATILV
FT                   FRTPYLQKLVGLYVELARNTPLLIQLFFVYFALPALGIKVSGFTAAIITMTFLGGAYLT
FT                   EVLRAGVDAVPQAQLESGRSIGLSHGQLLRYVILPQAGILSLPSLFANFIFLLKETTVV
FT                   SAVAVPEILYTTKSYIALYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRLQHGQFGS"
FT   gene            266595..267224
FT                   /locus_tag="Pfl01_0226"
FT   CDS_pept        266595..267224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0226"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71970"
FT                   /db_xref="GOA:Q3KJT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT6"
FT                   /protein_id="ABA71970.1"
FT                   /translation="MSLPQLAKGAGQTLSISFLSIAISTVGGVLYGVLRTLNVRWLNAL
FT                   LRIYLELFRAIPVLVWLYLLFFGLPIFFGLSLPSFWCAVLVLSLWGASEVGEVARGALH
FT                   SLPRGQREAGLSIGLNAAQLYGYVLLPQALKRMTPPTINVYTRIIKTSSLAVLIGVVDV
FT                   IKVGQQIIERTYESVLIYGALFLFFFFICYPLSAASRVLERRWTQA"
FT   gene            267221..268018
FT                   /locus_tag="Pfl01_0227"
FT   CDS_pept        267221..268018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0227"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71971"
FT                   /db_xref="GOA:Q3KJT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT5"
FT                   /protein_id="ABA71971.1"
FT                   /translation="MSALIEFQGFNKFFGEQQVLKGIDLQVKSGEVIVVLGPSGCGKST
FT                   LLRCLNGLETAHSGSLKFAGRELLDKATDWREVRQQIGMVFQSYHLFPHMSVLDNLLLG
FT                   PLKVQKRERREAQQQAEALLERVGLADKCDAFPRQLSGGQQQRIAIVRSLCMNPRVMLF
FT                   DEVTAALDPEMVKEVLEVIQGLAREGMTLLIVTHEMAFARAVADRIVFMDAGRILEQNP
FT                   PELFFTNPQTARAQQFLEKFSYVEALTSTTSPTTSQTKELELP"
FT   gene            268015..268893
FT                   /locus_tag="Pfl01_0228"
FT   CDS_pept        268015..268893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0228"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71972"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT4"
FT                   /protein_id="ABA71972.1"
FT                   /translation="MKTAKALFALPLISLALLAGCNKTEEPAKPKVASESTAPAGYLDK
FT                   IKARDKLIVGVFTDKPPFGFVNEAGRYVGFDTDIGRQFAKDLLGDENKVEFVAVEPASR
FT                   IPFLQSDKVDLILANMTVTPERKEAVEFTNPNLKVAVQALVPQGSEVKKLDDLATRTTI
FT                   VTTGTTADIWLTKNHPDWKLLKFEKNSESLQALANGRGDAYAQDNLVLFSWAKQNPGYR
FT                   VLDEKLGAEAPIAPAVKKGNIELRDWVNAELAKLGEEKYLLKLYDQYVRKELSDDTKPE
FT                   SVIVEGGKWQG"
FT   sig_peptide     268015..268089
FT                   /locus_tag="Pfl01_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.426 at
FT                   residue 25"
FT   gene            complement(268890..270050)
FT                   /locus_tag="Pfl01_0229"
FT   CDS_pept        complement(268890..270050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71973"
FT                   /db_xref="GOA:Q3KJT3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT3"
FT                   /protein_id="ABA71973.1"
FT                   /translation="MLKTLAVANYRSINKLVIPLGRLNLITGPNGSGKSNLYRALRLLA
FT                   ETAQGGVVNALAREGGLDSTFWAGPETISRRMRNGEVPIQSTVRQGVKRLRLGFAGEDF
FT                   SYSIALGLPEPSLSYFSLDPEIKKECIWAGPLYRPASLLVDRDGPMIRTRDGRSWDVLA
FT                   QHTPNFDSLFDQVGSLRTSPEVFQMREFIRRWRFYDHFRSDADAPVRQPQLGTRTPVLH
FT                   HDGRDLAAALQTIREIGDPEALQAAISDAFPGARLNIAPLAGGRFAIEFFQEGLLRPLS
FT                   AAELSDGTLRYLLLVAALLTPRPPSLMVLNEPETSLHPDLLPALARLIIRVSEQCQVWV
FT                   VSHARRLISALQEDPECNCIVLEKTLGQTGIVGQRVLDEPAWNWPD"
FT   gene            270195..271298
FT                   /locus_tag="Pfl01_0230"
FT   CDS_pept        270195..271298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0230"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71974"
FT                   /db_xref="GOA:Q3KJT2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT2"
FT                   /protein_id="ABA71974.1"
FT                   /translation="MASPGLKTAVMLSLFALLSACGEKKAPAEYLPRVFVQEVNPANYA
FT                   AAVTLTGDVQARVQTELSFRVGGKIIQRMVDVGDRVSAKQVLAKLDPKDLQTNVDSAQA
FT                   QVVAEQARVKQSAAAFVRQQKLLPKGYTSQSEYDSAQAALRSSQSALSAAQAQLANAKD
FT                   QLSYTALIADAPGVITERQAEVGQVVQATAPIFSLARDGDRDAVFNVYESLLAERPAER
FT                   SIVVSLLDNPAIKTTGTVREITPAVSAQSGTVQVKVSLDSLPQGMQLGSVVSATAKGTG
FT                   KSAVELPWSALTKNVSDPAVWMVDDKGEAQLHNVTVSRYLIGKVIISEGLKGGEKVIVA
FT                   GGQLLHPGMKVEIAENTYKDLQPGAQP"
FT   sig_peptide     270195..270263
FT                   /locus_tag="Pfl01_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.367 at
FT                   residue 23"
FT   gene            271295..272359
FT                   /locus_tag="Pfl01_0231"
FT   CDS_pept        271295..272359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0231"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71975"
FT                   /db_xref="GOA:Q3KJT1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT1"
FT                   /protein_id="ABA71975.1"
FT                   /translation="MKRLGLLSIGVLLAACSKSEPPPEPVRPVLSVKVEALSEENLGRF
FT                   AGSIQARYESNTGFRVGGRIASRNVDVGTEVQKGTLLATLDPTDQQNQLRSAQGDLARV
FT                   QAQLINAQANARRQQALFDRGVGAQAQLDIAMTDLKTTQASLDQARAAVNQSKDQLDYT
FT                   QLRSDHKAVVTAWNAEAGQVVTAGQQVVTLAQPDIKEAVIDLPDTLVDEIPSDVVFLVA
FT                   GQLDPNINTTATLREIEPQAQSATRTRRARLTLANTPDGFRLGTAISVTLSSAIKPRIE
FT                   LPATALQEADGKQRIWVIDTQSKTVNPRDVSVISRTDSSVVLAGGVKNGERVVSAGVNS
FT                   LKPGQSVKLDEDSQ"
FT   sig_peptide     271295..271354
FT                   /locus_tag="Pfl01_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.924 at
FT                   residue 20"
FT   gene            272356..275409
FT                   /locus_tag="Pfl01_0232"
FT   CDS_pept        272356..275409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0232"
FT                   /product="putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71976"
FT                   /db_xref="GOA:Q3KJT0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT0"
FT                   /protein_id="ABA71976.1"
FT                   /translation="MKGSFNLSEWALKHQSFVWYLMFVALLMGVFSYFNLGREEDPSFT
FT                   IKTMVIQTKWPGATQEETLKQVTDRIEKKLEELDSLDYVKSYTRPGESTVYVYLRDTTS
FT                   AKDIPEIWYQVRKKIDDIRGQFPQGIQGPGFNDEFGDVFGSVYAFTADGLTMRQLRDYV
FT                   EQARAEIRNVPGLGKIEMIGQQDEVIYLNFSTRKLAALGIDQRQVVQSLQSQNAVTPAG
FT                   VIEAGPERISVRTSGQFASEKDLAEVNLKLNDRFYRLADIADITRGYTDPATPEFRFDG
FT                   KPAIGLAIAMQKGGNVQEFGKALHKRIDELTADLPVGVGVHTVSDQAVVVEEAVGGFTS
FT                   ALFEAVVIVLVVSFISLGVRAGLVVACSIPLVLAMVFVFMEYSGITMQRISLGALIIAL
FT                   GLLVDDAMITVEMMVTRLEMGESKEEAATFAYTSTAFPMLTGTLVTVAGFVPIGLNASS
FT                   AGEYTYTLFAVIAVAMIVSWIVAVFFAPVIGVHILSTNVKSHEAEPGRVGRAFNGGLLW
FT                   CMRNRWWAIGITVLLFVLAVFCMRFVQNQFFPSSDRPEILVDLNLPQNASIDETRKAVD
FT                   KLEATLKGDADIVRWSTYIGQGAIRFYLPLDQQLQNPYYAQLVIVSKDFEAREALSQRL
FT                   RERLHKDFVGIGSYVQALEMGPPVGRPIQYRISGKDIDQVRKHAIDLATELDKNPHIGE
FT                   IIYDWNEPGKVLRIDIAQDKARQLGLSSEDVANLMNSIVSGAPLTQVNDDIYLINVVGR
FT                   AVSSERGTPETLQNLQIVTPNGTSIPLLAFATVRYELEQPLVWRRDRLPTITIKASVRD
FT                   EIQPTDLVKILKPSIDAFAEKLPVGYKVATGGTVEESGKAQGPIAKVLPLMLFLMATFL
FT                   MIQLHSVQKLFLVASVAPLGLIGVVLALVPTGTPMGFVAILGILALIGIIIRNSVILVT
FT                   QIDEFERKGYAPWDAVVEATEHRRRPILLTAAAASMGMIPIAREVFWGPMAYAMIGGIV
FT                   IATLLTLLFLPALYVAWYKIREPKKEAQ"
FT   gene            complement(275436..276065)
FT                   /locus_tag="Pfl01_0233"
FT   CDS_pept        complement(275436..276065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71977"
FT                   /db_xref="GOA:Q3KJS9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS9"
FT                   /protein_id="ABA71977.1"
FT                   /translation="MKQTPTDLEQITSTTLGHYNAVAEDFREGTRDHDVSQNIDALLRH
FT                   IQGTAPFSILDFGCGPGRDLQTFTRMGHVAVGLDGAEKFAQMAREDSGCEVWCQDFLKL
FT                   DLPPERFDGIFANAVLFHVPLQELPRVLKQLHGTLKPGGVLFSSNPRGDNREGWNGPRY
FT                   GSYHDLEAWRGLLTAAGFVELEHYYRPAGLPREQQPWLASVWRKAV"
FT   gene            276248..277666
FT                   /locus_tag="Pfl01_0234"
FT   CDS_pept        276248..277666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71978"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS8"
FT                   /protein_id="ABA71978.1"
FT                   /translation="MVIGRKPHVTPSPARFAPDATRPRTRPGDTLSIEAPAIKVARTSP
FT                   ALEKDPAMPVPADAAVTITGMPLAENTSIRSVVMSLEKYRLRLPRGLPAADTQGIRRFK
FT                   GREFVDIAAGEIVQVRQDVVTGEYRATLPSEQSASGPRLVLDQRTMIWKAEQLSILADI
FT                   GNAMSARSDSELIGLKPSIGRDATAAQGRLYEGRDDRFERQTSLAVTIVARGLSQFEPR
FT                   HAATLRTELHATHQIFSDARNGLAANYAEVAGIFQGFFGTQHALIKAKFADCLSRGEAL
FT                   SKEYQGPWGMEKFVGVAFDQDRRAWMFQFDFHGRLFISLNHLQTGDFAAVLGHEMLHTN
FT                   RVNRFKSVGPGALDFFYLDARMGNALSRPVPVYDMAERGVSEVIMQGGMTVAYLDGFTS
FT                   DHSRFTAGVREALGLAEKLDVQTAVDLFNAHPTVRTSLASSNADSIIYAATSLQALHLA
FT                   RIADSQLLESLLNR"
FT   gene            complement(277672..278316)
FT                   /locus_tag="Pfl01_0235"
FT   CDS_pept        complement(277672..278316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0235"
FT                   /product="putative amino acid ABC transport system,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71979"
FT                   /db_xref="GOA:Q3KJS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS7"
FT                   /protein_id="ABA71979.1"
FT                   /translation="MWFDRLLQGFIDTFLMVGVSSLIALLAGIPMAVILVTSDKGGIYE
FT                   APVLNRALGAFVNLFRSIPFLILMVALIPFTRLIVGTTYGVWAAVVPLTIAATPFFARI
FT                   AEVSLREVDYGLIEAAQAMGCRRWHIVWHVLLPEALPGIVGGFTITLVTMINSSAMAGA
FT                   IGAGGLGDIAYRYGYQRFDSQIMLTVIVLLVALVALIQLGGDRLARGLNKR"
FT   gene            complement(278306..279430)
FT                   /locus_tag="Pfl01_0236"
FT   CDS_pept        complement(278306..279430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0236"
FT                   /product="putative amino acid ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71980"
FT                   /db_xref="GOA:Q3KJS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJS6"
FT                   /protein_id="ABA71980.1"
FT                   /translation="MTAAIQRRLDLSEPPALAQRTELHPELNRAHVRFVGLGKTYDGKQ
FT                   GTVAALQGIDLAIQRGEVFGIIGRSGAGKSSLIRTINRLEQPTSGRVLIDQVDIGEYDE
FT                   DRLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVPKEQREKKVRELLELVGLQAK
FT                   HTAYPAQLSGGQKQRVGIARALVHDPDILLCDEATSALDPETTQSILGLLREINKRLGL
FT                   TIMLITHEMAVIREICDRVVVLEHGRIVEQGPVWEVFGNPQHEVSQTLLAPLQHALPEE
FT                   LQSRLQVQPSSSDASVVLRLQFTGSQQDEPDLAALFAALGGRVKLLQGGVERIQGHALG
FT                   QLLLAVAGSQLNAEQLRERAGQWAQRTEVLGYVV"
FT   gene            complement(279433..280242)
FT                   /locus_tag="Pfl01_0237"
FT   CDS_pept        complement(279433..280242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0237"
FT                   /product="putative amino acid ABC transport system,
FT                   exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71981"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS5"
FT                   /protein_id="ABA71981.1"
FT                   /translation="MTKKLLSHPVKALALAFGLFSSAVFAADAPLKIGTTAAFAIPLEA
FT                   AVEEASKQGLKVELVEFTDWIAPNVSLAAGDIDVNYFQHIPFLENAKAASGFDLVPFAP
FT                   GIINNVGLYSKKYKSFDELPEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATE
FT                   DDIVANPKKIKILQVEAVQLVRAYDDADLVQGYPAYIRLAKTFDAGSALLFDGLDHKEY
FT                   VIQFVIQPKSKTDPRLIKFVDIYQHSPAVRAALDKAHGKLYQAGWES"
FT   sig_peptide     complement(280162..280242)
FT                   /locus_tag="Pfl01_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(280256..281620)
FT                   /locus_tag="Pfl01_0238"
FT   CDS_pept        complement(280256..281620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0238"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71982"
FT                   /db_xref="GOA:Q3KJS4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS4"
FT                   /protein_id="ABA71982.1"
FT                   /translation="MSKKKILLNAFNMNCIGHINHGLWTHPRDTSTRYKTLEYWTELAQ
FT                   LLERGLFDGLFIADIVGVYDVYQNSVDVTLKESIQLPVNDPLLLVSAMSAVTKNLGFGL
FT                   TANLTYEPPYLFARRMSTLDHLSRGRVGWNIVTGYLDSAAKAMGLSEQVEHDRRYDQAD
FT                   EYLEVLYKLWEGSWENGAVLNDPQQRIYAQPDKVHKVEHKGEFYQVEGYHLCEPSPQRT
FT                   PVLFQAGSSDRGLLFAGRHAECVFISGQNKPSTKAQVDKVRASAVEAGRNPEDIKVFMG
FT                   LNVIVGETEEAAWAKHAEYLSYASAEAGVAHFSASTGIDFSQYEIDEPIQYVKSNAIQS
FT                   ATKNLQNNDWTRRKLLDQHALGGRYITVVGSPQQVADELESWIAETGLDGFNLTRIVTP
FT                   ESYVDFIDLVIPELQRRGSYKTAYDSGSLREKLFHGEAHLPPQHTGAHFRHTSSH"
FT   gene            complement(281620..282813)
FT                   /locus_tag="Pfl01_0239"
FT   CDS_pept        complement(281620..282813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0239"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71983"
FT                   /db_xref="GOA:Q3KJS3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS3"
FT                   /protein_id="ABA71983.1"
FT                   /translation="MTFSHPVAVITSDEQALIVASDLAEDFQRDSNLRDRERRLPLPEL
FT                   DVFSRSGLWGISVPKEYGGAGVSNVTLAKVIALIARADGSLGQIPQNHFYALEVLRVNG
FT                   SHEQKQRLYAEVLAGQRFGNALAELGTRTAHDRVTRLERDGSGYRINGRKFYATGAIYA
FT                   QRIPTSVVDENGVQQLAFVPRDSKGLTVIDDWSGFGQRTTGSGSVVFENVYVAAEDVIP
FT                   FQSAFERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRSKTRPWIDSGNDKATEDPLT
FT                   LKSFGHLSIRLHATEALLERAGEFLDAAQAETNAETVAAASIAVAEARAISTEISLAAG
FT                   STLFELAGSQATLIEHGLDRHWRNARVHTLHDPVRWKYHAVGNYYLNDENPPLRGTI"
FT   gene            complement(282852..284093)
FT                   /locus_tag="Pfl01_0240"
FT   CDS_pept        complement(282852..284093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0240"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71984"
FT                   /db_xref="GOA:Q3KJS2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS2"
FT                   /protein_id="ABA71984.1"
FT                   /translation="MSSLADANVQSDLDIAPLLLPAQVLRNDAQAIKAAHELAQVARVQ
FT                   AAKRDRQRKLPWSEIEQFTRSGLGSIAIPREYGGPQVSFVTLAEVFAIISAADPALGQI
FT                   PQNQFGIINLILGSATEQQKKHLLQSVLEGWRIGNAGPERGTKNTLELKARITADGDDY
FT                   VINGQKFYSTGALFAHWVAVKALNDDGKQVLAFVRRGTPGLRIVDDWSGFGQRTTASGT
FT                   ILLNNVRVDAGLVVDNWKINEKPNTQGAVSQLIQAAIDAGIARGAIDDAIEFVKTRARP
FT                   WIDANVERASDDLYVIADIGKLKIELHAAEALLRKAGQVLDQVHAAPLTAESAARASIA
FT                   VAEAKVLTTEISLLASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRWKYHAVGA
FT                   YRLNGKLPARHSWI"
FT   gene            complement(284360..285124)
FT                   /locus_tag="Pfl01_0241"
FT   CDS_pept        complement(284360..285124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS1"
FT                   /protein_id="ABA71985.1"
FT                   /translation="MTRTSHIPELAAPSLAPSRNNGINLAAAAHLLVDVPPYPEMDTGD
FT                   LIELFWNNCYVASHLLTAQDVAAPISLRVPESFIASGSSRIHYRVMRVGHGPSLSAAAR
FT                   VTVKLDCPGGQPPAVCGDENQQLAPVTLPETIRRQGVNANQIKRGVPLTIEPYLNMADG
FT                   DAITLRWGDVRMDLARITPADVGQPIQVWVPPAIITEAGEDLRLDVTYCILDRVGNNSR
FT                   WAPPRTLKIGCVNPYLKVPLKETPKAAEPQKK"
FT   gene            complement(285581..286330)
FT                   /locus_tag="Pfl01_0242"
FT   CDS_pept        complement(285581..286330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0242"
FT                   /product="L-cystine ABC transporter ATP-binding protein /
FT                   Diaminopimelate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71986"
FT                   /db_xref="GOA:Q3KJS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS0"
FT                   /protein_id="ABA71986.1"
FT                   /translation="MIVVEKLTKQFKGQVVLNGIDLEVKEGEVVAIIGPSGSGKTTFLR
FT                   CLNFLEEPTSGRIKVGEIEIDTSRPLNQQQNLVRNLRQHVGFVFQNFNLFPHRTALENV
FT                   IEGPIVVKKTPRDAAIALGKKLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEV
FT                   ILFDEPTSALDPELVGEVLATIRGLAEEKRTMVIVTHEMAFARDVANRVVFFDKGVIVE
FT                   QGEAKALFANPKEERTRQFLSKFRNNG"
FT   gene            complement(286335..287000)
FT                   /locus_tag="Pfl01_0243"
FT   CDS_pept        complement(286335..287000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0243"
FT                   /product="Diaminopimelate ABC transporter membrane protein
FT                   / L-cystine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71987"
FT                   /db_xref="GOA:Q3KJR9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR9"
FT                   /protein_id="ABA71987.1"
FT                   /translation="MEEAFQLALDSAPFLLKGAYYTVILSLGGMFFGLLLGFGLALMRL
FT                   SRFKSVSWLARIYVSFFRGTPLLVQLFVIYYGLPQLGMELDPLPAALIGFSLNMAAYAC
FT                   EILRAAIGSIERGQWEAAASIGMTRAQTLRRAILPQAMRTALPPLGNSFISLVKDTALA
FT                   ATIQVPELFRQAQLITARTFEVFTMYLAAALIYWILATVLSHFQNKLEERVNRHDQES"
FT   gene            complement(287000..287800)
FT                   /locus_tag="Pfl01_0244"
FT   CDS_pept        complement(287000..287800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0244"
FT                   /product="Diaminopimelate-binding protein /
FT                   L-cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71988"
FT                   /db_xref="GOA:Q3KJR8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR8"
FT                   /protein_id="ABA71988.1"
FT                   /translation="MILSALRRNLLVGSLGLALSAGLLGQAVAGEQLQQIKDKGVINVG
FT                   LEGTYPPFSFVDADGKLSGFEVELSEALAKKLGVKAKIQPTKWDGILAALESKRLDVVV
FT                   NQVTISEERKKKYDFSEPYTVSGIQALVLKDKAAALNIKSAADLSGKKVGVGLGTNYEQ
FT                   WVRANVPGADVRTYDDDPTKFADLNNGRTDAILIDRLAALEYAQKAPKTVAAGEAFSRQ
FT                   EAGIALRKGEPELLAAVNKALDELRADGTLEKLSKKYFNADVTQ"
FT   sig_peptide     complement(287711..287800)
FT                   /locus_tag="Pfl01_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 30"
FT   gene            complement(288046..289050)
FT                   /locus_tag="Pfl01_0245"
FT   CDS_pept        complement(288046..289050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0245"
FT                   /product="D-cysteine desulfhydrase"
FT                   /EC_number="4.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71989"
FT                   /db_xref="GOA:Q3KJR7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR7"
FT                   /protein_id="ABA71989.1"
FT                   /translation="MSTQPIKQQLQRFNRLDLLGQPTPLEKLERLSTWLGRDVYIKRDD
FT                   LTPLAMGGNKLRKLEYLAADAIAQGADTLITAGALQSNHVRQTAALAAKLGLGCVALLE
FT                   NPLGTDDSNYTGNGNRLLLDLFDTKVELVDNLDNADEQLAALAVRLRSNGKKPYLVPIG
FT                   GSNAIGALGYVRAGLELAEQIKDTGLQFSAVVLASGSAGTHSGLALALSEALPQLPVIG
FT                   VTVSRSEEDQRPKVQGLAERTADLLGVALPDSFKVELWDEYFGPRYGEPNAGTLSAVKL
FT                   LASQDAVLLDPVYTGKAMAGLLDGIGRGRFDDGPIIFLHTGGAPALFAYKDFL"
FT   gene            289241..290167
FT                   /locus_tag="Pfl01_0246"
FT   CDS_pept        289241..290167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0246"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71990"
FT                   /db_xref="GOA:Q3KJR6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR6"
FT                   /protein_id="ABA71990.1"
FT                   /translation="MSERSSHWQLQTIVSQLRTARDQWRAQNGRASGEQGGRELPSRDA
FT                   MAQILEALCGALFPMRLGPVDLREESEDFYVGHTLDVALNALLTQARLELRYVARHSAQ
FT                   ADTEVEAQAIRIIQDFALALPGLRSLLDTDVLAAYHGDPAARSVDEVLLCYPGILAVIH
FT                   HRLAHHLYRAGLPLLARISSEIAHSATGIDIHPGAQIGRSFFIDHGTGVVIGETAIIGE
FT                   RVRIYQAVTLGAKRFPADEDGQLQKGHPRHPIVEDDVVIYAGATILGRITIGKGSTIGG
FT                   NVWLTRSVPAGCNLTQANLQHDDGTQK"
FT   gene            290417..292417
FT                   /locus_tag="Pfl01_0247"
FT   CDS_pept        290417..292417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0247"
FT                   /product="putative choline/betaine transport-related
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71991"
FT                   /db_xref="GOA:Q3KJR5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR5"
FT                   /protein_id="ABA71991.1"
FT                   /translation="MSASSTPASGLVRMNPPVFWFAATVILLFGLTVIAMPEQAGAWLL
FT                   EAQNWAANTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAA
FT                   GISITLFFFCVSEPLTHMLQPPQGEAGTPEAARQAMQILFLHWGLHGWGVFAFVGMALA
FT                   YFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNSGL
FT                   DYLFGIAHTQWIQVGLITLMMGAAIIVAVSGVDKGVRVMSDINMLLACALLLFVLFAGP
FT                   TQHLLNTLIQNLGDYLGALPMKSFDLYAYDKPSDWLGGWTVFYWAWWIAWSPFVGLFIA
FT                   RISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSAIDQVLNHGMSALGMSALDNPSMTLY
FT                   LLLETYPWSKTVIAVTVFISFVFFVTSADSGTVVLSTLSAKGGNPDEDGPKWLRVFWGA
FT                   MTALVTSALLFSGSIDALKSAVVLTSLPFSLILLLMMWGLHKAFYLESQKQIAQLHSLA
FT                   PVSGSRRGKGGWRQRLSQAVHFPSRDEVYRFMDTTVKPAIEEVTAVFAEKGLNVVTQPD
FT                   PAHDSVSLEIGHGEQHPFIYQVQMRGYFTPSFARGGMGSKQLNNRRYYRAEVHLSEGSQ
FT                   DYDLVGYTKEQIINDILDQYERHMQFLHLVR"
FT   gene            complement(292442..292702)
FT                   /locus_tag="Pfl01_0248"
FT   CDS_pept        complement(292442..292702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71992"
FT                   /db_xref="GOA:Q3KJR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR4"
FT                   /protein_id="ABA71992.1"
FT                   /translation="MHTAIIIFFGLILLALMFYIGERIGFSRQTQAYGFAALWLALTVI
FT                   NGAVGVVHAGQPLGTEIAIGSAVYGVPLAAMVLFMVLSAET"
FT   gene            complement(292902..293939)
FT                   /locus_tag="Pfl01_0249"
FT   CDS_pept        complement(292902..293939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0249"
FT                   /product="putative DNA-binding, LacI family, regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71993"
FT                   /db_xref="GOA:Q3KJR3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR3"
FT                   /protein_id="ABA71993.1"
FT                   /translation="MSEEKPRKRRGAGRVTLNAVARQAGVSAITVSRYFNQPEQVSPER
FT                   RERIAAVVAELGYVPNLVAGGLASARGKIVGMVIPNISGPIFANTIQGFSDTLSRHGYQ
FT                   LLLASSYFSTEQEENAVRAFLGWSPAALVVTSHFHSAGTEKMLAEADIPVVETWDYQPD
FT                   REPMQIGFSHFEVGVSAARYLHDKGYRRIAFVQNSAPGDFSALERRDGYAATVRELGLE
FT                   PWVFAPDTDRAPFEAGKQAMQALMNASPRPDAIIFANDNLAAGGLLAGQRAGLKIPEDC
FT                   AVLGFGDYPFAEMLLPSLSTIKPPALEIGVLAATRVLESLGVLPSDEVQRLNLLQCTVI
FT                   ERESI"
FT   gene            294146..296371
FT                   /locus_tag="Pfl01_0250"
FT   CDS_pept        294146..296371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0250"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71994"
FT                   /db_xref="GOA:Q3KJR2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR2"
FT                   /protein_id="ABA71994.1"
FT                   /translation="MHNIPGATHKLAQSIRAAGWLITGLAALPLPAAFAADSTDQEPTL
FT                   KSVTVTATRREESLQKVPVAVSVIDGEQLERDNRNSVASIVQQVPSLNFRTGASNKDTS
FT                   LFVRGVGTISTSPGVEPTVATVIDGVVYARPGQSTLDLLDLERVEVLRGPQGTLFGKNA
FT                   SAGVLNITSKAPTAETHGYIDQSYYSGNESRTRFGIGGSLIPDTLKGSISTLFGTYDGN
FT                   VDNQHNGQEVNGYNHRGVRGKLEFTPNDDITFTLIADYMQSHDDGPNGVVTKALTPAFA
FT                   NALSPVSATSHNRDINTDTRSHVEDTNKGLSGQLDWQLGDYTLTSITAWRGWDNTQYQD
FT                   GDRLGRVTAAFSGTADKGDLAFDQYSQELRLASPKGEFLEYVGGLFYMHGKDEETYQRT
FT                   LTTTTRTDRGVADYSTTSDSYAVFGESTLNFTSDFRGIAGLRYTHDDLEYDHRRVSTSA
FT                   TTVSGIQPATRSSGSVDEDGWSGRLGLQYDLSDTVTTYLTYSRGYKGPAYNVFFNMQPR
FT                   DTEALKPETSNTWEAGIKASSWNNRLTTNLAVFHSDYDNYQANFFDTVAGQVVTRLINA
FT                   GSVSTEGVELDFALQATQQLKFSGALAYTRARIDEFACPAGAAASCNVNGKPLPFSPDW
FT                   KSYVRADYTIPLDNGLDIELGTDYSWQSEVQYDISQNADTKQGAYGLWNASVALADYTN
FT                   GWRVALLGKNLTDKSYSPLLASGGNYIYRAVPRDDERYFGVQLRKDF"
FT   sig_peptide     294146..294253
FT                   /locus_tag="Pfl01_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            296373..297692
FT                   /locus_tag="Pfl01_0251"
FT   CDS_pept        296373..297692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0251"
FT                   /product="putative nitrilotriacetate monooxygenase
FT                   component A"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71995"
FT                   /db_xref="GOA:Q3KJR1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR1"
FT                   /protein_id="ABA71995.1"
FT                   /translation="MSRQLKLGAFLMATGHHVAAWRHPNVPANAGLDFAHYKRLAQIAE
FT                   AAKFDTLFVADSVAAPTQDIASRMARSDHFEPLTLLSALSAVTEHIGLIATATTSYNEP
FT                   YHVARKFASLDHLSGGRAGWNLVTSDNAAEAQNFGRDEHIGHAERYSRAREFHQVVTGL
FT                   WDSWQDDAFIRDKASGAYYDPEKLHVLNHVGEHFRVKGPLNVARSPQGQPVIVQAGSSE
FT                   TGRELAAQTAEVVFTAQTSLASAKAFYADLKGRLPKYGRSADSLKIMPGVFVVVGQTEA
FT                   EAQEKCETFQQLVEPEVGIALLGRMLGNFDLSKYPLDGPLPELPLTDSGQQSRQKLLTE
FT                   LAGREHLTLAELGRRIAGGRGHYSVVGTPAQIADRLQEWFEQGAADGFNVLVPHLPGGL
FT                   EDFANGVVPELQRRGLFRTEYEGRTLRQNLGLARPGNRFA"
FT   gene            297732..298769
FT                   /locus_tag="Pfl01_0252"
FT   CDS_pept        297732..298769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0252"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71996"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR0"
FT                   /protein_id="ABA71996.1"
FT                   /translation="MTYTAAENRYDSIPYRRVGRSGLVLPALSLGLWHNFGDSTPIDTQ
FT                   RSLLRTAFDLGINHFDLANNYGPPYGSAEINFGRLLREDFKQYRDELIISSKAGWDMWP
FT                   GPYGQGGGSRKYVLASLDQSLQRLGLDYVDIFYSHRFDPDTPLEETASALATAVQQGKA
FT                   LYIGISSYSGVKTREIAALLKEWKVPLLIHQPAYNLLNRWVEKDLLDTTDELGTGVIAF
FT                   TPLAQGLLTDKYLNGVPADARVNRPGGGSLQASHLSEANIAHVRALNEIAKRRGQSLAQ
FT                   LALAWTLRDPRVTSALIGASRPEQIVENVGALKNLSFSAEELAEIDRFAQEGGINLWEK
FT                   PSTAE"
FT   gene            complement(298990..299832)
FT                   /locus_tag="Pfl01_0253"
FT   CDS_pept        complement(298990..299832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0253"
FT                   /product="alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71997"
FT                   /db_xref="GOA:Q3KJQ9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ9"
FT                   /protein_id="ABA71997.1"
FT                   /translation="MSSLNITPLSSALGAQISGVDISQPLNQEQRDAIEQALLKFQVLF
FT                   FRNQPIEPSQQARFAHYFGDLHIHPIYPNVPEQPEVLILDTAVTDVRDNAIWHTDVTFL
FT                   PTPAMGAVLSAKLLPEFGGDTLWASGIAAYEALSAPMKALLEGLTATHDFTRSFPLERY
FT                   GNTPQALAQWEEARRKNPPLSHPVIRTHPVSGRRSLFVNEGFTSKINELSETESEAVLK
FT                   FLFAHATRPEFTIRWRWQKDDIAFWDNRVTQHYAVDDYRPARRVMQRATVLGDVPFFR"
FT   gene            complement(299890..300729)
FT                   /locus_tag="Pfl01_0254"
FT   CDS_pept        complement(299890..300729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0254"
FT                   /product="taurine ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71998"
FT                   /db_xref="GOA:Q3KJQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ8"
FT                   /protein_id="ABA71998.1"
FT                   /translation="MSSYDVSATAVKPAATSVVIPVRRSLSTRWISLLTLFALLVIWWA
FT                   VTASGLIEPLFLPPPSAVLQKGWLLATTGYMDSTLWQHLGASLSRIGLGLGFAILTAVP
FT                   VGIAIGANRIARGVLDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAI
FT                   ATATGVRTVDPAKLRAAQSLGATRAQLIRHVILPSALPDILTGVRIGLGVGWSTLVAAE
FT                   LIAATSGLGFMVQSAAQFLVTDVVVLGILVIALIAFAMEMGLRALQRKLVPWHGQAH"
FT   gene            complement(300726..301520)
FT                   /locus_tag="Pfl01_0255"
FT   CDS_pept        complement(300726..301520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0255"
FT                   /product="taurine ABC transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71999"
FT                   /db_xref="GOA:Q3KJQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJQ7"
FT                   /protein_id="ABA71999.1"
FT                   /translation="MALLQLERISAQYPGSPEPVLSDISLTLGPQQLLVALGPSGSGKT
FT                   SLLNLIAGFVEPSAGRITLDNVPVKGPSAERGVVFQDDALLPWQDVLANVAFGLELAGV
FT                   AKDKREQRAREMLALVDLSGFEHRRIWQLSGGQKQRVGLARALAADPRVLLMDEPFGAL
FT                   DAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLATDLILLAPNPGQIVERLHLDFG
FT                   QRYAAGESARAIKSDPRFIETREHVLAKVFSQRSAVQRQERA"
FT   gene            complement(301537..302514)
FT                   /locus_tag="Pfl01_0256"
FT   CDS_pept        complement(301537..302514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0256"
FT                   /product="taurine ABC transport system, substrate-binding
FT                   periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72000"
FT                   /db_xref="GOA:Q3KJQ6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ6"
FT                   /protein_id="ABA72000.1"
FT                   /translation="MKLNFPLRLLAVASLAAASFLAQAADLTVAYQTTVDPAKVAQADG
FT                   AYEKATKADINWRKFDNGADIIAAIASGDVQIGYLGSSPLTAAITRKVPVETFLIATQI
FT                   GAAEALVARDGSGIKTPQDLVGKKIAVPFVSTGHYSLLAALKHWNIDPSKVTVLNLAPP
FT                   AIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAKFGAPTFDAWIVRKDFAEKHP
FT                   EIVTAFAKVTLDAYADYRKDPKAWLANQSNVDKLVKLSGAKASDIPLLLQGNVYPLAAD
FT                   QVSDLGAPTTKAITDTATFLKEQGKVEAVLPDYAPYVSAKYITN"
FT   sig_peptide     complement(302440..302514)
FT                   /locus_tag="Pfl01_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(302709..304307)
FT                   /locus_tag="Pfl01_0257"
FT   CDS_pept        complement(302709..304307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0257"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72001"
FT                   /db_xref="GOA:Q3KJQ5"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJQ5"
FT                   /protein_id="ABA72001.1"
FT                   /translation="MKESKLSELLNRRLALLGERANLSLLEQCLHGIERECLRVTGEGR
FT                   LAQTPHPEALGSALTNEQITTDYSESLLEFITPALPDPADTLASLDKIHRFAYSKLGNE
FT                   YLWSPSMPCPLPAEEDIPIAYYGTSNIGQLKYVYRKGLALRYGKTMQCIAGIHYNFSLP
FT                   EKLWPLLKEAEGFVGTDRDFQSSSYIALIRNFRRYSWLLMYLFGASPALDAGFLRGRAH
FT                   QLEQLDPDTLYLPYATSLRMSDLGYQSNAQAGLTPCYNDLASYTDSLRKAVATPYAPYV
FT                   EVGTHQDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALMARGIQYVEVRCLDI
FT                   NPFLPMGIDLTESRFLDAFLLYCALNESPLLTNNSCGNATSNFLSVVKEGRRPGLQLQR
FT                   DGQPVELKEWAAELLEKIAPLAALLDQSHGGDAHSKALDAQLAKVKDSSLTPSAQVLAA
FT                   MAAHKESFAQFSLRQSQAHAEFFRSEPLAAEEQAKFEELARSSLAQQAELEQNEVGDFD
FT                   VFVGSYQASILAISN"
FT   gene            complement(304507..304890)
FT                   /locus_tag="Pfl01_0258"
FT   CDS_pept        complement(304507..304890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0258"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72002"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ4"
FT                   /protein_id="ABA72002.1"
FT                   /translation="MDMPAGLVESAFFKLLGCRLHSLETGVAQVALVLEPELRNRGGKL
FT                   HGGALFSLVDIAMGLACSSTHGFDQQSATIECKINYIRAVSEGEVMCTARVIHPGRRTL
FT                   VVEADVMQGDKLVAKAQGTFAVL"
FT   gene            complement(304890..307214)
FT                   /locus_tag="Pfl01_0259"
FT   CDS_pept        complement(304890..307214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0259"
FT                   /product="putative S1 RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72003"
FT                   /db_xref="GOA:Q3KJQ3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ3"
FT                   /protein_id="ABA72003.1"
FT                   /translation="MDSINSRIAEELGVRPQQVEAAVALLDEGSTVPFIARYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDERRISILSSIQEQGKLTPELEREIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPSLAPEAEAARFIDAEKGVADVKAALEGAKYI
FT                   LMERFAEDANLLEKLRTYLKQEATLSARVIAGKEEEGAKFRDYFEHDEPLKSMPSHRAL
FT                   AIFRGRNEGILSSALKVGEELPGTLHPCEGMIGQHVGIQNQNRPADKWLSEVVRWTWKV
FT                   KLYTHLETDLLGELRDGAETEAINVFAHNLHDLLLAAPAGPRATLGLDPGLRTGCKVAV
FT                   VDSTGKLLDHATVYPHVPHNKWDQTIAILAALCAKHSVDLIAIGNGTASRETDKLAIEL
FT                   IKKYPAMKMTKVMVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLARISGLNATLAQN
FT                   IVAHRDEHGAFKTRAALKKVARLGEKTFEQAAGFLRVMNGDNPLDSSAVHPEAYPLVQR
FT                   IAAETDRDIRSLIGDAAFLKRLDPKKFTDETFGLPTVTDILQELEKPGRDPRPEFKTAE
FT                   FQEGVEDLKDLQLGMILEGVVTNVTAFGAFVDIGVHQDGLVHISALSEKFIKDPREAVK
FT                   AGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKIDGARGSRPGSAPRQSQGSAPRKESTP
FT                   AAPANNAMASLFANAKQLKKR"
FT   gene            307575..308315
FT                   /locus_tag="Pfl01_0260"
FT   CDS_pept        307575..308315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0260"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72004"
FT                   /db_xref="GOA:Q3KJQ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ2"
FT                   /protein_id="ABA72004.1"
FT                   /translation="MSSTAQTAEGEKILIVDDDPGLSSLLERFFVSKGYRARAVPNTEQ
FT                   MDRLLSREVFNLVVLDLMLPGEDGLTACRRLRGANNQIPIIMLTAKGDELSRIKGLELG
FT                   ADDYLAKPFNPDELMARVKAVLRRQAAPVPGAPGSEEENVTFGDYVLSLATRELKRGDE
FT                   VHMLTTGEFAVLKALVMNARQPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGNSTK"
FT   gene            308430..309743
FT                   /locus_tag="Pfl01_0261"
FT   CDS_pept        308430..309743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0261"
FT                   /product="osmolarity-sensing histidine-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72005"
FT                   /db_xref="GOA:Q3KJQ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ1"
FT                   /protein_id="ABA72005.1"
FT                   /translation="MKTPVWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQ
FT                   YSHGVALTLRAYWAADEENRAKIADAATLIRVVGAGVPEGEQHWPYSEIYQRQMQAELG
FT                   ADTEVRLRMHSPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLSTASA
FT                   WIFVSQLNQPLKRLVYAARQLGQGRSVRLPISDTPSEMAEVYRAFNQMAEDVEQAGRER
FT                   ELMLAGVSHDLRTPLTRLRLSLELMGDRTDLTDDMVRDIEDMDAILDQFLAFIRDGRDE
FT                   SVEEVDLSDLVREVAAPYNQTEEKVRLRLEPIQPFPLRRVSMKRLLNNLIGNALNHAGG
FT                   SVDVAAYVSGDTSAPYVVLSVMDRGAGIDPSELEAIFNPFTRGDRARGGKGTGLGLAIV
FT                   KRIASMHGGNVELRNRSGGGLEARVRLPLGLMLPRDAV"
FT   gene            complement(309828..310733)
FT                   /locus_tag="Pfl01_0262"
FT   CDS_pept        complement(309828..310733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0262"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72006"
FT                   /db_xref="GOA:Q3KJQ0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJQ0"
FT                   /protein_id="ABA72006.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGTERGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPVTGFAHSPDDIPDLIDMVNGAPLVIKVLEGTQGIGVVLCETATAAESV
FT                   IEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTALRAAKVMGLAVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKNVAGI
FT                   IIEHLEKNGGPNMTRTKGKG"
FT   gene            complement(310730..311209)
FT                   /locus_tag="Pfl01_0263"
FT   CDS_pept        complement(310730..311209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP9"
FT                   /protein_id="ABA72007.1"
FT                   /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATDIE
FT                   PFERDGEKWVRFTAHLGTVVQLRHRRCEAPLVARKTIKSSNGQAQVRYVISTTLALGDR
FT                   VWPIEFTLACRKSMRYRLLLGSKALIDGQLVVNPGIKYVQDKPVFPVSTSSTGVA"
FT   gene            complement(311226..312005)
FT                   /locus_tag="Pfl01_0264"
FT   CDS_pept        complement(311226..312005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0264"
FT                   /product="conserved EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72008"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP8"
FT                   /protein_id="ABA72008.1"
FT                   /translation="MTKFPSSLTSPQSGCQGCQQSEPLGFDFSFAYQPIVDLRDKSVYA
FT                   YEALVRGTAGEGALTVLDQVTEDNRYRFDQLCRTRAIEGAAGLNMQTHLSINFMPNAVY
FT                   RPELCIRSTLEAAKKHNFPVDRLIFETLESEHVDNYRHLTNILREYREFGFKTAIDDFG
FT                   AGYSGLNLLADFQPDLIKLDMALIRDIDHDRVRQAIVRGIVTICAELGVTVIAEGIESA
FT                   GERDFLADCGIFLMQGYWFARPAFKALAQVSPEAWTR"
FT   gene            312122..312529
FT                   /locus_tag="Pfl01_0265"
FT   CDS_pept        312122..312529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0265"
FT                   /product="heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72009"
FT                   /db_xref="GOA:Q3KJP7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP7"
FT                   /protein_id="ABA72009.1"
FT                   /translation="MAQKSEEDDKVRLDKWLWAARFFKTRALAKAAIESGKVHCRGERC
FT                   KPGKEPRIGDEFEIRAGFDEKTVVVQALSIVRRGAPEAQTLYAETEASIAKREAAAAMR
FT                   KAGALGVTTDGKPSKKQRRDLFKFRGNSSGE"
FT   gene            complement(312596..313396)
FT                   /locus_tag="Pfl01_0266"
FT   CDS_pept        complement(312596..313396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0266"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72010"
FT                   /db_xref="GOA:Q3KJP6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP6"
FT                   /protein_id="ABA72010.1"
FT                   /translation="MNNPGLFQSRWNLGRLVLCNVVPLALLAFWLWPTGQMLCVIFDEW
FT                   LFRSLNAPLASNPIWLHIWAIASLRPFDIVVGVILLMLLIKGDWVFRAIDVRRAFFGFF
FT                   SILLLMVVIRALFSKFSDHMGWQHSSPSMVLEGAVHISDYFPHLEKTWELKDRSSQSFP
FT                   GDHASVLLIWALFMGVFSRTAGQFLVIWGLALLFMLPRLVAGAHWGQDDYIGGMLLAVW
FT                   ALGWGYYTPFAYHAANFWLKVTAPVFRLLGKLPMVSRMSVVSAQ"
FT   gene            313501..314403
FT                   /locus_tag="Pfl01_0267"
FT   CDS_pept        313501..314403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0267"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72011"
FT                   /db_xref="GOA:Q3KJP5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJP5"
FT                   /protein_id="ABA72011.1"
FT                   /translation="MTDFLDTDYTQRFIFDDSDTRGELVSLERSYAEVLAKHPYPEPVA
FT                   QLLGELMAAASLLVGTLKFDGLLILQARSEGPIPLLMIECSSEREIRGLARYHAEQIPA
FT                   DATLGDLMPNGVLALTVDPIAGQRYQGIVDLDGETLSDCFTNYFVMSQQVGTRFKLCAD
FT                   GRRARGLLLQQLPADRLKDEEERAASWQHITALGNTLTADELLSLDNETVLHRLYHEEQ
FT                   VRLFDVQKLRFHCSCSRERSGNALVSLGLEDAQALVAEQGGQVEIDCQFCNQRYLFDAA
FT                   DIAQLFAGAGVETPSDTRH"
FT   gene            314585..316126
FT                   /locus_tag="Pfl01_0268"
FT   CDS_pept        314585..316126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0268"
FT                   /product="phosphoenolpyruvate carboxykinase, ATP"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72012"
FT                   /db_xref="GOA:Q3KJP4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJP4"
FT                   /protein_id="ABA72012.1"
FT                   /translation="MTQANNAVYTDLSVDDLVKEALNRGEGELADTGALVVRTGHRTGR
FT                   SPVDRFIVEEPSTQAAIAWGPINRKFPADKFDALWARVEAFNNAQEHFVSHVHVGAAED
FT                   HYLAVKMTTQTAWQNLFGRCLFINPAQYNPAGREEWQVLNVANFECVPERDGTNSDGCV
FT                   IINFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGEGVVFNIEGGCYAKCIDLSEKNEPVIWKAIKHGAV
FT                   LENVVIDDAKHADYADVSLTQNSRAAYPLEHVAKRSEKNLGGEPNAVIFLTCDLTGVLP
FT                   PVSILNEEQAAYHFLSGYTALVGSTEMGSGSGIKSTFSTCFGAPFFPRPAGEYAELLIK
FT                   RIRGFGSKVYLVNTGWTGGGYGVGKRFNIPTTRAVIAAIQSGALIGAATEHLDTINLDV
FT                   PLAVPGVETNLLNPRNTWADKAAYDEAAKALAGLFIENFKKFEVSDAIKAAGPKL"
FT   gene            complement(316192..316491)
FT                   /locus_tag="Pfl01_0269"
FT   CDS_pept        complement(316192..316491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0269"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72013"
FT                   /db_xref="GOA:Q3KJP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP3"
FT                   /protein_id="ABA72013.1"
FT                   /translation="MEMTMSKFFDELMESVQEMDEIVRGERTPSREFHVDALQVKEIRK
FT                   ATGLTQAKFAALIDVQLGTLRNWEQGRREPTGPAKALLKAIHNDPVHVLNALAH"
FT   gene            complement(316482..316796)
FT                   /locus_tag="Pfl01_0270"
FT   CDS_pept        complement(316482..316796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72014"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP2"
FT                   /protein_id="ABA72014.1"
FT                   /translation="MIFIETRIFTRRVKELLDDDTYAAFQKQLVVSPSIGDVIEGTGGI
FT                   RKTRIAAKGHGKRGGARVIYYHFVSASQIGLLMIYPKNEQHDLSSDERKALKVLIEKWR
FT                   "
FT   gene            complement(316908..317207)
FT                   /locus_tag="Pfl01_0271"
FT   CDS_pept        complement(316908..317207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72015"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP1"
FT                   /protein_id="ABA72015.1"
FT                   /translation="MKLWNQFPNDRYRPLDTNLTDTKPLVIDTEADPQDILECAVQRLR
FT                   ASSDLLQTLYCLCFKHADVEDIPHITHALYLLTKDGFDLLQVAQQRMLNWKAPV"
FT   gene            complement(317758..318885)
FT                   /locus_tag="Pfl01_0272"
FT   CDS_pept        complement(317758..318885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72016"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP0"
FT                   /protein_id="ABA72016.1"
FT                   /translation="MTTLTIFFCGTGSTKFDSAHENYWNGELVSTLASHHTGREFADWI
FT                   VVDGPGTSNLQADELFTQSKDYGLSGTLFGKGWEENVQHAMNIIKGKCDWQRQQLTETE
FT                   YNRLKAAGIPIEDVKVEGSWLWRKYNYGDRSVTQQKLQEQIIKTFRKDGVIPTKVNLVG
FT                   WSRGGISCHMLANAMFNDSMLTNIPVNIFAIDPVPGIGNFQEHRVKLNYNVKEYVGFYA
FT                   RDERSKGFSCVIPQTATGTKTSIFPMPGRHATLVGNASADGNSGPKVLAEPGLIVRHFA
FT                   EVCLKRWGTVLDKNLNLTDADLRNHTAAIVNAAAKYKAMEKCSYTWFTELDQGERYVSL
FT                   GSKGVPFSTVKGGIYTPATGLTTSVLDVEGYRAIR"
FT   gene            complement(318988..319269)
FT                   /locus_tag="Pfl01_0273"
FT   CDS_pept        complement(318988..319269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72017"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN9"
FT                   /protein_id="ABA72017.1"
FT                   /translation="MNMYTPLNTRFLPLKTCESDKPVLVIDTEAEPGDLLNAADQRLRA
FT                   ASDLLETLYCVCFKQADVKDIPNIVNALYLLTQDGCDLLKVARQRINN"
FT   gene            319573..320076
FT                   /locus_tag="Pfl01_0274"
FT   CDS_pept        319573..320076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0274"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72018"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN8"
FT                   /protein_id="ABA72018.1"
FT                   /translation="MQWLRMASIVLLWVSGCRLAMATEASNAMVLTQVERTEWPDALTT
FT                   QASIDTASRAEVLMFGKALLASECLDESGLKKRLDVPHVQLKSIRQVRDGLWDRLFTTY
FT                   RNASQNCDEQAFCPRVRSVADLRQLAAAFTGDISPAHALWASKSQGVHEQLLNEQLRVA
FT                   VLQP"
FT   sig_peptide     319573..319641
FT                   /locus_tag="Pfl01_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.977 at
FT                   residue 23"
FT   gene            320449..322377
FT                   /locus_tag="Pfl01_0275"
FT   CDS_pept        320449..322377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0275"
FT                   /product="ATP-dependent DNA helicase, RecQ-like"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72019"
FT                   /db_xref="GOA:Q3KJN7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN7"
FT                   /protein_id="ABA72019.1"
FT                   /translation="MHNTLEQVFGYPQFRPGQEAAISAVLAGRSAAAIFPTGSGKSLCY
FT                   QVPALLLPHLTLVVSPLLALMQDQLEFLRRHGISAGSIDSTQSREDANDVMARARSGEL
FT                   KILMISVERLKNERFRNFLQQVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQRQFNIR
FT                   QTLLLTATATPKVIADMQAKFSIAEDDVVTTGFYRPNLNLLVEPVRGQDKRRRLVEWMS
FT                   ARAGQPSIVYVTLQKTAEQIAEHLERNGIQAEAYHAGLPHEQRDAIQKRFMGGQSNCIV
FT                   ATIAFGMGIDKSDIRNVVHFDLPKSIENYSQEIGRAGRDGQPSDCLVLANRDSLNVLEN
FT                   FVYGDTPEQDGIRHVLDELQAAAPEGQWEFLLGPLADQSNIRALPLKTLLVQLELRGLI
FT                   APRYAYYAEYRFKYLLEPDTLLERFEGERRDFVAAIIQTSSRARTWATVNFEAMYEQYS
FT                   AERNRVVKALDYFQEKGWVELESKQMTEVYNVLRGDFDSQVLSAELHEYFTRHEQTEVA
FT                   RIHAMLELFATERCLGYRLAEYFGDHNAPQQCGHCSVCHGHVARLPAPPELPALVDKNF
FT                   TELCGEFIHRHQQYAGSAPSAERLTRFLCGISVPLFTKLKARAISGFAALEEYPYAEVR
FT                   AWAQAHL"
FT   gene            322487..323710
FT                   /locus_tag="Pfl01_0276"
FT   CDS_pept        322487..323710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0276"
FT                   /product="putative fatty acid degradation protein (possibly
FT                   trifunctional)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72020"
FT                   /db_xref="GOA:Q3KJN6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN6"
FT                   /protein_id="ABA72020.1"
FT                   /translation="MSQTSFAIQQAAVIGAGTMGRGIVMCLANAGVSVQWVDNNPQMLE
FT                   QALSSVAETYAHNVRQGRIDQAEADARIARVSKAADYVAIRNVDLVIEAVYENLELKQK
FT                   IFRELDGVLKPEALLASNTSALDIDAIAAATRRPTQVLGLHFFSPAHIMKLLEIVRGAQ
FT                   TAPAVLEAALELGKRMGKVSVVSGNCHGFIGNRMLHPYVLEARKMLLEGAYPHQVDAAL
FT                   QSFGFAMGPFRMYDVVGIDLEWRARELAGKGQDAPEVQVDNRLCEQGRFGQKSGNGYYH
FT                   YEPGSRQAEHDPEVDALVLSVSEGLGFHRRDIGSEEILERCLLALVNEGAKILQEGIAE
FT                   SAHDIDQVYLNGYGFPAERGGPMAWADDQGLADIHKRLLALETRQGDHWRPAPLIGELA
FT                   ARGKGFYL"
FT   gene            323742..324173
FT                   /locus_tag="Pfl01_0277"
FT   CDS_pept        323742..324173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0277"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72021"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN5"
FT                   /protein_id="ABA72021.1"
FT                   /translation="MSNPMPQRSDYPHFQPITTRWHDNDAYGHVNNVTYYSFFDTAVNT
FT                   YLIQVGGLDIHDGEVVGFVVSSSCDYFASIAFPDRIEIGLRVGKLGNSSVQYELAVFKE
FT                   GEQEACAAGRFVHVFVDRASNQPVSIPARLREALERLTV"
FT   gene            complement(324239..324718)
FT                   /locus_tag="Pfl01_0278"
FT   CDS_pept        complement(324239..324718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0278"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72022"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN4"
FT                   /protein_id="ABA72022.1"
FT                   /translation="MKFSSILLLSLGLVSGFASAGGTTEAGVGGALGGVLGSVVGQSLG
FT                   GSTGSTIGAALGGAGGSAVGADKRSRGEAAIGGALGAAGGNVVGRSMGGTTGSLIGAAA
FT                   GGGAGGALGNYMGNKSDDDDRHYDRRHDDRRYYRDRHPGRGHAYGHRKHHRYYRD"
FT   sig_peptide     complement(324656..324718)
FT                   /locus_tag="Pfl01_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            complement(325007..327355)
FT                   /locus_tag="Pfl01_0279"
FT   CDS_pept        complement(325007..327355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0279"
FT                   /product="putative molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72023"
FT                   /db_xref="GOA:Q3KJN3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN3"
FT                   /protein_id="ABA72023.1"
FT                   /translation="MSQHHQADQKPVPRYKPYKGPAGGWGALISVAQAWLTSDNALKNL
FT                   RMMLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDGKFFAKHSVTS
FT                   LLEQSDYWLEYQGRLTEPLVYDAETDRYKPISWDDAYALIGKHLQALSSPDQAEFYTSG
FT                   RASNEAAYLYQLFVRAFGTNNFPDCSNMCHEASGVALAQSVGVGKGTVTFDDFEHADAI
FT                   FVWGQNPGTNHPRMLEPLREAVKRGAQVVCVNPLKERGLERFQHPQHPLEMLTNGDKPT
FT                   NTAYFRPALGGDMAVLRGMAKFLLQWERDAQKAGAPAVFDHDFLNEHSVNVLEYIGVVD
FT                   DTPWEQIVEQSGLTLVEIEQAARMYAKGKNVIMCWAMGITQHRHSVPTIQEIANLMLLR
FT                   GNIGKPGAGLCPVRGHSNVQGDRTMGINERPPVAFLDSLERRFQFKVPRHNGHNVVEAI
FT                   HAMAEGRAKVFIGLGGNFAQATPDSPRTFQALSNCDLTVQISTKLNRSHLAHGKDALIL
FT                   PCLGRTDIDIQTEGPQAVTVEDSFSMVHASNGQLQPLSNQMRSEPSIIAGIAAATLGSQ
FT                   PVDWNWLVADYRRIRELIADTIPGFKDFNEKVKNPGGFYLGNSAGARKWNTTSGRANFK
FT                   PNMLPKDLIHERTRATGKLPDLILQSMRSHDQYNTTIYGLDDRYRGVKGQRDVLFANEA
FT                   DIIRLGFKPGQKADIVSLWDDGRERRVKGFTLLAFDIPAGQAAAYYPEVNPLVPLESTG
FT                   DGSHTPTSKFIAIRLEAASETGLIMAKSA"
FT   gene            complement(327352..328191)
FT                   /locus_tag="Pfl01_0280"
FT   CDS_pept        complement(327352..328191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72024"
FT                   /db_xref="GOA:Q3KJN2"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN2"
FT                   /protein_id="ABA72024.1"
FT                   /translation="MNAKRPACAAPALETPAPAASQTYSYSDLPLAESASTALAEEVAL
FT                   AIAYNGISQAVMLVTPTDLEDFIVGFSLGSGIIEDASDIYDLQLSGSGSAQYAQVTIAN
FT                   RAFWNLKQQRRQLAGTSGCGLCGVEAVEQALPDLKVLPGAPLPPIEWLDGLRQRIGAFQ
FT                   PLGQHCGAVHAAVFMNASGELLLGREDIGRHNALDKLIGGLIRQKISTAGGLAIVTSRC
FT                   SLELIQKVLRAGIQTLVSLSAPTGLAVQWARRHNLNLIHLPQKNAPRVYSPEMEKHP"
FT   gene            complement(328284..329171)
FT                   /locus_tag="Pfl01_0281"
FT   CDS_pept        complement(328284..329171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0281"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72025"
FT                   /db_xref="GOA:Q3KJN1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN1"
FT                   /protein_id="ABA72025.1"
FT                   /translation="MDIKQLKFLIALDETRHFGQAAARCHITQPTLSMRLRSLEEELDL
FT                   PLVNRGQRFEGFTAPGERVLAWARTVLAAYDGLQAEAAACRGNLIGTLRLGVVPLSSFD
FT                   ALPLMQRLHAQHPNLRFELSSLSSEQVLEQLANNRIDIGVSYLDRLDGERFESLAFSET
FT                   QMGLLYDQRFFSFGQAPLSWESLIELPLGMLTSGMHFRQSIDHNFHSRGLTPQPLLQTD
FT                   AVHQLLQAVHGGLCCAVMPLDGGLENLTDNLRLQPIENAQTLARLGLIMRRGAPRSALA
FT                   EACFALYQKSPTDA"
FT   gene            329309..329749
FT                   /gene="ygaU"
FT                   /locus_tag="Pfl01_0282"
FT   CDS_pept        329309..329749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaU"
FT                   /locus_tag="Pfl01_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72026"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN0"
FT                   /protein_id="ABA72026.1"
FT                   /translation="MSLLSFVKEAGEKLLDLLTPGNANASEQLKEHISKVGLGNPNVQA
FT                   TVDGDKVTVTGEVASQEEKEKILLAVGNIEGVGSVDDQITVTGPVVAAARFVVVKKGDT
FT                   LSAISLAVYGNANQYNKIFEANKPMLKDVNKIYPGQTLRIPE"
FT   gene            complement(329843..330505)
FT                   /locus_tag="Pfl01_0283"
FT   CDS_pept        complement(329843..330505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0283"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72027"
FT                   /db_xref="GOA:Q3KJM9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM9"
FT                   /protein_id="ABA72027.1"
FT                   /translation="MPSLPWSDIDTVLLDMDGTLLDLHFDNHFWLEHLPQRYAELHGVS
FT                   RAMAEMELQPLFERHAGQLQWYCLDFWSAELKLSVRELKLETAHLIALRPDADTFLDAI
FT                   KRAGKRVVMITNAHRDSLSLKLERIELAPYFERLISSHDYGFPKENPQFWDALQADIGF
FT                   DPARSLFIDDTLPILRSARNFGVAHLLAVKEPDSRKGPKDTGEFAAVEDYRDLITGL"
FT   gene            330594..331160
FT                   /locus_tag="Pfl01_0284"
FT   CDS_pept        330594..331160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0284"
FT                   /product="ADP compounds hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72028"
FT                   /db_xref="GOA:Q3KJM8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM8"
FT                   /protein_id="ABA72028.1"
FT                   /translation="MRQKPTVLAREIVATSRLFCVEELKLRFSNGVERTYERLVGKGAG
FT                   YGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAAERELKEEAGYGA
FT                   RQLEHLTELSLSPGYMSQKIQVVLATDLYEERLEGDEPEPMRVDKVNLRELSTLAQNPN
FT                   FSEGRALAALYLTRDLLTQRGFFQS"
FT   gene            331172..331999
FT                   /gene="cysQ"
FT                   /locus_tag="Pfl01_0285"
FT   CDS_pept        331172..331999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="Pfl01_0285"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72029"
FT                   /db_xref="GOA:Q3KJM7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM7"
FT                   /protein_id="ABA72029.1"
FT                   /translation="MNFPHPLMAPVVELALRAGEAILPFWRADVAVTAKSDDSPVTAAD
FT                   MAAHHVIVAGLTALDPSIPVLSEEDADIPQSVRAGWQRWWLVDPLDGTKEFISGSEEFT
FT                   VNIALIENGRVVFGVVSMPTNGRFYVGGAGLGAWRGDTGGTPVAIQVRDVPGPGEAFTV
FT                   VASRRHSSPEQERLLAGLSASLGELQLANIGSSLKFCLLAEGAADCYPRLAPTSQWDTA
FT                   AAQGVLEGAGGEVLDLNGDAFCYPPRDSLRNAFFLALPAKAAWRSKLLELAHS"
FT   gene            complement(332029..332484)
FT                   /locus_tag="Pfl01_0286"
FT   CDS_pept        complement(332029..332484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72030"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM6"
FT                   /protein_id="ABA72030.1"
FT                   /translation="MKHDSRYLESVLHHDIPLTRDMGLKVLDWQEQQLRLHLPLDANVN
FT                   HKSTMFGGSLYCGAVLAGWGWLHLRLKEEGIEDGHIVIQEGQISYPLPVTGDAIAICPS
FT                   PSATQWKKFLAMYQRYGRARLTLHTRVVNAGSNEDAVTFSGQYVLHR"
FT   gene            complement(332525..333913)
FT                   /locus_tag="Pfl01_0287"
FT   CDS_pept        complement(332525..333913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0287"
FT                   /product="putative sigma-54 interactive two-component
FT                   system, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72031"
FT                   /db_xref="GOA:Q3KJM5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM5"
FT                   /protein_id="ABA72031.1"
FT                   /translation="MTIDNRIQVVLIDDDPHLRQALGQTLDLAGLKILPLSEAKGLAAQ
FT                   LERDWPGVVVSDIRMPGMDGLELLSELHAQDPELPVLLITGHGDVPLAVQAMRAGAYDF
FT                   LEKPFASDALLDSVRRALALRRLVLDNRSLRMALSDRNELSARLVGQSAPMLRLREQIG
FT                   ALAATKADVLILGETGAGKEVVARALHDLSSRRNGPFVAINAGALAESVVESELFGHEP
FT                   GAFTGAQKRRIGKFEFANGGTLFLDEIESMSMDVQVKLLRMLQERVVERLGGNQLIPLD
FT                   IRVIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGEDALMLFQHYADEASAR
FT                   HGLPAHELQPAQRALLLRHSWPGNVRELQNAAERFALGLELALDNTQPDGSPGTSVEIT
FT                   AGGLSEQVENFEKSLIAAELARSHGSVRSLAEALGIPRKTLHDKLRKHGLNFAGSGGHS
FT                   DESE"
FT   gene            complement(333910..335724)
FT                   /locus_tag="Pfl01_0288"
FT   CDS_pept        complement(333910..335724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0288"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72032"
FT                   /db_xref="GOA:Q3KJM4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM4"
FT                   /protein_id="ABA72032.1"
FT                   /translation="MLMTPTLPRRPRWRSLALLALCLAPLLWPLEHLAERYYRSELAGQ
FT                   NRQTLDLYVANLLGTLHRYEVLPQILGDLPALRAVLGAPDDGVTQGNANRLLKNIAAQT
FT                   GAEVMYLMDTSGQTLAASNWDKHDSFVGRNFSFRPYFSEAMAGRLGRFFGLGTTSAKRG
FT                   YFFAAAVRNGEKIIGVLVIKVDLDHTESLWGKTPEQLLVTDHNGVVILTSRPEWRFRAT
FT                   RTLSDAERSAITAIQPYPTREPRPLNLSPTAWLPQTQDIAETGWSVSILAPRTLIDRPV
FT                   RTVVAIGGATLLVVMLLLGLMMQRRRHYLERIAFEAKARRELEGRVAERTSDLEGLNRR
FT                   LKQEVLEREQAQQELVRAQDDLVQAGKLSALGTMSASISHELNQPLAAIRSYAENAEVL
FT                   LDHERTEDARGNLKLISELTGRMASIIAHLRAFARRDRHAPESVALQPALDDALALLAK
FT                   RRRSMDVELIRDLPAATLWVEAGETRLRQVLGNLLANALDALTEKGPPRKLWLSAESTD
FT                   EGVNLYIRDNGPGFCMEALGRASEPFYTTKTRTQGLGLGLAICETLMRAFGGELSFANH
FT                   KQGGALITLRLRAGAPGVSLQPSEDRSA"
FT   sig_peptide     complement(335623..335724)
FT                   /locus_tag="Pfl01_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.641) with cleavage site probability 0.496 at
FT                   residue 34"
FT   gene            complement(335825..336406)
FT                   /gene="rmlC"
FT                   /locus_tag="Pfl01_0289"
FT   CDS_pept        complement(335825..336406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="Pfl01_0289"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72033"
FT                   /db_xref="GOA:Q3KJM3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM3"
FT                   /protein_id="ABA72033.1"
FT                   /translation="MSAIHTCHWKIYMNVITTDLPGVLIIEPKVFGDERGFFYESFNAK
FT                   AFQDATGLDTQFVQDNHSRSQKGVLRGLHYQLENTQGKLVRVTAGEVLDVAVDIRRSSP
FT                   HFGKWVAVRLSADNHRQLWVPEGFAHGFVVLSEFAEFLYKTTDYYNPSSERSIRWDDPD
FT                   LGIDWQLDEAPKLSAKDQAAALLKDADVFS"
FT   gene            336550..339462
FT                   /locus_tag="Pfl01_0290"
FT   CDS_pept        336550..339462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0290"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72034"
FT                   /db_xref="GOA:Q3KJM2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM2"
FT                   /protein_id="ABA72034.1"
FT                   /translation="MSFATLIHRASLPSPQVSVEQARHLLAQHYGLNGTLQALGSQQDL
FT                   NYRVDSDRGRFVLKICRGDYSLVELQAQHAGLKYLAEKGAVKVPRVMAATNGADLLTLD
FT                   VGGESVHVRLLDYIDGQPLTALDHLGHEVVAGFGRLCGEMDLALVGFDHPGLERTLQWD
FT                   ARHASALIEHLLPVIEDERQRTLIAEVAEQARLRLQPLVEKLPVQAIHMDITDDNVVWQ
FT                   RDARRHWRLQGVIDFGDLVRTWRITDLSVTCAALLHHAAGDPFVILPAVQAYHAINPLQ
FT                   HEELLALWPLIVARAAVLVLSGEQQVSIDPGNTYSRDNLTHEWEIFRVATSVPLALMEA
FT                   AILTAVGQALPAIDSEGFAPLLPDLVGREFALIDLGVLSAHFEAGNWEQPGIDQRLLSE
FT                   AAVIHGLAASRYGQYRLSRTRPDSADEPETFPLHVELHVPKGSAVEAPFAGVLHLSADG
FT                   ALRLDGPQLSLRLLGVKPSLHGGAALVKGQVLGSVDGPLIVQLIRGAQLEAPRFCTPTR
FT                   AAAWQALSPSPAALLGLACDAEPELDATTLLARRDASFARTQKHYYVDPPRIERGWRNH
FT                   LIDMQGRSYLDMLNNVAVLGHGHPRMAAVASRQWSLLNTNSRFNYAAVAEFSERLLKLA
FT                   PEGMDRVFLVNSGSEANDLAIRLAWAASGGRDMISVLEAYHGWTVGADAVSTSIADNPK
FT                   ALSSRPDWVHAVTAPNTYRGEFRGPDSAPDYVRSVEQHLAKLDEQKRQLAGFICEPVYG
FT                   NAGGISLPPGYLKKVYEMVRARGGVCIADEVQVGYGRMGHFFWGFEEQGVVPDIITMAK
FT                   GMGNGQPLGAVITRREIAEALEAEGYFFSSAGGSPVSCQIGMAVLDVMEEEKLWENAQV
FT                   VGAHFKARLEALIDQYPLVGAVHGSGFYLGVELIRNRATLEPATEETTLLCDRLRELGI
FT                   FMQPTGDYLNVLKIKPPMVTSRQSVDFFVDMVAKVLEEGL"
FT   gene            339642..340748
FT                   /locus_tag="Pfl01_0291"
FT   CDS_pept        339642..340748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0291"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72035"
FT                   /db_xref="GOA:Q3KJM1"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM1"
FT                   /protein_id="ABA72035.1"
FT                   /translation="MTTLKSTPRADGFYMPAEWAPQTQTWMIWPERPDNWRLGGKPAQA
FT                   AHAAVAKAIARFEPVTVAVSAGQYENARARLDVPNIRVVEMSSDDAWVRDSGPTFVINN
FT                   SGEVRGVNWDFNAWGGFDGGLYSPWNRDSQVGGKILEIERSPRYRTEGFVLEGGSIHVD
FT                   GEGTLITTEECLLNRNRNPHLGREEIEAMLSENLSVDKIIWLPDGLFNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDPQDPNYPRCQAAMKVLESSTDAKGRPFTVHKMPIPGPLFATEEE
FT                   CAGVDPVDGTQERNPSVRLAGSYVNFLIVNGGIIAPSFDDPMDAPAREILQNLFPQHEV
FT                   VMVPGRELLLGGGNIHCLTQQQPAPHKE"
FT   gene            340953..341207
FT                   /locus_tag="Pfl01_0292"
FT   CDS_pept        340953..341207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM0"
FT                   /protein_id="ABA72036.1"
FT                   /translation="MDNVAAHERGESAEMNAEVNVISERTLHPMAVNSESLQIVAHWLK
FT                   SNGTRQIREPDPRRMMIERYPAGLFSEAELEALWDVMEG"
FT   gene            complement(341273..343375)
FT                   /locus_tag="Pfl01_0293"
FT   CDS_pept        complement(341273..343375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0293"
FT                   /product="purative iron-transport related exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72037"
FT                   /db_xref="GOA:Q3KJL9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL9"
FT                   /protein_id="ABA72037.1"
FT                   /translation="MRFSMPAPFRLTPVTLGLSAFLSSGFAYSATELPATSISAEAQAD
FT                   DPRVKVSNTATRTSTPVRYVPQAIDSIKTANFANYGTNDLGDALSGMPNVSSGGDTRFD
FT                   SLRIRGFDASNDFYLDGIRDDSQYKRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRVSK
FT                   APEFGRRSTIEAQGGSEDLRSLYADLSTDPSDNISLRLNMGNMDENSFRDGVSGNRQLF
FT                   APSMSWQLTPDLNWLVQYEYSRYNRTPDRGIPGVGGRPADVGRDTTYGNDHDFIDDKTQ
FT                   SLRSKLSYEINDNWQLRHTLGVFKLDSDFDNTYLTGYTPTTKKVTRQHWQQDLTTRNVF
FT                   NNVELEGGFETFGLEHRLLTGLETGSQRRDPTLYNAATSGRGSSAVPSLDLYTPNRDLR
FT                   HTGRMQVSSSSHTEVESRAVYVQDQLRLNDQWQLLAGLRYDTFDIESTNKLRNISEDRD
FT                   SHSTSPRFGVVWTPLQNHSFYASWTKTFSPVGGGLIGITPGAAGNTNDLSPELTKQKEI
FT                   GVKSDWLDDRLSTTLAIYELELYNRRTTDPNDPTLTVLSGLQRSRGIELTGTGKIVGNW
FT                   YLRGGVGVQDATIEKDNNGLEGKRVNNVAKRNGSLFLTWKPEMGWYAETGLTLVGQRYA
FT                   DNANTTVLPGYGRWDALVGYRHKDWDLRGALNNITDREYYSSATSAFQIQPGAPRSLVV
FT                   TGTYSF"
FT   sig_peptide     complement(343286..343375)
FT                   /locus_tag="Pfl01_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 30"
FT   gene            343619..344287
FT                   /locus_tag="Pfl01_0294"
FT   CDS_pept        343619..344287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72038"
FT                   /db_xref="GOA:Q3KJL8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL8"
FT                   /protein_id="ABA72038.1"
FT                   /translation="MTLHYIYDPLCGWCYGAKPLVQAAQQVLPVIAHAGGMMTGANRQS
FT                   VSPQLRNYVMPHDRRIAEYTGQPFGEAYFEGLLRDQSALFDSAPPIAAVMAAEKIDGRG
FT                   LELLGRLQTAHYVEGRRIADESVLVEYAVEQGYNADMFLNALQSVDTEQHIKNSRALLA
FT                   KLGGQGFPTFALEQDGRFTLVDIGPWLGKPEAFAQWLSESFTPAPGTETLPVCGLDGCA
FT                   "
FT   gene            344587..345873
FT                   /locus_tag="Pfl01_0295"
FT   CDS_pept        344587..345873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0295"
FT                   /product="putative family S43 non-peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72039"
FT                   /db_xref="GOA:Q3KJL7"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL7"
FT                   /protein_id="ABA72039.1"
FT                   /translation="MLNKRISLIALGMLSATSAMANDQAESKGFVEDSSLKVLLRNAYI
FT                   NRDYKDGNQDKAEWGQAAIGTFSSGFTQGTVGVGVDAFGLYALRLDGGKGRSGAGGIDF
FT                   FKRGDSGNAADDLSKGGAAVKFRISNTVLTYGDQMPALPVLSYDNVRLLPESYTGTLIT
FT                   SKEIKGLQLDAGRFTAESRKSAEGRDSGGLKSINVLGGSYQFTEQFKAALYASDVEDVL
FT                   KKQYVNANYVFPIDKDQSLTLDFNGYRTKLDNSYVRENGVTGDDNKIWSLAATFATGPH
FT                   SFTVAHQRSTGDSNLGYAYGGYQKGQGRVGDGGNTIYLANSYWSDFNAEDERSWQLGYG
FT                   LDFSAFGVPGLSYNFAYVRGDNITTSTSEGGTEREIFNQFKYVVQSGPAKDLSIKLRSS
FT                   ILRVSQKSSEYNVSGNELRVFVDYPINIF"
FT   sig_peptide     344587..344652
FT                   /locus_tag="Pfl01_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            346106..346852
FT                   /locus_tag="Pfl01_0296"
FT   CDS_pept        346106..346852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72040"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL6"
FT                   /protein_id="ABA72040.1"
FT                   /translation="MIVLTREVGESLRRDKYANVQGADFNLYGHFADFVRLTKSWENME
FT                   PDSYYGQAEAGMRYRRYSDFEYNPKTRELKQLEHRAYVQSKANNSYVGGVVRHFQDFSD
FT                   EVISSPVMRSLIDTDFEVYKSVLPEELHDEIWQCQIHQIRIEIKPGKQLEITPEGIHCD
FT                   GYPFSGVHFWGRNNVEGAESRLYDIHEQQLASTTYQEILDTTYFLDRDMRHYVTPARNT
FT                   HSHAMAYRQILAISFSRPGTAFDIVR"
FT   gene            346842..347309
FT                   /locus_tag="Pfl01_0297"
FT   CDS_pept        346842..347309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0297"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72041"
FT                   /db_xref="GOA:Q3KJL5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL5"
FT                   /protein_id="ABA72041.1"
FT                   /translation="MFANQITPIDGVECSTPVVLRRATAKDAQRMERFFRQFDEVSFCE
FT                   WQDAKCLRGVLIQKTTTAYLAFDVEGEIVGAVLGGMLGSRGTINHLAVSLRYRSQGVGQ
FT                   RLVEAASADMKRVGVLRMFLFVDDANLAGKRFWTAQGFCEPHGERTFERDL"
FT   gene            347306..348022
FT                   /locus_tag="Pfl01_0298"
FT   CDS_pept        347306..348022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0298"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72042"
FT                   /db_xref="GOA:Q3KJL4"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL4"
FT                   /protein_id="ABA72042.1"
FT                   /translation="MNETSGSAPLMVDRQPSRTFAEASPVVAGYFTVSFVFGLMAVNAG
FT                   LPLWLPVAMCLFVYAGASQFAALALISSGASLTTIVLTTFLINARHMLMSVYMAKALRA
FT                   LGLSRMERWCYAGGLTDESFAFHSVKLGTGAPVNVRYLIGFNLFCHTSWVIGGLLGALC
FT                   AQYASHLIKYQLDYALTAMMLYVLVSLCNTRNKLIAALAAVVCMGALSLVGSSPFNVFI
FT                   ATFVGCGVGVCLTKRS"
FT   gene            complement(348235..349161)
FT                   /locus_tag="Pfl01_0299"
FT   CDS_pept        complement(348235..349161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0299"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72043"
FT                   /db_xref="GOA:Q3KJL3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL3"
FT                   /protein_id="ABA72043.1"
FT                   /translation="MDSRTLRNLMRIVQTGSLSAAAEHSCLTVQALAAQLNKVEEQFGF
FT                   RLFRRSNKGLTLTPQGTELTPYMDRVLIATRQMEEKVEALKVPGQRTLKVALNTTLAPD
FT                   FNRRLIGRLIEVFPDYQMEFSYAESMENLSKLKNEDFDLAVLIGPQRPGLPSIVLPEVQ
FT                   VQVVGAHCGQENDPLTLLGNKFQVRPAEDCPYSHSFLRFLDAGLGNHENSQRTIYSCSE
FT                   TLTLSLITQMDAVGMVSREAAQKNGLTIFPGFEDFLEVRLAVNNPDLSGQALNDVVDLP
FT                   LHERAERNVRSRPNRHTEKEVFAEIRT"
FT   gene            349541..349759
FT                   /locus_tag="Pfl01_0300"
FT   CDS_pept        349541..349759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0300"
FT                   /product="putative tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72044"
FT                   /db_xref="GOA:Q3KJL2"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL2"
FT                   /protein_id="ABA72044.1"
FT                   /translation="MPFVSVRITRDGVTREQKAQVIAEITETLERVLNKRPDLTHIVIE
FT                   EVDTDNWGYAGITTTEYRRQLAERGQS"
FT   gene            349756..350400
FT                   /locus_tag="Pfl01_0301"
FT   CDS_pept        349756..350400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0301"
FT                   /product="putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72045"
FT                   /db_xref="GOA:Q3KJL1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL1"
FT                   /protein_id="ABA72045.1"
FT                   /translation="MTPTVTIDFVSDVVCPWCALGATALEQAIGNLAGEISVELTYKPF
FT                   ELNPDMPAEGEPAVQHLMRKYGRTAEDVAAGKKMQIERGKAIGFEFDLEKRTHFHNTFD
FT                   AHRLLMWAAQEGRQVALKKILLRAYFRDGDNPNDHPTLIRLATKAGLDAARARKVLAND
FT                   EFASEVRQLQAFYRQHGINSVPALILNGKHLVSGSQSVEYYEQMLKQLAAA"
FT   gene            350434..351144
FT                   /locus_tag="Pfl01_0302"
FT   CDS_pept        350434..351144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0302"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72046"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL0"
FT                   /protein_id="ABA72046.1"
FT                   /translation="MSNSKKTVVITGASQGLGEGMVKAFRELGYNIVATSRSIKPSNDP
FT                   QILTIAGDIGDPATAQRVISEGVARFGRIDTLVNNAGIFVAKPFTAYTPEDYAAVLSVN
FT                   LNGFFYITQLAIAEMEKQGKGHVVNITTSLVDHAIDGVPSVLASLTKGGLNAATKSLAI
FT                   EYAKRGIRVNAVSPGIIKTPMHGEETHEALGALHPVGHMGEIDDIAQAVVYLDNANFVT
FT                   GEILHVDGGQSAGH"
FT   gene            complement(351203..351469)
FT                   /locus_tag="Pfl01_0303"
FT   CDS_pept        complement(351203..351469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72047"
FT                   /db_xref="InterPro:IPR021427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK9"
FT                   /protein_id="ABA72047.1"
FT                   /translation="MTNPHDLKTLGLTHFSFQSNHALFRTTPGVPVATALSHASHLLHI
FT                   SKLLTSDTSAANDPELHACASQYLQELSKALVDDAVKVLSSDP"
FT   gene            351918..352109
FT                   /locus_tag="Pfl01_0304"
FT   CDS_pept        351918..352109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72048"
FT                   /db_xref="GOA:Q3KJK8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJK8"
FT                   /protein_id="ABA72048.1"
FT                   /translation="MMHMKYSEFRRWLKAQGVEFQTGKGSHFKVSLNGKSTVFPDHGAK
FT                   EMGEGLRKSIVKQLGLKD"
FT   gene            352128..352568
FT                   /locus_tag="Pfl01_0305"
FT   CDS_pept        352128..352568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72049"
FT                   /db_xref="GOA:Q3KJK7"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJK7"
FT                   /protein_id="ABA72049.1"
FT                   /translation="MRGSVMFEYALEVHEEPGSVWLSCAEIPEMHAAGDTLEEALDGAI
FT                   DAMETALSIYVDDRRLIPTGDAGEQESDAVLRLPALTAAKVGLWNTLLESGVSKAELAR
FT                   RLGVQRPQVDRLVDFLHHSKIENVERALQQLGRRILLSVEAA"
FT   gene            352739..352900
FT                   /locus_tag="Pfl01_0306"
FT   CDS_pept        352739..352900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0306"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72050"
FT                   /db_xref="GOA:Q3KJK6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK6"
FT                   /protein_id="ABA72050.1"
FT                   /translation="MGVSQSAFAKLIGVSLRTLQDWELGRRHPTGAAQTLLRVASQHPE
FT                   ALRDLQPA"
FT   gene            complement(353031..353106)
FT                   /locus_tag="Pfl01_R0008"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(353031..353106)
FT                   /locus_tag="Pfl01_R0008"
FT                   /product="tRNA-Thr"
FT   gene            complement(353183..353998)
FT                   /locus_tag="Pfl01_0307"
FT   CDS_pept        complement(353183..353998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0307"
FT                   /product="putative methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72051"
FT                   /db_xref="GOA:Q3KJK5"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK5"
FT                   /protein_id="ABA72051.1"
FT                   /translation="MTFISYAQNFEDVRLWRALQYFENGFYIDVGANDPIHDSVTKAFY
FT                   DRGWQGINVEPMPNYYDALRQHRPRDTTLQCVASDQPGELTFYGIPDTGLSTADPVVAQ
FT                   ERKNLGMDVQSLTVNARTLTSICEEHAAERPIHFLKIDVEGHEETVLRGMDFSRFRPWI
FT                   ILIETPWERDHTWEHLVTDAGYTNVLFDGLNSFFLANEHINLKPAFDLPPCNLDNFQLC
FT                   KGHNLAHPVNPALETALQRAEQAEAQLRAMQNSRAWRAVQKLRNVLRRA"
FT   gene            complement(354343..355548)
FT                   /locus_tag="Pfl01_0308"
FT   CDS_pept        complement(354343..355548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72052"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK4"
FT                   /protein_id="ABA72052.1"
FT                   /translation="MLTGEALLARFTALDTFLTAHQALWKPRPFTHLHLPWEASYPELA
FT                   SWLRGRSLEDAENAHNQPAELLNAPEPFGSLAALSLELSAVGELPTHSLEAAGHRLNVD
FT                   VPGRKWQQIEAFASRLSFAAQPRHWLDWCSGKGHLGRRLLGADQQLTCLEYDPALVSSG
FT                   QALSQRHHLHALHVEQDVLAADTALLLNTEHTPVALHACGDLHVRLMQLASAAGCRQLA
FT                   IAPCCYNRISRTEYQALSSAGSRSVLQLSLEDLSLPMSETVTAGARVRRQRDTSMARRL
FT                   AFDLLQRQVRGVDEYLPVPSLPSVWLDKPFADYCHDLAALKELSTVGAPDWVALEAAGW
FT                   QRLAEVRNLELLRGLFRRPLELWLNLDRALFLTEQGYIVRLGTFCEAPLTPRNFLLLAE
FT                   RA"
FT   gene            complement(355559..356248)
FT                   /locus_tag="Pfl01_0309"
FT   CDS_pept        complement(355559..356248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0309"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72053"
FT                   /db_xref="GOA:Q3KJK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK3"
FT                   /protein_id="ABA72053.1"
FT                   /translation="MNWEVIIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSK
FT                   LWYVRALPYAYIFFFRGTPLLVQLFLVYYGLAQFDAVRNSSMWPYLRDPFWCATATMTL
FT                   HTAAYIAEILRGAIQAIPPGEIEAARALGMSRPKALFYIILPRAARIGLPAYSNEVILM
FT                   LKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVMAYVLVRGFKLLERWLR
FT                   VDACQGR"
FT   gene            complement(356245..356940)
FT                   /locus_tag="Pfl01_0310"
FT   CDS_pept        complement(356245..356940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0310"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72054"
FT                   /db_xref="GOA:Q3KJK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK2"
FT                   /protein_id="ABA72054.1"
FT                   /translation="MIIDLYGFGPALFAGALMTVKLALSALCLGLVLGLLGALAKTSPY
FT                   KPLQWLGGTYSTLVRGVPELLWVLLIYFGTVNAMRALGEFLGNPELELSAFAAGVIALG
FT                   LCFGAYATEVFRGAILAIPKGHREAGVALGLSKWRIFTKLIMPQMWRIALPGLGNLFMI
FT                   LMKDTALVSVIGLEEIMRHAQIGVTVSKQPFTFYMVAALMYLGLTVLAMIGMHLLEKRA
FT                   ARGFARSAQ"
FT   sig_peptide     complement(356818..356940)
FT                   /locus_tag="Pfl01_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.830 at
FT                   residue 41"
FT   gene            complement(357019..357765)
FT                   /locus_tag="Pfl01_0311"
FT   CDS_pept        complement(357019..357765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0311"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72055"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK1"
FT                   /protein_id="ABA72055.1"
FT                   /translation="MQNYKKVFLAAAVTLAFSAGAMAETLKMGIEAAYPPFNNKDASGN
FT                   VVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLISSMSITDERKGAVDFT
FT                   DPYYSNKLQFIAPKDKEFKTDKDSLKGKVIGAQRATLAGTFMEDNMPGVEVKLYDTQEN
FT                   AYLDLISGRLDGILADKYVNYEWLKSDAGKAYEFKGDPVEESDKIGIAVRKGDPIREKL
FT                   NAALKEIVADGTYKKINDKYFPFSIY"
FT   sig_peptide     complement(357694..357765)
FT                   /locus_tag="Pfl01_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(357779..358552)
FT                   /locus_tag="Pfl01_0312"
FT   CDS_pept        complement(357779..358552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0312"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72056"
FT                   /db_xref="GOA:Q3KJK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK0"
FT                   /protein_id="ABA72056.1"
FT                   /translation="MAEATPALEIRNLHKRYGQLEVLKGISLTARDGDVISILGSSGSG
FT                   KSTFLRCINLLENPHQGQILVAGEELKLKAAKNGELVAADGKQINRLRSEIGFVFQNFN
FT                   LWPHMSVLDNIIEAPRRVLGQSKAEAIEVAEALLAKVGIADKRHAYPAQLSGGQQQRAA
FT                   IARTLAMQPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMGFARQVSSE
FT                   VVFLHQGLVEEQGSPQQVFENPLSARCKQFMSSNR"
FT   gene            359105..360496
FT                   /locus_tag="Pfl01_0313"
FT   CDS_pept        359105..360496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0313"
FT                   /product="gamma-aminobutyrate:proton symporter, AAT family"
FT                   /note="TC 2.A.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72057"
FT                   /db_xref="GOA:Q3KJJ9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ9"
FT                   /protein_id="ABA72057.1"
FT                   /translation="MSSTQSSNGLEQGLKPRHVTMLSIAGVIGAGLFVGSGHAIAAAGP
FT                   AVLLAYAAAGALVVLVMRMLGEMAVASPDTGSFSTYADRAIGHWAGFTIGWLYWWFWVL
FT                   VIPLEANAAATILHAWFPGVDIWAFALIITMLLTVTNLFSVKNYGEFEFWFALLKVVAI
FT                   IGFIILGVAAIFGFLPNSQVSGVSHIFDTQGFLPNGMGAVLGAILTTMFSFMGTEIVTI
FT                   AAAESKNPGKQISKATNSVIWRIGLFYLVSIFIVVALVPWNDPVLASVGSYQTVLERMG
FT                   IPNAKMIVDIVVLVAVTSCLNSALYTSSRMLFSLGKRGDAPVMSTRTNKSGTPYWAVML
FT                   STGAAFLCTFANYVAPAAVFEFLLASSGAIALLVYLVIAISQLRMRKQRMARGEKIVFS
FT                   MWLFPGLTYAVIAFIVAALTIMLFQDAHRVEILATGLLSLVVVATGLLVARRRKMENRG
FT                   AAVLN"
FT   sig_peptide     359105..359230
FT                   /locus_tag="Pfl01_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.808 at
FT                   residue 42"
FT   gene            complement(360567..361019)
FT                   /locus_tag="Pfl01_0314"
FT   CDS_pept        complement(360567..361019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ8"
FT                   /protein_id="ABA72058.1"
FT                   /translation="MASLNKQQKRAKRAKAKAKQIRMVGRKPLAQDDDLGHLAEPIPEY
FT                   TLAMFSKMRDAEAVSRNEMLLTLLRELAFIIVDHPDLLDMENAENEGMAATHLAADMLI
FT                   DYRMWADGMDRETAQAWLSEPEFISDFGIALDTYGQSVEAQEEKSE"
FT   gene            complement(361026..361439)
FT                   /locus_tag="Pfl01_0315"
FT   CDS_pept        complement(361026..361439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ7"
FT                   /protein_id="ABA72059.1"
FT                   /translation="MASANKQQKRAARAKTKAKQNRTKRAEAPVELDPNDDRIDFESVD
FT                   LTELFKKMIDAEKISQQALCTAFLEDPLLELVYEQEGEEGAMDFILAALIEYRQWSTET
FT                   DEAGALAWIESPDFQKDYVAASDAIAAQTQQKN"
FT   gene            complement(361460..362413)
FT                   /locus_tag="Pfl01_0316"
FT   CDS_pept        complement(361460..362413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72060"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ6"
FT                   /protein_id="ABA72060.1"
FT                   /translation="MNLQSAPPPLGQASDIESEPFHEPAADGYLLGGFTWRHASPDPQR
FT                   PVVIINAATSVRCRHYSRFAAYLFANGFDVIIYDYRGIGESQPKSMRHLQASWTDWGAL
FT                   DFEAMLKRAQREFPGQPIDVVGHSFGGCAAGLGASGQVIRRLVTVGAQFAYWRDYAPGH
FT                   RWRMFGKWHLLMPLVTLLCGYFPGKRLGWLEDTPAGVVRDWSTPAARYERRPSGRTIRN
FT                   LPFANVRAKALAISISDDPYGTIPAIERLLAYFHNAQKTHLRIEPQDIGEQQVGHFAFF
FT                   RSAYQATLWPIALTWLQTGELASDTPGRKIPRSQAL"
FT   gene            362679..363128
FT                   /locus_tag="Pfl01_0317"
FT   CDS_pept        362679..363128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ5"
FT                   /protein_id="ABA72061.1"
FT                   /translation="MKRVLSFVLPVAAAAVLLFPIMAQAASLEPIDSSAVQVQQQEQNG
FT                   VRYLAGGIGEDESKAIQQSAGYNLHMTFAVGMQNQYTADVDVMIQKAPGQTVLTLNQTG
FT                   PLVYVQLPPGKYTVVATRNGETRRDAAEIGGGAARNLVFHWNDNS"
FT   sig_peptide     362679..362756
FT                   /locus_tag="Pfl01_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            complement(363125..363463)
FT                   /locus_tag="Pfl01_0318"
FT   CDS_pept        complement(363125..363463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72062"
FT                   /db_xref="GOA:Q3KJJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ4"
FT                   /protein_id="ABA72062.1"
FT                   /translation="MNQKRTRVPLPHPAPPVKRTDWLMIALGLVLILCIGLIAYETVDG
FT                   LIQGRIGNMARGKRFAVYSLTTQPSSFWFAVAAHCLLALFLSGAAWVLIWLGRTATVAP
FT                   SRRDRQQR"
FT   gene            complement(363599..363674)
FT                   /locus_tag="Pfl01_R0009"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(363599..363674)
FT                   /locus_tag="Pfl01_R0009"
FT                   /product="tRNA-Phe"
FT   gene            complement(363779..364051)
FT                   /locus_tag="Pfl01_0319"
FT   CDS_pept        complement(363779..364051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72063"
FT                   /db_xref="GOA:Q3KJJ3"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJJ3"
FT                   /protein_id="ABA72063.1"
FT                   /translation="MTRTVMCRKYKEQLEGLERPPYPGAKGQDIFEHVSAKAWADWQKH
FT                   QTLLINEKRLNMMNAEDRKFLQGEMDKYFSGEEYAQAEGYVPPAE"
FT   gene            complement(364048..365115)
FT                   /locus_tag="Pfl01_0320"
FT   CDS_pept        complement(364048..365115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0320"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72064"
FT                   /db_xref="GOA:Q3KJJ2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ2"
FT                   /protein_id="ABA72064.1"
FT                   /translation="MRAEQFSTAVLEWFDRHGRHDLPWQQNINPYRVWVSEIMLQQTQV
FT                   STVLNYFDRFMAALPTVEALAAAPEDEVLHLWTGLGYYTRARNLQKTAKIVVSQYGGEF
FT                   PRDVEKLTELPGIGLSTAGAIGSISMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQ
FT                   LWANAERFTPQDRVNAYTQAMMDLGATLCTRSKPSCLLCPLEKGCEAHMLGLETRYPIP
FT                   KPRKAIPQKRTLMPLLANEDGAILLYRRPSSGLWGGLWSLPELDDLDDLQHLAAQHSLE
FT                   LGEQQALPSLVHTFSHFQLSIEPWLVQVQEAGGHVAEADWLWYNLATPPRLGLAAPVKT
FT                   LLERAAAVLNAGEST"
FT   gene            complement(365112..367334)
FT                   /locus_tag="Pfl01_0321"
FT   CDS_pept        complement(365112..367334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0321"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72065"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ1"
FT                   /protein_id="ABA72065.1"
FT                   /translation="MKAFGKILGLVLLGLLLIIVAAGFALTHLFDPNDYKDEIRQIARD
FT                   KAHIELTLNGDIGWSLFPWLGLELHEASVATLAKPAEPFADLQMLGLSVRVLPLLRREV
FT                   QMSDVRVEGLNLRLNRDKNGHGNWEDIGKVPAPAGSTPPATAGEASPATPAPVEKPAQP
FT                   IRLDIDSLTVNNARVEYNDELTGKQFSAESIQLSTGAVHDSTNIPVKATAFLGTNQPVL
FT                   RVRTELNGELRFERALQRYKFEDLKLSGEVAGDPLQGKTVTFAAQGQLLLDKAANVAEW
FT                   TGIKLSVNQLRALGELKANDLDKTPQISGGISIAQFDLAKFVDSIGQTLPAMAEGSLSK
FT                   VELVSRVAATPTSLALDNINLKLDDSSFSGRIAVEDFAKQSLRAVLKADTFNVDRYLPP
FT                   KSEKANNATQVRQAEVASTEADAMAGAGSTPLPEKPSKSAWSTERLFPVERLSKLDVNA
FT                   DLTFGQLTLDKLPIQNAALKATGQGGLLTLENLRGELYNGDFEAKGTLDVRQNAPVLNL
FT                   QTRINRVPVEKILESQGKNPPVKGLVNLTSTVTGSGNSQQALIETLNGNASFVINNGVL
FT                   LNANLEQQLCKGIATLNRKSLSGEPRGKDTPFQELKGNLTFRNGLASNPDLKVRIPGMS
FT                   VNGDGDIDLRVLGMDYRVGIIVEGDTSAMPDPACQVGDKFVGIEWPLRCRGPLELGAKA
FT                   CRVDNERMGQVASKLAGDKLSEKIDEKLGDKVSPELKNALKGLFKR"
FT   sig_peptide     complement(367251..367334)
FT                   /locus_tag="Pfl01_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.876 at
FT                   residue 28"
FT   gene            367689..369353
FT                   /locus_tag="Pfl01_0322"
FT   CDS_pept        367689..369353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0322"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72066"
FT                   /db_xref="GOA:Q3KJJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ0"
FT                   /protein_id="ABA72066.1"
FT                   /translation="MSTTITADGLKADQPGFLSKERIIAKPGFNRWLVPPAALAIHLCI
FT                   GMAYGFSVFWLPLSKALGVTAPVACAPDMSFIAQVFSSQCDWPISMLGWIYTLFFIFLG
FT                   CSAAIWGGWLEHAGPRKAGVVSALCWCGGLLISALGIYTHQIWLMWIGSGVIGGIGLGL
FT                   GYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMSHFASPTGVGVWQSFV
FT                   AMAAIYFVFMIGGALAYRVPPTGWKPEGWTAPAKKASNAMITHRHVHVNVAWKTPQFRL
FT                   VWLVLCLNVSAGIGILGMASPLLQEVFGGKLLGNDLPFGQLDAGQLASIAAIAAGFTGL
FT                   LSLFNIGGRFFWASFSDYLGRKNTYFVFFALGFALYALIPNLGHLGNVALFVAAFCIIL
FT                   SMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLVNYLREYQLSIGVER
FT                   AAAYDITLYILAGLLVLGFLCNLLVRPVADKYFMTDAELAAEQALGHDKGADGSTVLEW
FT                   KAAPGSKPLAIAAWLVVGIPLAWGVWVTLQKTAVLFH"
FT   gene            369562..370155
FT                   /locus_tag="Pfl01_0323"
FT   CDS_pept        369562..370155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0323"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72067"
FT                   /db_xref="GOA:Q3KJI9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI9"
FT                   /protein_id="ABA72067.1"
FT                   /translation="MAERKASVERDTLETQIKASINLDGTGKARFNIGVPFLEHMLDQI
FT                   ARHGLIDLDIECKGDLHIDDHHTVEDVGITLGQAFAQAIGDKKGIRRYGHAYVPLDEAL
FT                   SRVVIDFSGRPGLQMHVPYTRATVGGFDVDLFQEFFQGFVNHALVSLHIDNLRGTNTHH
FT                   QIETVFKAFGRALRMAVELDERMAGQMPSTKGVL"
FT   gene            370155..370793
FT                   /locus_tag="Pfl01_0324"
FT   CDS_pept        370155..370793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0324"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72068"
FT                   /db_xref="GOA:Q3KJI8"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI8"
FT                   /protein_id="ABA72068.1"
FT                   /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLITSDAAVIREADRVV
FT                   FPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLDSSEENDGVDCIGLFP
FT                   GAVKFFGKDLHEDGEHLKVPHMGWNEVKQAVDHPLWHNIPDLARFYFVHSYYIAAGNPR
FT                   QVVGSGHYGVDFAAALAEGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW"
FT   gene            370794..371054
FT                   /locus_tag="Pfl01_0325"
FT   CDS_pept        370794..371054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72069"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI7"
FT                   /protein_id="ABA72069.1"
FT                   /translation="MAVKKSKPPILTLTPEQESEANRKIQRFMEDRFELDLGSFEAAEI
FT                   LELFTREIAPHYYNRAIFDVQTHLKERFESIESDLWALEKN"
FT   gene            371097..371834
FT                   /locus_tag="Pfl01_0326"
FT   CDS_pept        371097..371834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0326"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
FT                   methylideneamino] imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72070"
FT                   /db_xref="GOA:Q3KJI6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI6"
FT                   /protein_id="ABA72070.1"
FT                   /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCR
FT                   RLHLVDLNGAFEGQPVNGEVVTAIAKRYPTLPIQIGGGIRSLETIEHYVKAGVSYVIIG
FT                   TKAVKDPAFVAEACRAFPGKIIVGLDAKDGFVATDGWAEISTVQVIDLAKQFEADGVSS
FT                   IVYTDIAKDGMMQGCNVPFTAALAAATKIPVIASGGIHNLGDIKSLLDAKVPGIIGAIT
FT                   GRAIYEGTLDVAEAQAFCDSYQG"
FT   gene            371844..372614
FT                   /locus_tag="Pfl01_0327"
FT   CDS_pept        371844..372614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0327"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72071"
FT                   /db_xref="GOA:Q3KJI5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI5"
FT                   /protein_id="ABA72071.1"
FT                   /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGA
FT                   DEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSIN
FT                   TAAVFNPEFVGEAAQHFGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWA
FT                   KKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGILE
FT                   GHASAVLAASIFHFGEYTVQEAKAYMSKRGIVMR"
FT   gene            372691..373446
FT                   /locus_tag="Pfl01_0328"
FT   CDS_pept        372691..373446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0328"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72072"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI4"
FT                   /protein_id="ABA72072.1"
FT                   /translation="MIKRLLLALASASVLLINTGHAEESPDTDLVLLTENFPPYNMAKN
FT                   GKNFAQDENINGIATDIVREMFKRAGITYSLTLRFPWERVYKLALENPGYGAFVMARLP
FT                   DREKLFKWVGPIGPDDWVMLAKADSKITLETLNDARKYKIGAYKGDAIAETLTKQGLKP
FT                   VVVLRDQDNARKLVSGQIDLWATGDPAGRYLARQDGVTGLKTVLRFNSAELYLALNKDV
FT                   PDATVARLQAELDQMRKDGVVDEIMGRYL"
FT   sig_peptide     372691..372759
FT                   /locus_tag="Pfl01_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(373427..374815)
FT                   /locus_tag="Pfl01_0329"
FT   CDS_pept        complement(373427..374815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72073"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI3"
FT                   /protein_id="ABA72073.1"
FT                   /translation="MTGIDSNTLSAQRMEPIRFGNLLINFTSEFHRIWDSRGSGSAVGS
FT                   FWRPAPAPDLLPGYFPLGDVAVTGYENVNGNRIVAVVREGEPQGDAPSRSNALSPPTDY
FT                   KRVWKDANSGAAADCTVWRPIPPPGYVAMGLVCSNGRDKPLLNAIRCVREDLVMPATVG
FT                   DLIWDDKGSGARQNFSAWDIEPAQAAAGEIHFAAGTFFGVQSHSKPVNAIVHALRMQLP
FT                   RQSIPAPEAPELSGYGAPPELAPAKVTQTVRIPWFAVNDQLSAGEQLSTSPFYRLERSD
FT                   QYVLVGHGHNTSDLPRPFKWKAVRVQNSQMQQIFSRLTAIEFSTAWSALPSSAPPAIRF
FT                   SAHLYKDFTYCETSASGWDESRPLDIVAMAAKHKAVAVYQIQSIYTLRRADGTHVAVSV
FT                   GYTDDESLYLTEYPPDSDSTLTFTPQLATEPPSSEGHSDSDRDNIGFAPQPTTEEEVAT
FT                   NTVP"
FT   gene            complement(374934..375710)
FT                   /locus_tag="Pfl01_0330"
FT   CDS_pept        complement(374934..375710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0330"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72074"
FT                   /db_xref="GOA:Q3KJI2"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI2"
FT                   /protein_id="ABA72074.1"
FT                   /translation="MSLRLVFVLLCCLAGAAHAEPARPTPQKAYLTLIIDDLGQNLPRD
FT                   RRVLALPGPVTTAIMPDTPHATEFAREAHRAGKVVILHMPMDPATGPFAWHPELPIEEL
FT                   EKRLNAAFKMVPYTAGINNHMGSRMTAQPVAMAWLMGELQRRHKFFVDSRTSAQTVAAQ
FT                   QAQKIDLASVSRDVFLDDERTEAAILTQLQTAISLAHKQGSAVMIGHPYPQTLAVLERE
FT                   LPKLKAQGIEWIDIKQMISVRSNRATAAHGKNGVYR"
FT   sig_peptide     complement(375651..375710)
FT                   /locus_tag="Pfl01_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(375713..377032)
FT                   /locus_tag="Pfl01_0331"
FT   CDS_pept        complement(375713..377032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0331"
FT                   /product="carboxy-terminal processing protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72075"
FT                   /db_xref="GOA:Q3KJI1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI1"
FT                   /protein_id="ABA72075.1"
FT                   /translation="MLHLSRLTSLALTIALVIGAPLAFAAQPAPAVAPAGTAATSKAPL
FT                   PLEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQEST
FT                   SGEFGGLGIEVGAEDGFIKVVSPIDDTPASKAGIQAGDFIVKINGAPTRGQTMTEAVDK
FT                   MRGKIGQKITLTLVRDGGTPFDVTLARAVIQVKSVKAQLLESGYGLIRITQFQVKTGEE
FT                   VSKALAKLRKDNGKKLNGIILDLRNNPGGVLQAAVEVVDHFITKGLIVYTKGRIANSEL
FT                   RFSATGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVVMGTTSFGKGSVQTVLPL
FT                   NNDRALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITNEADSDYFKEADLQGHLGNGN
FT                   GGADKPTGSGGKAKAMPQDDDYQLAQALSLLKGLSITSGR"
FT   sig_peptide     complement(376955..377032)
FT                   /locus_tag="Pfl01_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(377064..378368)
FT                   /locus_tag="Pfl01_0332"
FT   CDS_pept        complement(377064..378368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0332"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72076"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI0"
FT                   /protein_id="ABA72076.1"
FT                   /translation="MLRVLIALALTCLLQPAFADERAQTQQQLDATRQDIAELKKLLGK
FT                   LQEEKSGVQKELKGTETEMGKLEKQVEALQKELKKSESELQRLDAEKKKLQSARTEQQR
FT                   LIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKSFNETLRQLA
FT                   NVEKDIGLQQAQLLVQQSDLDTQREALDKVRKERQQALAKLNDDVKARDQKLAAREQDQ
FT                   ADLSKVLKTIEETLARQAREAEEARQKALIAQQEAEKKRLREAQARADADSDTSDAPRK
FT                   QARPTPGALVSSSGETFGGPFAATRGKLPWPVDGRLLARFGETRGDDARTKWDGVMISA
FT                   SAGSQVHAVHGGRVVFADWLRGAGLLVILDHGNGFLSLYGHNQTLLKSAGDVVKAGESI
FT                   STVGNSGGQDTPALYFAIRQQGHPSDPAQWCRAQG"
FT   sig_peptide     complement(378309..378368)
FT                   /locus_tag="Pfl01_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(378505..380031)
FT                   /locus_tag="Pfl01_0333"
FT   CDS_pept        complement(378505..380031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0333"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72077"
FT                   /db_xref="GOA:Q3KJH9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJH9"
FT                   /protein_id="ABA72077.1"
FT                   /translation="MTTTPKPLVLMILDGFGHSDSPESNAVYAAKKPVLDRLWATVPNG
FT                   LISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVD
FT                   KAVAAGKAVHFMGLLSDGGVHSHQDHLIAMAELAFKRGAEKIYLHAFLDGRDTPPKSAA
FT                   SSIELLDATFQALGKGRIASLIGRYYAMDRDNRWDRVAQAYNLIVDGKGEINAATAQEG
FT                   LEAAYARGESDEFVKATSIGEPVKVEDGDAVVFMNFRADRARELSRVFVEDGFKEFERA
FT                   RQPKVQYVGLTQYAESIPAPAAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFF
FT                   SGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVEAIENQRYDVIVVNYANGD
FT                   MVGHSGVFEAAVKAVECLDTCVGRIVEALEKVGGEALITADHGNVEQMADESTGQAHTA
FT                   HTTEPVPFIYVGKRDLKVREGGVLADVAPTMLKLLGLEKPAEMTGTSILV"
FT   gene            380184..380597
FT                   /locus_tag="Pfl01_0334"
FT   CDS_pept        380184..380597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0334"
FT                   /product="putative rhodanese domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72078"
FT                   /db_xref="GOA:Q3KJH8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH8"
FT                   /protein_id="ABA72078.1"
FT                   /translation="MVAHLIEFATNHYILVGIFVVLLALLLAHTVQGGGKSLSTGELTA
FT                   LVNKEAGVVVDIRPSKDYAAGHIVGAVNIPQDKLAARIGELEKHKAKTIILVDALGQTA
FT                   GTHARELMKAGFTAAKLSGGISSWKGDNLPLVK"
FT   gene            380599..380853
FT                   /gene="grxC"
FT                   /locus_tag="Pfl01_0335"
FT   CDS_pept        380599..380853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="Pfl01_0335"
FT                   /product="glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72079"
FT                   /db_xref="GOA:Q3KJH7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH7"
FT                   /protein_id="ABA72079.1"
FT                   /translation="MSDVIVYSSDYCPYCSRAKYLLANKGVAFEEIKVDGKPQVRAAMA
FT                   QKAGRTSVPQIWIGDTHVGGCDDLYALERAGKLDALLKA"
FT   gene            380911..381396
FT                   /gene="secB"
FT                   /locus_tag="Pfl01_0336"
FT   CDS_pept        380911..381396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="Pfl01_0336"
FT                   /product="protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72080"
FT                   /db_xref="GOA:Q3KJH6"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJH6"
FT                   /protein_id="ABA72080.1"
FT                   /translation="MTDQQNTAASEEETAPQFSLQRIYVRDLSFEAPKSPAIFRQQWDP
FT                   AVALDLNTRQKALEGDFYEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKNLDAASMSHT
FT                   LGAFCPNILFPYARETLDSLVTRGSFPALMLAPVNFDALYAQELQRMQESGETPTVQ"
FT   gene            complement(381462..381917)
FT                   /locus_tag="Pfl01_0337"
FT   CDS_pept        complement(381462..381917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0337"
FT                   /product="putative RNA-methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72081"
FT                   /db_xref="GOA:Q3KJH5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH5"
FT                   /protein_id="ABA72081.1"
FT                   /translation="MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLR
FT                   RAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDAAFVPGDAFIFGPESR
FT                   GLPPEVLDALPGEQRLRLPMREGCRSLNLSNTVAVAVYEAWRQNDFK"
FT   gene            381916..382356
FT                   /locus_tag="Pfl01_0338"
FT   CDS_pept        381916..382356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72082"
FT                   /db_xref="GOA:Q3KJH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH4"
FT                   /protein_id="ABA72082.1"
FT                   /translation="MHGSEGKDDAHSTPQADPRSKLFPRVMASLAIVGVMVGMMIGRLT
FT                   TPDPTVLQQVEVIDDGLAVWFNNEPKLHGEIVDGSVALLFGAEGKPQKGQLKLNGKDVN
FT                   WRTRLSDGGLLLTLVAARPLQGDWAGQAVDDRWRLEIHLREQ"
FT   gene            complement(382767..384203)
FT                   /locus_tag="Pfl01_0339"
FT   CDS_pept        complement(382767..384203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0339"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72083"
FT                   /db_xref="GOA:Q3KJH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH3"
FT                   /protein_id="ABA72083.1"
FT                   /translation="MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLA
FT                   RQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDEAVSLVKRANQHAQEQQGLEVAPALTRTPEIIGEAPAMQEVFRAIGRLSHSNI
FT                   TVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAA
FT                   NLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHVPVKVDVRIIAAT
FT                   HQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKL
FT                   LKSETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNW
FT                   EQALRQWADQALARGQSSLLDSAVPAFERIMIETALKHTAGRRRDAAVLLGWGRNTLTR
FT                   KIKELGMKVDGGDDDEGDEG"
FT   gene            complement(384200..385285)
FT                   /locus_tag="Pfl01_0340"
FT   CDS_pept        complement(384200..385285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0340"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72084"
FT                   /db_xref="GOA:Q3KJH2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH2"
FT                   /protein_id="ABA72084.1"
FT                   /translation="MTISDALHRLLLDNLTTATILLDSELRLEYMNPAAEMLLAISGQR
FT                   SHGQFISELFTESTEALNSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGA
FT                   TLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELP
FT                   EDSLRDYTNVIIEEADRLRNLVDRMLGSNKLPSLALCNVHEVLERVCQLVEAESQGCIT
FT                   LVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRISLRTRAMRQFTIGH
FT                   VRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECD
FT                   SHPGHTTFSIFLPLEQGATST"
FT   gene            complement(385516..386139)
FT                   /locus_tag="Pfl01_0341"
FT   CDS_pept        complement(385516..386139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72085"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH1"
FT                   /protein_id="ABA72085.1"
FT                   /translation="MRRGLIALCLSLIAFGASAEVFTYIDAQGNRVYTDQPRGNAKRVP
FT                   LATSNRMASNPTATAPVKPSMKSAEPPLFHYDMLRVLIPEPDATIRSSAGELIVSVTSE
FT                   PGLQKGHLYRLLLDGQAVGEPGLSPVFPLSNIDRGSHNLSVEILDAQGRTVEKTANQPF
FT                   HMQRISLAQKRQVKPCVSADYGVRPECPLKDKPAEPKNPFLRFF"
FT   sig_peptide     complement(386080..386139)
FT                   /locus_tag="Pfl01_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(386136..386645)
FT                   /locus_tag="Pfl01_0342"
FT   CDS_pept        complement(386136..386645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72086"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH0"
FT                   /protein_id="ABA72086.1"
FT                   /translation="MGRGFFLLLLLIVLPAAAQIYKYTDADGNTVYSDHAPDGVQVQPV
FT                   ALPPLNSVQPQAPNAPSADTATREPARNVYEVLELTGLPTEEALRANNGTFTVSVLIKP
FT                   RLQPPHQLRLLLDDAPYGQPSNVPILQLVNVDRGEHRLAVQVINGETIIQQSPAVVFTV
FT                   QRVHKP"
FT   sig_peptide     complement(386589..386645)
FT                   /locus_tag="Pfl01_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.991 at
FT                   residue 19"
FT   gene            complement(386745..388034)
FT                   /locus_tag="Pfl01_0343"
FT   CDS_pept        complement(386745..388034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0343"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG9"
FT                   /protein_id="ABA72087.1"
FT                   /translation="MKWLRAIALMAGLARSTTGAAEFYEDKPLAHPLIQGLQESSMTLA
FT                   FIKETNGVKGYYCRCDTPGERPQLLDEFGQVNIESVFLMSLDSEDPTRFVLFRQNDRYK
FT                   IYAYKYNANDHLYSRVTRLQPALDRIAEGRKHLDALTIKKALSQITPLNYSLFLEESGI
FT                   PEFDQLDFSQGKLVSFYGQYYDPLSDPTPDDEPYFFKKTYQEKNGRFLTVTFWRWLDQT
FT                   LVEGKRTLYNYRVRRIAWETEPTKFTGSEDGQSVSYDSGSLSAQGAYKQGVRVGPWSSS
FT                   KDEKYSESGNFVEGKREGQWTLYQDGQTLEGEFHNDLREGRWQLLNHDDMEWVATGFQT
FT                   YVHGQLNGLSELTVRGTTERGEYRDDKRQGLWVTRLDNGHTLNVNFVDDVKEGEWREVD
FT                   AKGVPVLIEHYKAGVLSGARENTGAPGAAQ"
FT   sig_peptide     complement(387972..388034)
FT                   /locus_tag="Pfl01_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.974 at
FT                   residue 21"
FT   gene            complement(388163..389569)
FT                   /locus_tag="Pfl01_0344"
FT   CDS_pept        complement(388163..389569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0344"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72088"
FT                   /db_xref="GOA:Q3KJG8"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG8"
FT                   /protein_id="ABA72088.1"
FT                   /translation="MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDALEDDFFEV
FT                   GKMFDGSSIAGWKGIEASDMILLPDDETAVLDPFTEEPTLILVCDIIEPSTMQGYDRDP
FT                   RAIARRAEEYLKTTGIGDTVFAGPEPEFFIFDEVKFKSDISGSMFKIYSEQGSWMSDQD
FT                   VEGGNKGHRPGVKGGYFPVPPFDHDHEIRTSMCNALEEMGLTVEVHHHEVATAGQNEIG
FT                   VKFNTLVKKADETQTLKYVVHNVADAYGRTATFMPKPLYGDNGSGMHVHMSISKDGKNT
FT                   FAGEGYAGLSDTALYFIGGIIKHGKALNGFTNPATNSYKRLVPGFEAPVMLAYSARNRS
FT                   ASIRIPYVNSPKGRRIEARFPDPAANPYLAFAALLMAGLDGIQNKIHPGDAADKNLYDL
FT                   PPEEAKEIPQVCGSLKEALEELDKGRAFLTKGGVFSDDFIDAYIALKSEEEIKVRTFVH
FT                   PLEYELYYSC"
FT   gene            389599..389853
FT                   /locus_tag="Pfl01_0345"
FT   CDS_pept        389599..389853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72089"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG7"
FT                   /protein_id="ABA72089.1"
FT                   /translation="MDALNSGDAGANTLPRQPASQGSKLHASAPAWVFCPKFTLLKVES
FT                   ALKAKISPFNVALKSKNDPFWCVQNLLHINWLNLEQFPL"
FT   gene            389897..391351
FT                   /locus_tag="Pfl01_0346"
FT   CDS_pept        389897..391351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0346"
FT                   /product="[ThiS-adenylate] sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72090"
FT                   /db_xref="GOA:Q3KJG6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJG6"
FT                   /protein_id="ABA72090.1"
FT                   /translation="MKLIVKVFPEITIKSRPVRTKFIRQLAKNIRTVLRDLDPAVVVNG
FT                   VWDNLELETRVTDPKALKEMGERLTCMPGIAHFLQIDEYPLGDFDDITEKCKQHYGDAL
FT                   AGKIFSVRCKRAGKHAFSSMDVEKYVGSKLRRECGAAGIDLKQPEIEVRIEVRDKRLFV
FT                   IHSQHNGIGGYPLGALEQTLVLMSGGFDSTVAAYQILRRGLMTHFCFFNLGGRAHELGV
FT                   MEVAHFIWKKYGSSQRVLFVSVPFEEVLGEILGKVDDSHMGVVLKRMMLRAASSIAERL
FT                   HIDALVTGEAISQVSSQTLPNLSVIDCVTDKLVLRPLIVAHKQDIIDTADQIGTGDFAR
FT                   HMPEYCGVISVNPKTAAKRGRVEHEEQEFDMAVLERALANARLVPIDRVIDELGQDLQI
FT                   EEVSEALAGQIVIDIRHPDAAEDDPLELAGIEVQTMPFYAVNARFKELDPTRQYLLYCD
FT                   KGVMSRLHAHHLLSEGHANVRVYRPS"
FT   gene            391491..393311
FT                   /locus_tag="Pfl01_0347"
FT   CDS_pept        391491..393311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0347"
FT                   /product="putative elongation factor/GTP-binding protein
FT                   TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72091"
FT                   /db_xref="GOA:Q3KJG5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG5"
FT                   /protein_id="ABA72091.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERNELNDERVMDS
FT                   NDQEKERGITILAKNTAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDG
FT                   PMPQTRFVTKKAFEAGLRPIVVINKVDRPGARPDWVLDQIFDLFDNLGATEEQLDFQVV
FT                   YASALNGIAGLDHTAMGEDMTALYQAVVDHVPPPAVDRDGPFQMQISALDYNSFLGVIG
FT                   VGRIARGRVKPNTPVVAISADGKRRNGRILKLMGHHGLHRVDVEEAAAGDIVCISGFDE
FT                   LFISDTLCDINNVEAMKPLTVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKDRLDKELL
FT                   YNVALRVEEGDSADKFKVSGRGELHLSVLIETMRREGFELALGRPEVIIREVDGVKQEP
FT                   FENVTIDIPEESQGKVMEEMGLRKGDLSNMVPDGKGRVRLEYNIPARGLIGFRNQFLTL
FT                   TNGAGILTSIFDRYAPVKSGHMSGRQNGVLVSVETGKALTYSLETLQARGKLFVEHGQE
FT                   IYNGQIVGQNSRDNDLGVNPTKGKKLDNMRASGKDETIALVPPVRFTLEQALEYIQEDE
FT                   LCEVTPKSIRLRKKILDESERTRAAKKAKA"
FT   gene            complement(393610..394047)
FT                   /locus_tag="Pfl01_0348"
FT   CDS_pept        complement(393610..394047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72092"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG4"
FT                   /protein_id="ABA72092.1"
FT                   /translation="MMKPNLIAAAEIDRLDTWAKYSAPMCGSCVSSCCTLPVEVKIKDL
FT                   VRIGVVDEFELGDPPKNIAKRLQKEGLVERFNQKSGIFTLQRMSNNDCYYLDRKSRLCT
FT                   IYDKRPDTCRNHPKIGPRPGYCAYKPKEVERVQNSRSIERF"
FT   gene            394306..396756
FT                   /locus_tag="Pfl01_0349"
FT   CDS_pept        394306..396756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0349"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72093"
FT                   /db_xref="GOA:Q3KJG3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG3"
FT                   /protein_id="ABA72093.1"
FT                   /translation="MTQEPLVREAEVAAFRDAVLTKLTYAVGKDPDHAFDHDWFEAIAL
FT                   AARDHMVEHWMDHTRQIYRKGQKRVYYLSLEFLIGRLLYDSLSNLGLLDVAREALTELG
FT                   VDLERIRILEPDAALGNGGLGRLAACFMESMSTLGIAGHGYGIRYEHGLFRQAIVDGWQ
FT                   QEQTEHWLDFGNPWEFERPEVVYPIGFGGSVETVTDANGNSRQVWHPAETVRAIAYDTP
FT                   VVGWRGASVNTLRLWRARAMEDLHLERFNAGDHLGAVAEVARAESISRVLYPADSTEAG
FT                   QELRLRQEYFFVAASLQDLLRRHRNMHTSVLTLGDHAAIQLNDTHPSIAVAELMRQLVD
FT                   VYDVAWDAAWQVTVDTLSYTNHTLLPEALETWPVGLMERMLPRHMQIIYLINAQHIDSL
FT                   RAKGIHDFDVLRAVSLIEEDNGRRVRMGNLAFLGSHSVNGVSGLHTQLMRKTVFAELHK
FT                   LYPERINNKTNGITFRRWLYQANPELTSMLVDALGPDVLDNPEERLLDLEPFAEKPAFR
FT                   KAFAEQRLHSKKALAYLIHERLGIAVNPAAMFDVQVKRIHEYKRQLLNLMHTVALYQAI
FT                   RAEPEIDWVPRVKIFAGKAAASYHQAKLIIKLTNDIARVVNNDPTVRGLLKVVFLPNYN
FT                   VSLAESIIPAADLSEQISTAGFEASGTSNMKFGLNGALTIGTLDGANVEMCENIGAEHM
FT                   FIFGLSAQQVEARKQNHEFSAVPDIAASHRLNDVLQAIRSGVFSPDDTSRYTGLIDSLV
FT                   DYDRFFVCADFDSYWEAQMRVDAHWHDANNWWRSAVLNTSRMGWFSSDRTIREYATDIW
FT                   KALE"
FT   gene            396859..400455
FT                   /locus_tag="Pfl01_0350"
FT   CDS_pept        396859..400455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0350"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72094"
FT                   /db_xref="GOA:Q3KJG2"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG2"
FT                   /protein_id="ABA72094.1"
FT                   /translation="MQWMFMLIGLLLGWLLDESFSDALLGALLGLAIGQAMLIARLGSQ
FT                   AAEQQRQLDHAKIALQGVEQRLFLLEGAPAHSPASPSVAPVSETIVEPVTVFEQPAAAE
FT                   PELVWELPPELEPVAVAASASSQPLPVDVWRLDAVTPEPEPRQPAEPRGPNLIERGISA
FT                   ARNWLFGGNTVLRVGVVLLFFGLAFLLRYATEGMVVPIELRYAGVAAAALGLLALGWWL
FT                   RHRNNSYALMLQGTGIAVLYLTVFAAMRLHPLLDPSAALGLLVAVTVFSAILAITQDSL
FT                   ALACVAALGGFAAPILTSTGAGNHVALFSYFALLNAGILAIAWFKAWRLLNLIGFVGTF
FT                   GIGFAWGLRSYTPELLWSTEPFLILFFLMYLAIGLLFARRKLLDMPDAPADDDREALLH
FT                   WSARKGDYVDGTMLFGPPLVGFGLQFALVQHLEFAAAFSALALGMIYMALAKVLMGGRA
FT                   LLLGETCLALGVIFASLAIPLGLDARWTSAAWAVEGAGIFWLGLRQQRPLARAFALLLQ
FT                   LGSALAFLSQLRVGESSLLDGAPLGALMLGAALLFSFYQLRKASPEQTSPWERQGLPVL
FT                   ACLGLTFLYLLASLFFFIQGTAISWALAGLATLFVGLRLQSRTFLFTAFAVQLLGGALF
FT                   LLRLQGAGEDSAAVFSAGWSGLLSASLIGLALIAGMLLAARDEMVRSDVRLLRGLSVVL
FT                   LAGLVLINLAVLFVLPWQTASAVWAASGLLIIWLSLYLKQRVSFVFGLLLQLIGGAAFL
FT                   LAGPELLGLLSSEGLRPLAHGGFWTPLVLGLAAMIGAWRLQLGNHASAFDVLSLQRLSE
FT                   VLLVWGAGWWALAWVSEVLRFAPQNLQATLLLLVAALSVALWTLLALRLKWPSLGLLCT
FT                   VLIPAAGLVLLGAWHSRYHPAADFGWLVWAAVFVVHFISLRRLAPMLPARALSTAHVLG
FT                   CWLLIGVLALELRYGLLLLSEQYNAWRWLGWAILPSLYLLLMAAPRQWPWPVAAFPREY
FT                   RLYAAAPLAVLMLVWFWLANGVSDGNAEPLPYVPLLNPLELGLLFALFGVYVWSRSAVA
FT                   ELSIRQDYAAYATQLIAGVSLFAFCTALVTRAAHHWAGIPFELDLLLESMLVQAGLSIV
FT                   WTLMALGLMIGGHLRHRREVWLIGAALIALVVAKLIFVELSNRGGLARIVSFIGVGVLL
FT                   LVVGYFAPLPPKRVDAAPAADKPAPETEGVSS"
FT   gene            400452..401816
FT                   /locus_tag="Pfl01_0351"
FT   CDS_pept        400452..401816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0351"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72095"
FT                   /db_xref="GOA:Q3KJG1"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG1"
FT                   /protein_id="ABA72095.1"
FT                   /translation="MSRKLNFGWLLLGVAMTAGAQEKPADFAAQVPLSVSGAGPWYRLE
FT                   LPLNVQLQARQTDLSDLRVFNAAGEPQAYALARESAQTRDDGQLHEVKWFPLYNSADAT
FT                   ERAPSVRVQSTTTGTLVEVQPSSQLEAGEEVLRGWLLDASAIKAPLQQLFLDWTSERDG
FT                   FQRFSIEASDDLQHWQAWGEGQVARLTFADERVEQHEVALPGQSARYLRLLWDSPASAP
FT                   VLTSAQLKSSDPRNLPLPLVWSPALAGSSGKPGEYTWQLPMGLNIERVQVELKQANSLA
FT                   PVTLSGRRESSLPWQAISSGLLYRLTQNGQDVVQNELQLYGQTVQQLKLTVDERGGGLG
FT                   EQAPSVKYAVRATQVIFLARGDGPYSLALGSPTVKTANLPLTTLIPDFKPEKLATLGKA
FT                   TVQGEALATQTSTATTAATTDTHWKRFGLWAVLLLSVLFLAAMAFSLLRKPPAKS"
FT   sig_peptide     400452..400514
FT                   /locus_tag="Pfl01_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.857 at
FT                   residue 21"
FT   gene            402012..403022
FT                   /locus_tag="Pfl01_0352"
FT   CDS_pept        402012..403022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0352"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72096"
FT                   /db_xref="GOA:Q3KJG0"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJG0"
FT                   /protein_id="ABA72096.1"
FT                   /translation="MSRVTLSRYLIEQTRSNNTPADLRFLIEVVARACKEISHAVSKGA
FT                   LGGVLGSMGTENVQGEVQKKLDVLSNEILLEANEWGGHLAGMASEEMDNAYQIPGKYPK
FT                   GAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPNEYLSQNEALDEKAFLQPGTQQVAAGY
FT                   AIYGPQTMLVLTLGHGVKGFTLDREMGSFVLTHEDITIPESTQEFAINMSNQRHWEAPV
FT                   QRYVSELLAGEEGPLKKNYNMRWVAAMVADVHRILTRGGLFMYPRDSREPSKPGKLRLM
FT                   YEANPMSFLVEQAGGASTDGHQRILDIKPEGLHQRVAVFLGSKEEVARATAYHKE"
FT   gene            403026..403628
FT                   /locus_tag="Pfl01_0353"
FT   CDS_pept        403026..403628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72097"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF9"
FT                   /protein_id="ABA72097.1"
FT                   /translation="MTAPWQPLLDWWFGHAESATEVTAQQGGLWFGKKDSQDLEARERF
FT                   GVFVDQALAGELSEWTQRPEGWLALVLLLDQLPRMIFRDTSKAFSGDLRAQKLVAQGIA
FT                   ADFDRQLKPIQRLFIYLVFEHCENLAVQNEAVSRFIELVAEQPEAERGVFADNLDYAER
FT                   HQRVIARFGRFPHRNAVLGRESTVEELEFLKEPGSRF"
FT   gene            complement(403832..405724)
FT                   /locus_tag="Pfl01_0354"
FT   CDS_pept        complement(403832..405724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0354"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72098"
FT                   /db_xref="GOA:Q3KJF8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF8"
FT                   /protein_id="ABA72098.1"
FT                   /translation="MTRNMKFSHKILLAAALVVAVAFACFILFNDYRQREALQSSTEAS
FT                   MQELGSLTTSNIQTWLESRIQLLQSMSQQVVADGNAPASLKRIIDLPAYTGNFQLSYFG
FT                   GADGVMFSVPAGNRAPDYDPRARGWYKAANAAQQTIVTEPYIAASSGKLVITVATPVQR
FT                   QGQMIGVAGADIDLSSVSAIINSLNFGGHGHAFIVSADGKILIHPDSKLVLKTLAEAYP
FT                   NGAPNVSPGLKEVEFDGKTQLISFTRVNGVPSADWYVALVLDKDTAFSMLSEFRTSALI
FT                   AMVIAVVIIIALLGMLIRVLMQPLLTMGRAMHDIAEGEGDLTKRLTIHGHDEFGALGLS
FT                   FNRFVERIHTSIREVSSATGQVNEVALRVVAASNSSMFNSDQQASRTNSVAAAINQLGA
FT                   AAQEIAQNAALASQHSSDARSLAEDGQQVVDKTIHAMQQLSAKISDSCGNIETLNSNTV
FT                   NIGQILEVITSISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQDSAQQVQ
FT                   KMIEELQVGARQAVGIMTESQRESESSVGIANQAGERLGSVTQRIGEIDGMNQSVATAT
FT                   EEQTAVVESINVDINEINTLNQEGVENLQATLRACADLEQQAARLKQLVGSFRI"
FT   sig_peptide     complement(405650..405724)
FT                   /locus_tag="Pfl01_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 25"
FT   gene            406007..406261
FT                   /locus_tag="Pfl01_0355"
FT   CDS_pept        406007..406261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0355"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF7"
FT                   /protein_id="ABA72099.1"
FT                   /translation="MSLRSIALLSFCVLLAACSKVNQENYSKLSAGMAKAEVETLLGKP
FT                   TDCSGALGMSSCTWGDKNSFISVQYAGDKVLMFSGQGLK"
FT   sig_peptide     406007..406078
FT                   /locus_tag="Pfl01_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.748 at
FT                   residue 24"
FT   gene            406293..406862
FT                   /locus_tag="Pfl01_0356"
FT   CDS_pept        406293..406862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0356"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72100"
FT                   /db_xref="GOA:Q3KJF6"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF6"
FT                   /protein_id="ABA72100.1"
FT                   /translation="MKRLLLVLLAGLVLVGCATSGEDPLAPKTVNSVNLKRYQGTWYEL
FT                   ARLPMYFQRNCAQSEARYSLKPDGNVAVYNRCLTADWTWEEVKGTAYPQVPAKTDKLWV
FT                   EFDTWFSRLIPGVAKGQYWVLYVSDDYKTALVGDPSRRYLWLLSRTPTVNGVVREELLS
FT                   KARQQGYDTTRLIWRTSDQQMAKTSN"
FT   sig_peptide     406293..406355
FT                   /locus_tag="Pfl01_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.717 at
FT                   residue 21"
FT   gene            complement(407000..408364)
FT                   /locus_tag="Pfl01_0357"
FT   CDS_pept        complement(407000..408364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0357"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72101"
FT                   /db_xref="GOA:Q3KJF5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF5"
FT                   /protein_id="ABA72101.1"
FT                   /translation="MSAFFAERALLPNGWANNVRLEVSADGVLTRIQADSTADGAERLS
FT                   GPLLPGMPNLHSHAFQRAMAGLAEVAGNPNDSFWTWRDLMYRLVGKISPDQLGVIARQL
FT                   YIEMLKAGYTSVAEFHYVHHDNNGQPYADPAELALRISQAASSVGIGLTLLPVLYSHSG
FT                   FGGQTPNEGQRRFINSTENYLKLQSRLQPLLAQQKAQSLGLCFHSLRAVTPQQISEVLA
FT                   ASDQQCPVHIHIAEQQKEVDDCLSWSGRRPLQWLYENTEVDQRWCLVHATHANPEEVTL
FT                   MAKSRAIAGLCLTTEANLGDGIFPAVDFLAQGGRMGIGSDSHVSLSVVEELRWLEYGQR
FT                   LRDQRRNRLYGADQPMVGRTLYDAALDGGAQALGQPIGALEVGKRADWIVLDGNDPYLA
FT                   TASGDGILNRWLFAGGDRQVRDVLVNGQWVVREGRHAGEEDSNRAFTQVLRELLG"
FT   gene            408472..409221
FT                   /locus_tag="Pfl01_0358"
FT   CDS_pept        408472..409221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0358"
FT                   /product="histidine utilization repressor GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72102"
FT                   /db_xref="GOA:Q3KJF4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF4"
FT                   /protein_id="ABA72102.1"
FT                   /translation="MPTPPPVSPLAANMGDSPAPLYARVKQMITQQIDSGNWPPHYRVP
FT                   SESELVSQLGFSRMTINRALREMTADGLLVRMQGVGTFVAEPKSQSALFEVHNIADEIA
FT                   SRGHRHTCQVITLEEEAAGSERALALDMREGQKVFHSLIVHYENDVPVQIEDRFVNALV
FT                   APEYLKQDFTLQTPYAYLNQVAPLTEGEHVVEAILAEASECKLLQIEKGEPCLLIRRRT
FT                   WSGRQPVTAARLIHPGSRHRLEGRFHK"
FT   gene            409218..409787
FT                   /locus_tag="Pfl01_0359"
FT   CDS_pept        409218..409787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72103"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF3"
FT                   /protein_id="ABA72103.1"
FT                   /translation="MSEVKVLRAEGYPRMPWKNGGGSTEEITRDAGAGLDGFGWRLSIA
FT                   DIAESGGFSTFAGYQRVITVLQGDGMTLCVDGDDTRPLLPLDPFAFSGESQVSCTLLGG
FT                   AIRDFNLIYSPQRYRARLQWLDGDQRFFSSASTVLVFSVSELLEVTVGDSASQLGRHDC
FT                   LQLDGNTGLTEIAVNAGCCVIELSPH"
FT   gene            410209..411891
FT                   /locus_tag="Pfl01_0360"
FT   CDS_pept        410209..411891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0360"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72104"
FT                   /db_xref="GOA:Q3KJF2"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF2"
FT                   /protein_id="ABA72104.1"
FT                   /translation="MTDNKPTKFRNVEIRAARGNKLTAKSWLTEAPLRMLMNNLDPEVA
FT                   ENPKELVVYGGIGRAARNWECYDKIVESLTNLNEDETLLVQSGKPVGVFKTHSNAPRVL
FT                   IANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHY
FT                   NDNLTGKWVLTAGLGGMGGAQPLAATLAGACSLNIECQQISIDFRLKTRYVDEQAKDLD
FT                   DALARIAKYTSEGKAVSIALCGNAAEILPELVKRGVRPDMVTDQTSAHDPLNGYLPAGW
FT                   TWDEYRARAKTEPAAVVKAAKQSMAVHVKAMLDFQKMGVPTFDYGNNIRQMAQEEGVEN
FT                   AFDFPGFVPAYIRPLFCRGIGPFRWAALSGDPQDIYKTDAKVKELIPDDAHLHNWLDMA
FT                   RERISFQGLPARICWVGLGLRAKLGLAFNEMVRSGELSAPIVIGRDHLDSGSVSSPNRE
FT                   TESMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAA
FT                   ERIARVLHNDPGTGVMRHADAGYQIAIDCAKEQGLNLPMITGK"
FT   gene            411966..413438
FT                   /locus_tag="Pfl01_0361"
FT   CDS_pept        411966..413438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0361"
FT                   /product="putative histidine ABC transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72105"
FT                   /db_xref="GOA:Q3KJF1"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF1"
FT                   /protein_id="ABA72105.1"
FT                   /translation="MAGNTDRAGSKPLIERRSIDYIPEAERHGRLFSQFTLWMGANLQI
FT                   TAIVTGALAVVLGGDVFWSLIGLLIGQLLGGGVMALHAAQGPKLGLPQMISSRVQFGVY
FT                   GAAIPIVLVCLMYLGFTATGTVLSGQALGQLFGVSDTVGILLFASVIVVVTVLGYRVIH
FT                   WIGRIASVIGVIAFVYLFSRLMSQVDVGALLQIRHFSWSSFLLAVSLAASWQIAFGPYV
FT                   ADYSRYLPSKVSSVKTFFAAGAGSVIGAQVAMILGVFAAASANGQFAGHEVAYIVGLGG
FT                   TGATAALLYFSIAFGKVTISTLNSYGSFMCIATIISGFRGHLTVTRMQRLVFVLGIVGA
FT                   ATLIALLGQHSFLGAFKSFILFLLAFFTPWSAINLVDYYCITRERYDVPALADPNGRYG
FT                   RWNLLGISVYVFGVLVQLPFISTKFYTGPLVAALGDVDISWIIGLVLPAALYYVCAKKW
FT                   HGTVPDRLILPVEQDSVVQPKTSGAGRAAAQA"
FT   gene            413509..414477
FT                   /locus_tag="Pfl01_0362"
FT   CDS_pept        413509..414477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0362"
FT                   /product="putative histidine transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72106"
FT                   /db_xref="GOA:Q3KJF0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF0"
FT                   /protein_id="ABA72106.1"
FT                   /translation="MKSNKTLLTTLLSMGLLASAGATQAAGWCESGKPVKFAGLNWESG
FT                   MLLTDVLQVVLEKGYDCKTDSLPGNSITMENALSSNDIQIFAEEWVGRSEVWNKAEKAG
FT                   KVVGVGAPVVGAIEGWYVPRYVIEGDAKRKLEAKAPDLKNIADLGKYSAIFKDAEEPSK
FT                   GRFYNCPAGWTCELDNSEMLKSYGLENSYTNFRPGTGPALDAAVLSSYKRGEPILFYYW
FT                   SPTPLMGQIDAVKLEEKPGVDKTVTIKVGLSKTFHEQAPELVAVLEKVNLPIDLLNQNL
FT                   GRMAKERIESPKLAKIFLKEHPEVWHAWVSEDAAKKIDAAL"
FT   sig_peptide     413509..413586
FT                   /locus_tag="Pfl01_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 26"
FT   gene            414562..415413
FT                   /locus_tag="Pfl01_0363"
FT   CDS_pept        414562..415413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0363"
FT                   /product="putative histidine ABC transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72107"
FT                   /db_xref="GOA:Q3KJE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE9"
FT                   /protein_id="ABA72107.1"
FT                   /translation="MFPESFTFSIADWVNGWVDALVTNYGDVFRHISDTLLWAIVNLEG
FT                   LLRAAPWWLMLAIVGVVAWHATRKVVTTAVIVGLLFLVGAVGLWDKLMQTLALMMVATV
FT                   ISVLIGVPLGILSARSNRLRSVLMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVI
FT                   YAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMA
FT                   LSMVVIASMIGARGLGEDVLVGIQTLNVGRGLEAGLAIVILAVVIDRITQAYGRPRHEV
FT                   SK"
FT   gene            415410..416240
FT                   /locus_tag="Pfl01_0364"
FT   CDS_pept        415410..416240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0364"
FT                   /product="putative histidine ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72108"
FT                   /db_xref="GOA:Q3KJE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE8"
FT                   /protein_id="ABA72108.1"
FT                   /translation="MSNATVSKIEVKNVFKIFGNRAKDALAMVGQGKTKDQVLNETGCV
FT                   VGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGVDILQYDMDAL
FT                   REFRRHKISMVFQSFGLLPHKTVLDNVAYGLKVRGESKQLCAERALHWINTVGLKGYEN
FT                   KYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTI
FT                   VFITHDLDEAVRIGNRIAILKDGRLIQVGTPKEILHSPADEYVDRFVQRRAAVV"
FT   gene            416375..417898
FT                   /locus_tag="Pfl01_0365"
FT   CDS_pept        416375..417898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0365"
FT                   /product="putative histidine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72109"
FT                   /db_xref="GOA:Q3KJE7"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE7"
FT                   /protein_id="ABA72109.1"
FT                   /translation="MSQAEKIVIADAPMRWQDVVAVARHGAQLELSAQTWARIENAQGI
FT                   VQRIVASGERAYGVNTGLGALCNVSLKDEQLSQLSRNTLLSHACGVGPVLADEQTRAIM
FT                   CAAIRNYSHGKSGIHRRVVEALLALLNRGITPQVPSQGSVGYLTHMAHIGIALLGVGNV
FT                   SYRGQVVCAQQALAEEGLQPVQLGAKDGLCLVNGTPCMTGLGCLAIADATRLLQWADVI
FT                   GAMSFEAQRGQIAAFDAEIIALKPHPGMQQVGVNLRALLDGSEVIASSKGIRTQDALSI
FT                   RSIPQVHGAARDQLEHAIKQIETELNGCTDNPLLLGTPDDFRVMSQANPHGQSVALAAD
FT                   LLAIAMAEIGSIAERRLDRLINPHVSGLPAFLVANPGVNSGMMIVQYVAASLCAENRQL
FT                   AQPAVLDNYVTSGLQEDHLSMGTNAALKLHRALENCTQILAIEYLLAAQAFEFLKEQRF
FT                   GAGTDTAWRLLREKVPAYDQDRWLAPDIAAAASVLKDPDLLHNALPNLH"
FT   gene            418016..419548
FT                   /locus_tag="Pfl01_0366"
FT   CDS_pept        418016..419548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0366"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72110"
FT                   /db_xref="GOA:Q3KJE6"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJE6"
FT                   /protein_id="ABA72110.1"
FT                   /translation="MTALNLIPGQLSLAQLRDVYQNPVKLTLDNSASAQIEASVACVEQ
FT                   ILAENRTAYGINTGFGLLASTRIASEDLENLQRSLVLSHAAGVGQPISDELVRLIMVLK
FT                   VNSLSRGFSGIRRVVIDALIALINAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKA
FT                   RHKGEWMDATEALKVAGLTPLTLAAKEGLALLNGTQVSTAFALRGLFEGEDLFAGALAL
FT                   GGLTVEAVLGSRSPFDARIHAARGQKGQIDAAAAYRDLLGERSEVSDSHQNCEKVQDPY
FT                   SLRCQPQVMGACLTQFRQAAEVLAIEANAVSDNPLVFAAEGDVISGGNFHAEPVAMAAD
FT                   NMALAIAEIGSLSERRISLMMDKHMSQLPPFLVANGGVNSGFMIAQVTAAALASENKAL
FT                   SHPHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGILAVEWLAAVQGLDLRNGLKT
FT                   SAKLEQARGILRREVPFYEKDRFFAPDINAATELLASRILTELVPAKLLPSL"
FT   gene            419775..420980
FT                   /locus_tag="Pfl01_0367"
FT   CDS_pept        419775..420980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0367"
FT                   /product="putative imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72111"
FT                   /db_xref="GOA:Q3KJE5"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJE5"
FT                   /protein_id="ABA72111.1"
FT                   /translation="MKTLWQHCHVATMAQGVYSIIEDAAIVTSGALIEWIGPRSQLPSG
FT                   EYPAVNDLQGAWVTPGLIDCHTHTVFGGNRSGEFEKRLQGVSYAEIAAAGGGIASTVRA
FT                   TREASEDELFASAAKRLKSLMRDGVTTVEMKSGYGLDLASERKILRVIRRLAAELPISV
FT                   RSTCLAAHALPPEYQDRADDYIDHICAEMLPALAAEGLVDAVDAFCEYLAFSPEQVERV
FT                   FIAAQKLGLPVKLHAEQLSSLHGSSLAARYHALSADHLEFMDEADAIAMAESDTVAVLL
FT                   PGAFYFLRETRLPPMEALRKHKVKIAIASDLNPGTSPALSLRLMLNMACTCFRMTPEEA
FT                   LAGATIHAAQALGMAETHGSLEVGKVADFVAWQIDRPADLAYWLGGELDKRVVRHGVES
FT                   SL"
FT   gene            420991..421791
FT                   /locus_tag="Pfl01_0368"
FT   CDS_pept        420991..421791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0368"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72112"
FT                   /db_xref="GOA:Q3KJE4"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE4"
FT                   /protein_id="ABA72112.1"
FT                   /translation="MDKVLNFKQGRVPLLISMPHAGVRLTPAVEAGLIADAKSLPDTDW
FT                   HIPQLYDFAAELGASTLAAEYSRFVIDLNRPSDDKPLYAGATTGLYPATLFDGIPLFKE
FT                   GQEPSKEERATYLEQIWTPYHRTLQEELARLKAEFGYALLFDAHSIRSVIPHLFDGKLP
FT                   DFNLGTFNGASCDPQLATQLEAICARHAAYSHVLNGRFKGGHITRHYGNPAENIHAVQL
FT                   ELGQCTYMEEFEPFRYRADLAEPTRVVLKELLEGLLAWGKNHYN"
FT   gene            421913..422929
FT                   /locus_tag="Pfl01_0369"
FT   CDS_pept        421913..422929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0369"
FT                   /product="putative glycine betaine/L-proline-binding
FT                   protein ABC transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72113"
FT                   /db_xref="GOA:Q3KJE3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE3"
FT                   /protein_id="ABA72113.1"
FT                   /translation="MFRPRCKKTPIRTIIRCRTRRSLMKKLFTRCALILTGSALLSAGA
FT                   MASDDASCKTVRMGVVNWTDVIATSGMADVLLNGLGYESKQTSAVQQIIFAGIRDKRLD
FT                   IFLGYWKPAMDKNIAPFLAANQVKVMDKPSLADAQATLAVPDYVAAAGLKTFGDIAKFK
FT                   DQLGGKIYGIEPGSGANTTIKTMIETNHFGLKDFKIIESGEAGMLAAVQRAVNRKEFVV
FT                   FVGWTPHPMNINMKITYLTGSEDVYGPNEGAATVSTVTAPDYAERCPNVHRLLENLTFT
FT                   AAQESQLMVPIMERKTPQEVAKTWLREHPEDLQRWLAGVSSFDGKDGVATVQASLKN"
FT   sig_peptide     421913..422056
FT                   /locus_tag="Pfl01_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 48"
FT   gene            422929..423846
FT                   /locus_tag="Pfl01_0370"
FT   CDS_pept        422929..423846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72114"
FT                   /db_xref="GOA:Q3KJE2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE2"
FT                   /protein_id="ABA72114.1"
FT                   /translation="MGTYPLSPSMAAFVARTESFASDDSSLGGLRKSYDDMCRAFTPER
FT                   PAGLEVVDFQLSGVAVRSYRPPVRPSASGWPCVLYLHGGGWVVGGLDSHDFICCELAMA
FT                   LGAMVVVVDYRLAPEHPFPAGFEDCLSVWRALRSGPFWFDPGRMLVAGDSAGGNLAAAL
FT                   CLALRDAGEPLPGAQVLIYPGLGGDAQLPSRSECADAPLLASSDVDCYHALYLRGTAKP
FT                   NAYAMPLLAGDFSGLPPAWIAVAQFDPLRDDGVCYAERLDAAGVDAALYYGEGLVHGCL
FT                   RARHQVAEVDRLFENLLGFMADKM"
FT   gene            423951..424922
FT                   /locus_tag="Pfl01_0371"
FT   CDS_pept        423951..424922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0371"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72115"
FT                   /db_xref="GOA:Q3KJE1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE1"
FT                   /protein_id="ABA72115.1"
FT                   /translation="MQTLFPQIKPHARHDLAVDDTHTLYVDESGSPEGLPVVFIHGGPG
FT                   AGCDAQSRRYFDPNLYRIVTFDQRGCGRSTPHASLENNTTWDLVEDLERIRKHLGIDKW
FT                   VLFGGSWGSTLALAYAQTHPERVHGLILRGIFLCRPQEIEWFYQAGASRLFPDYWQDYL
FT                   APIPLDERDDLLSAFHKRLTGNDQIAQMHAAKAWSTWEGRTATLRPNPLVVDRFSEPQR
FT                   ALSIARIECHYFTNNAFLEPNQLIRDMGKIAHLPGVIIHGRYDVICPLDNAWELHQAWP
FT                   NSELQVIRDAGHAASEPGITDALVRAASKMARRLLDLPPEEA"
FT   gene            424919..425356
FT                   /locus_tag="Pfl01_0372"
FT   CDS_pept        424919..425356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0372"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72116"
FT                   /db_xref="GOA:Q3KJE0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJE0"
FT                   /protein_id="ABA72116.1"
FT                   /translation="MKGLLQRVKGARVEVAGEVVGSVDQGLLVLVAVEPDDTPASADKL
FT                   LHKLLNYRVFSDAEGKMNLSLADVGGGLLLVSQFTLAADTKSGLRPSFSTAAPPALGEK
FT                   LFDYLLSRAKQMHGTVASGRFGADMQVHLVNDGPVTFLLQT"
FT   gene            425678..427492
FT                   /locus_tag="Pfl01_0373"
FT   CDS_pept        425678..427492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0373"
FT                   /product="glucans biosynthesis protein G precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72117"
FT                   /db_xref="GOA:Q3KJD9"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD9"
FT                   /protein_id="ABA72117.1"
FT                   /translation="MIVSPCNAAKLSAKRLRSALVAGSAVLCLLSAGQLWAFNLDDVSA
FT                   KAKELAGQKFEAPRSNLPNEFREMKFADYQKIRFRTEKAEWADQKTPFKLSFYHQGMHF
FT                   DTPVKINEITANTVEEIKYDPSRFDFGDLQFDPKATEQLGYAGFRVLYPINKADKQDEI
FT                   MTMLGASYFRVVGKGHTYGLSARGLAIDTALPSGEEFPRFREFWIQQPKPGDKHLVIFA
FT                   LLDSPRATGAYRLILRPGSDTIVDVKGQMYLRDKVGKLGIAPLTSMFLFGANQPSKVLN
FT                   YRRELHDSSGLSIHAGNGEWIWRPLNNPKHLAVSQFSVENPRGFGLLQRGRDFSHYEDL
FT                   DDRYDKRPSAWIEPKGDWGKGTVDLVEIPTADETNDNIVAFWNPEKLPEPGQPLDFAYR
FT                   MHWTIDEAALHAPDSAWVNQTLRSTGDVKQSNLIRQPDGSVAYLVDFEGPSLAALAPDA
FT                   DVRSQVSVGDNAELVENSVRYNPETKGWRLTLRMKIKDPSKSTEMRAALVQPVVTADLA
FT                   KSSVPTSNSSVAKADKVAAKQQEKADKEAKAAEAKQADAKPVADAKDKANKDAKQPAAA
FT                   DAAPATPESAPTEEVLTETWSYQLPADE"
FT   sig_peptide     425678..425791
FT                   /locus_tag="Pfl01_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 38"
FT   gene            427485..430055
FT                   /locus_tag="Pfl01_0374"
FT   CDS_pept        427485..430055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0374"
FT                   /product="glucans biosynthesis glucosyltransferase H"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72118"
FT                   /db_xref="GOA:Q3KJD8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD8"
FT                   /protein_id="ABA72118.1"
FT                   /translation="MSNSQVQPETLSEYLAHLPMTDEQRAELAGCQSFSELHERLSSKT
FT                   FDAPTEAAQASVGKRLILSTAEELQDAEMLVLDASGRVSMKATPPIRRTKVVPEPWRTN
FT                   ILVRGWRRLTGRTNPPQPPKDANVLPAARWRTVGSIRRYILLVLMLGQTIVAGWYMKGI
FT                   MPYQGWSFVDLEEVLHQPLLQTATQVLPYALQTSILIMFGILFCWVSAGFWTALMGFLE
FT                   LLTGHDKYRISGKSAGNEPIPKDARTALVMPICNEDVPRVFAGLRATFESVAATGDLDR
FT                   FDFFVLSDSNDTDICVAEQQAWLDVCREAKGFGKIFYRRRRRRVKRKSGNLDDFCRRWG
FT                   GDYKYMVVLDADSVMSGECLTSLVRLMEATPDAGIIQTAPRASGMDTLYARMQQFATRV
FT                   YGPLFTAGLHFWQLGESHYWGHNAIIRMKPFIDHCALAPLPGKGAFSGAILSHDFVEAA
FT                   LMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAV
FT                   FLTGVMSYLSAPLWFFFLVLSTALLAVNTLMEPQYFLEPRQLYPLWPQWHPDKAIALFS
FT                   TTIVLLFLPKLLSIILIWAKGAKEFGGKFKVTLSMLLEMLFSMLLAPVRMIFHTRFVLA
FT                   AFLGWAATWNSPQRDDDSTPWSEAVKRHGPQTLLGFFWALLVIWLNPSFLWWLVPIVGS
FT                   LMLSIPVSVISSRVGLGLKSRDESLFLIPEEYNPPQALLATDQYTHENRWHALNDGFVR
FT                   AVVDPQQNALACSLATSRHGQAEPIEWLRQERVRHAIKVGPAGLNNHDRLQLLSDPVAL
FT                   ARLHEQVWAEGHAEWLDAWRASVKADPHAPLLPLKPVSLQAQPA"
FT   gene            430418..431215
FT                   /locus_tag="Pfl01_0375"
FT   CDS_pept        430418..431215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0375"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72119"
FT                   /db_xref="GOA:Q3KJD7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD7"
FT                   /protein_id="ABA72119.1"
FT                   /translation="MKKYLSMLLVGVTALVAVNAAQAGAIDDAVKRGSLKVGMDPTYMP
FT                   FEMTNKRGEIIGFEVDILKAMTKAMGVKLELVSTGYDGIIPALMTDKFDMIGSGMTLTQ
FT                   ERNLRLNFSEPFIVVGQTLLIRKELEGTIKSYKDLNTADYRITSKLGTTGEMVAKKLIS
FT                   KAKYHGYDNEQEAVLDVVNGKADAFIYDAPYNVVAVNKVGAGKLVFLDKPFTYEPLAFG
FT                   LKKGDYDSLNFINNFLHQIHEDGTYDRIHDKWFKSTEWLKDME"
FT   sig_peptide     430418..430489
FT                   /locus_tag="Pfl01_0375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 24"
FT   gene            431365..432324
FT                   /locus_tag="Pfl01_0376"
FT   CDS_pept        431365..432324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0376"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72120"
FT                   /db_xref="GOA:Q3KJD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD6"
FT                   /protein_id="ABA72120.1"
FT                   /translation="MKQKKAQWPWHVLTVLVLVGLAGALYYATSLMSYEWRWNRVPQYF
FT                   AYQAEETQRATDISTVSELVRKGGSAQVTLRNDAGDEQHLTVDENSLQFAQGDDVAEGD
FT                   VVGVTRHWAAGPLLWGLWTTLWLSVVSGVLGLLIGLATGLCRLSSNPTLRDLSTIYVEL
FT                   VRGTPLLVQIFIFYFFIGTVMNLSREFAGIAALSLFTGAYVAEIIRSGVQSIARGQNEA
FT                   ARSLGLSAGQSMRHVVLPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVIT
FT                   TSFSPFEILFCVAGLYLLINLPLSKIASRLERRLAQSD"
FT   sig_peptide     431365..431466
FT                   /locus_tag="Pfl01_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.705 at
FT                   residue 34"
FT   gene            432317..433051
FT                   /locus_tag="Pfl01_0377"
FT   CDS_pept        432317..433051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0377"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72121"
FT                   /db_xref="GOA:Q3KJD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD5"
FT                   /protein_id="ABA72121.1"
FT                   /translation="MIEVRDLVKVFDTRGQVVRAVDNVSTRVAKGEVLVVIGPSGSGKS
FT                   TFLRCLNGLEEFDSGSVSIDGLQLADPKTDVNAYRREVGMVFQHFNLFPHMTVLENLCL
FT                   AQKVVRKRGQKESEAKALALLEKVGIAQKAREYPSRLSGGQQQRVAIARALAMDPKVML
FT                   FDEPTSALDPEMVGEVLDVMKNLAVEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDA
FT                   SPAEFFDAPKDPRAQAFLRQVL"
FT   gene            complement(433106..435022)
FT                   /locus_tag="Pfl01_0378"
FT   CDS_pept        complement(433106..435022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0378"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72122"
FT                   /db_xref="GOA:Q3KJD4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD4"
FT                   /protein_id="ABA72122.1"
FT                   /translation="MYRWLAESLGNVSVKRKLGIGFGLVLLLTLLITFTGWTGMSGIIS
FT                   RGDKLGFISSLNELTKDLRLARLDYEARRGEQGPGAVNDLLGKLDSGLQSARGMIEQPS
FT                   DVAMIDQQLAAVAEYKRAFADMTQATVQREDARSKLGASADNAVAKVSEVEKSLLQGDS
FT                   VAQFNSVIELSKLLQQARYQVRGYTYSGKAEAEQPALDAIAAALNNLESLPSKLPEQHI
FT                   ANLQQATESLKAYRAAVSQFRDSQVNNAKAMARMTAQGDILLDVSKKLTESQTIVRDTD
FT                   AAHAKNMLMIATLLALAFGLLAAWAITRQIIIPLEQTLKVAERVAAGDLTHNLVSLRRD
FT                   ELGQLQRSMQSMTQGLRELIGGISDGVTQIASAAEELSAVTEQTSAGVNNQKIETDQVA
FT                   TAMNEMAATVQEVARNAEEASEAAVAADQQAREGDKVVGEAIAQIERLAAEVGHSTEAM
FT                   GELKRESDKIGSVLDVIKSVAQQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRT
FT                   QKSTEEIEELIVGLQNGTQQVATIMDNSRTLTDSSVELTRRAGGSLESITRTVSAIQAM
FT                   NQQIAAAAEQQSAVAEEINRSVLNVRDVSDQTSAASEETAASSVELARLGTHLQTLVGR
FT                   FKV"
FT   gene            complement(435130..435837)
FT                   /locus_tag="Pfl01_0379"
FT   CDS_pept        complement(435130..435837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72123"
FT                   /db_xref="GOA:Q3KJD3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD3"
FT                   /protein_id="ABA72123.1"
FT                   /translation="MNLLLLEEADFIAADRVVLRDRRLTHMQEVHRSEVGDSLRVGCIG
FT                   GLMGSAELLRLDAGEAELRVNLDQPPPAKLPLTLVLALPRPKMLRRVFQTVATMGVSKV
FT                   ILVNSYRVEKSFWQTPFLEPDAIREQLILGLEQARDTVLPEIIIEKRFKPFVEDRLPAI
FT                   TDGTLGLVGHPGNFPPCPRALNEPVTLAIGPEGGWIPYEIDLLAKAGLQPVQLGERILR
FT                   VETAVTALLARLF"
FT   gene            complement(435834..436628)
FT                   /gene="tatC"
FT                   /locus_tag="Pfl01_0380"
FT   CDS_pept        complement(435834..436628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="Pfl01_0380"
FT                   /product="Sec-independent protein translocase protein, TAT
FT                   system, TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72124"
FT                   /db_xref="GOA:Q3KJD2"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD2"
FT                   /protein_id="ABA72124.1"
FT                   /translation="MTGPSLPENDQHMPLVSHLTELRTRLLRCVAAIFIIFAGLFAFTQ
FT                   QIYTFVSTPLREYLPAGATMIATDVSSPFLTPLKLTMMVSLFLAIPVILHQIWGFIAPG
FT                   LYKHEKRVAVPLLISSILLFYTGMAFAYFFVFPLIFKFFASATPAGVEMMTDITSYLDF
FT                   VMTLFFAFGVAFEIPVAVVLLVWIGVVDVKYLKKIRPYVIIGCFVVGMILTPPDIFSQT
FT                   LLAVPMWMLFEVGILFGSLVSKRERPEETADDHNDQPPATQP"
FT   gene            complement(436885..437331)
FT                   /gene="tatB"
FT                   /locus_tag="Pfl01_0381"
FT   CDS_pept        complement(436885..437331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="Pfl01_0381"
FT                   /product="Sec-independent protein translocase protein,
FT                   TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72125"
FT                   /db_xref="GOA:Q3KJD1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD1"
FT                   /protein_id="ABA72125.1"
FT                   /translation="MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWVGRLKRSFNA
FT                   IKQEVEREIGADEIRRQLHNEHILSLEQEARKIFTPVQQEPTPVEHVGEQTIHSPAAPT
FT                   PAAPAVAPTESAPVVAPASVEHVAQTAAPTTPAPNDTTQPPRAP"
FT   gene            complement(437342..437620)
FT                   /gene="tatA"
FT                   /locus_tag="Pfl01_0382"
FT   CDS_pept        complement(437342..437620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="Pfl01_0382"
FT                   /product="putative Sec-independent protein translocase
FT                   protein, TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72126"
FT                   /db_xref="GOA:Q3KJD0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD0"
FT                   /protein_id="ABA72126.1"
FT                   /translation="MGIFDWKHWIVILVVVVLVFGTKKLKNLGTDVGESIKGFRKAMND
FT                   DEKPADPTVTPAQPVPPVQPQATAQANPPHTIDVQAQKVEEPIRKDV"
FT   gene            complement(437646..437978)
FT                   /locus_tag="Pfl01_0383"
FT   CDS_pept        complement(437646..437978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0383"
FT                   /product="putative phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72127"
FT                   /db_xref="GOA:Q3KJC9"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJC9"
FT                   /protein_id="ABA72127.1"
FT                   /translation="MSDTLTRLAQVLEERKGAAADSSYVASLYHKGLNKILEKVGEESV
FT                   ETIIAAKDAAVSGDCSDVIYETADLWFHSMVMLAQLGQHPQAVLDELDRRFGLSGHVEK
FT                   ASRPSA"
FT   gene            complement(437971..438372)
FT                   /locus_tag="Pfl01_0384"
FT   CDS_pept        complement(437971..438372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0384"
FT                   /product="putative phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72128"
FT                   /db_xref="GOA:Q3KJC8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJC8"
FT                   /protein_id="ABA72128.1"
FT                   /translation="MKNWLDEIKWDADGLVPAIAQDHKTGRVLMMAWMNREALELTAAE
FT                   NRAIYWSRSRGKLWRKGEESGHVQTLHEMRLDCDADVIILMVEQIGDIACHTGRQSCFY
FT                   RVFENGDWKTVDPVLKDPHAIYSAGHKHE"
FT   gene            complement(438453..440057)
FT                   /locus_tag="Pfl01_0385"
FT   CDS_pept        complement(438453..440057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0385"
FT                   /product="putative ubiquinone biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72129"
FT                   /db_xref="GOA:Q3KJC7"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJC7"
FT                   /protein_id="ABA72129.1"
FT                   /translation="MKLLAVRRLLRIQRVVIRYRLDDLLFDLPLPWFLLALRYVLPWRW
FT                   FPRKPLELSRGARLRLALQDLGPIFIKFGQILSTRRDLLPEDIADELMRLQDRVPPFDS
FT                   QLSVKLIEEQLGKKISEVFSRFDVEPLASASVAQVHAAQLKTGEEVVVKVIRPGLKPII
FT                   AQDLAWLFILARAAEKVSADARLLHPVDVVSDYEKTIYDELDLLREAANASQLKRNFEG
FT                   SPLLYVPQVYWDWCRPKVLVMERIYGIQVTDLATLADQRTDMKMLAERGVEIFFTQVFR
FT                   DSFFHADMHPGNIFVSTVNPWSPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRV
FT                   AQLHIDSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPDLDLWNTAQPFLERWMRERVSPKALLGNVQSQFEQLP
FT                   HLANMARDLLERMSQPHANDPPPPWKKRKDDWFLRLLGSAHLAGGTILAAGGPLHELGH
FT                   WPAGIMVAVGLYLVVRR"
FT   gene            complement(440054..440677)
FT                   /locus_tag="Pfl01_0386"
FT   CDS_pept        complement(440054..440677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72130"
FT                   /db_xref="GOA:Q3KJC6"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC6"
FT                   /protein_id="ABA72130.1"
FT                   /translation="MLLTGLLASVELGLNRVLRLDSTALPRLAHLTGKVIAVDCRSPAL
FT                   QLFILPSDEGLMLASHWETGVDCTLRAPASSLVKLALSKDKTAVLHAPEVELDGDSGVL
FT                   LELAGVLQDLELDWEYELSRWLGPVATQLVGGHLRSRARWYQQGFASLNQNLAEYLAEE
FT                   SRTLVGQREAEARFSELDRIKLDLERLEARFERLSRSLDPSDNA"
FT   gene            complement(440677..441447)
FT                   /locus_tag="Pfl01_0387"
FT   CDS_pept        complement(440677..441447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0387"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone
FT                   methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72131"
FT                   /db_xref="GOA:Q3KJC5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJC5"
FT                   /protein_id="ABA72131.1"
FT                   /translation="MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMN
FT                   DLLSGGMHRLWKRFAIELSGVRAGNRVLDIAGGTGDLTKKFSHLVGPTGQVVLADINES
FT                   MLKVGRDRLLDVGVSGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLR
FT                   VLKPGGRLLVLEFSKPTNALMSKAYDAYSFAFMPLMGKLITNDSESYRYLAESIRMHPN
FT                   QETLKSMMVDAGFDRVTYHNMTAGIVALHRGIKP"
FT   gene            441613..441888
FT                   /locus_tag="Pfl01_0388"
FT   CDS_pept        441613..441888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72132"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC4"
FT                   /protein_id="ABA72132.1"
FT                   /translation="MAHISVERAHSLGKEAAREKAEKLAQKLSDQYGLEPQWSGDVLNL
FT                   KRSGVKGAVHVAEDSIRVDVELGLMMSAMSGMIKAEIEKALDKALV"
FT   gene            442050..442472
FT                   /locus_tag="Pfl01_0389"
FT   CDS_pept        442050..442472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0389"
FT                   /product="putative polyhydroxyalkanoate
FT                   biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72133"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC3"
FT                   /protein_id="ABA72133.1"
FT                   /translation="MAKVILKKKIDASTSALSDVKSYARKIWLAGLGAYTKVGQEGSEY
FT                   FQELIKAGQTVEKKGKKAVTEKLEAANAEIDEAKSEVSSFKGRVEVQLDKVEKAFDTRV
FT                   ASALNRIGIPSKHDVEALSAKLDELTALLERVARKS"
FT   gene            442483..443361
FT                   /locus_tag="Pfl01_0390"
FT   CDS_pept        442483..443361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0390"
FT                   /product="transcriptional regulatory protein (of PHA
FT                   genes)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72134"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC2"
FT                   /protein_id="ABA72134.1"
FT                   /translation="MAGKKNTDKEGSSWIGKVEDYSRKIWLAGLGVYSKIDTDGSKLFD
FT                   TLVKDGEKAEKLTKAAVGKKVDAAKDSASSAKSRISGVKDRALGTWDQLEGAFDKRLNS
FT                   AISRLGVPSRNEVKDLHKKVDTLTRQIEKLTGLKAQPVAAKTAAAKPAAKAAAKPLAKA
FT                   AAKPAAKAAAKTAAAKPAAKAAAKPVAAKAAAKPAAKPAAKPAAKSAAKPAAKTAAAKP
FT                   AAKPAAKPAAAKKPAVKKPAAPKAAAPKAAAPKPVTTPQALASTSNSASAPTPAPAPTA
FT                   ASTPSTPTSQS"
FT   gene            complement(443464..444084)
FT                   /locus_tag="Pfl01_0391"
FT   CDS_pept        complement(443464..444084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0391"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72135"
FT                   /db_xref="GOA:Q3KJC1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC1"
FT                   /protein_id="ABA72135.1"
FT                   /translation="MKTSERILECALQLFNEKGEPNVSTMEVANEMGISPGNLYYHFHG
FT                   KEPLILGLFERFQNDLAPLLDPPADVELAPEDYWLFLHLIVERLAQYRFLFQDLSNLAG
FT                   RLPKLAKGIRQFLNVLKRTLASLLARLKASGQLVSDTQALGQLVEQITMTLLFSLDYQR
FT                   ILDREGEVRLVVYQIMMLVAPHLLPPVKVATERMALQYLEDHE"
FT   gene            complement(444113..445795)
FT                   /locus_tag="Pfl01_0392"
FT   CDS_pept        complement(444113..445795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0392"
FT                   /product="poly(3-hydroxyalkanoate) polymerase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72136"
FT                   /db_xref="GOA:Q3KJC0"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC0"
FT                   /protein_id="ABA72136.1"
FT                   /translation="MRDKPATGVVPSPAVFINAQSAMTGLRGRDLISTLRSVAAHGLRN
FT                   PIHSAKHALKLGGALGRVLLGETLHPTNPQDSRFADPAWSLNPFYRRSLQAYLAWQKQV
FT                   KSWIDESSMSDDDRARAHFAFTLLNDAVAPSNTLLNPLAVKELFNSGGHSLVRGLSHLI
FT                   DDLLHNDGLPRQVTKQAFEVGKTVATTTGSVVFRNEMLELIQYRPMSEKQYSKPLLVVP
FT                   PQINKYYIFDLSPSNSFVQFALKNGLQTFMISWRNPDVRHREWGLSTYVEAVEEAMNIC
FT                   RAITGAREVNLMGACAGGLTIAALQGHLQAKRQLRRVSSATYLVSLLDSEMNTPATLFA
FT                   DEQTLEAAKRRSYQKGVLDGRDMAKVFAWMRPNDLIWSYFVNNYLLGKEPPAFDILYWN
FT                   NDSTRLPAAFHGDILDFFKHNPLTHPGGLEVCGTPIDLQKVTVDSFSVAGMNDHITPWD
FT                   AVYRSTLLLGGERRFVLSNSGHVQSILNPPGNPKAHYVENGKLSSDPRAWYYDAKKVDG
FT                   SWWPQWLEWVQQRSGTLHETRMTLGNANYPPMEAAPGTYVRVR"
FT   gene            complement(445947..446801)
FT                   /locus_tag="Pfl01_0393"
FT   CDS_pept        complement(445947..446801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0393"
FT                   /product="poly(3-hydroxyalkanoate) depolymerase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72137"
FT                   /db_xref="GOA:Q3KJB9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011942"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB9"
FT                   /protein_id="ABA72137.1"
FT                   /translation="MPHPFIFRTVELDGQTIRTAVRPGKPHLTPLLIFNGIGANLELVF
FT                   PFVAALDPDLEVIAFDVPGVGGSSTPSRPYRFPGLAKLTARMLDYLDYGQVNVIGVSWG
FT                   GALAQQFAYDYPERCKKLVLAATAAGAVMVPGKPKVLWMMASPRRYIQPSHVIRIAPMI
FT                   YGGSFRRDPTLAASHAAKVRSAGKLGYYWQLFAGLGWTSIHWLHKIHQPTLVLAGDDDP
FT                   LIPLINMRMLAWRIPNAQLHIIDDGHLFLITRAEAVAPIIMKFLQEERQRAVMHPHPTP
FT                   LGG"
FT   gene            complement(446870..448549)
FT                   /locus_tag="Pfl01_0394"
FT   CDS_pept        complement(446870..448549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0394"
FT                   /product="poly(3-hydroxyalkanoate) polymerase 1"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72138"
FT                   /db_xref="GOA:Q3KJB8"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB8"
FT                   /protein_id="ABA72138.1"
FT                   /translation="MSNKNNDDLKYQASENTLGLNPVVGLRGKDLLASARMVLTQAIKQ
FT                   PIHSVKHVTQFGLELKNVLFGKSDLQPAGDDRRFVDPAWSQNPLYKRYLQTYLAWRKEL
FT                   HAWIDDSSLSPKDIARGHFVINLMTEAMAPTNTAANPAAVKRFFETGGKSLLDGLSHLA
FT                   KDLVHNGGMPSQVNMGAFEVGKSLGVTEGAVVFRNDVLELIQYKPITEQVHERPLLVVP
FT                   PQINKFYVFDLSPDKSLARFCLRNNVQTFIVSWRNPTKEQREWGLSTYIEALKEAVDVV
FT                   TAITGSKDVNMLGACSGGITCTALLGHYAATGENKVNALTLLVSVLDTTLDSDVALFVD
FT                   EQTLEMAKRHSYQAGVLEGKDMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNN
FT                   DTTRLPAAFHGDLIEMFKNNPLIRPNALEVCGTPIDLKQVTADIFSLAGTNDHITPWKS
FT                   CYKSAQLFGGKVEFVLSSSGHIQSILNPPGNPKSRYMTSDEMTANADDWQENSTKHADS
FT                   WWLYWQAWQAARSGELKKAPTKLGNKAYPAGEASPGTYVHER"
FT   gene            complement(448808..449185)
FT                   /locus_tag="Pfl01_0395"
FT   CDS_pept        complement(448808..449185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72139"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB7"
FT                   /protein_id="ABA72139.1"
FT                   /translation="MTQLPTDIKLHKASKTLSLKYASGEEYTLPAEFLRVHSPSAEVQG
FT                   HGKPILQFGKLHVGLTKVEPAGQYALKLTFDDGHDSGLFTWDYLYELGRRHDALWADYL
FT                   AELKAAGKTRDPDQSVVKLML"
FT   gene            complement(449262..450599)
FT                   /locus_tag="Pfl01_0396"
FT   CDS_pept        complement(449262..450599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0396"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   hslu"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72140"
FT                   /db_xref="GOA:Q3KJB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJB6"
FT                   /protein_id="ABA72140.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRV
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAIKMLREQEMTRVRHRAEDAAEDRILDALLPPARMGFSNEEAPTQDSNTRQLFRKRLR
FT                   EGQLDDKEIEIEVAEMAGIEIATPPGMEEMTNQLQNLFANMGKGKKKARKLKVKEALKL
FT                   VRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLP
FT                   LIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFER
FT                   ILSEPHASLTEQYCALLKTEGLNIQFQPEGIKRLAEIAWQVNEKTENIGARRLHTLLER
FT                   LLEEVSFSAGDLASAHDDKAIQIDAEYVNSHLGELAQNEDLSRYIL"
FT   gene            complement(450655..451233)
FT                   /locus_tag="Pfl01_0397"
FT   CDS_pept        complement(450655..451233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0397"
FT                   /product="ATP-dependent protease hslV"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72141"
FT                   /db_xref="GOA:Q3KJB5"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB5"
FT                   /protein_id="ABA72141.1"
FT                   /translation="MNGHKAFSPRSVETLPLTTIVSVRRHGKVVMGGDGQVSLGNTVMK
FT                   GNAKKVRRLYHGEVIAGFAGATADAFTLFERFEGQLEKHQGHLVRAAVELAKEWRTDRS
FT                   LSRLEAMLAVANKDASLIITGNGDVVEPEDGLIAMGSGGAYAQAAASALLKKTDLSARE
FT                   IVETALGIAGDICVFTNHTQTIEEQDLAE"
FT   gene            complement(451341..452057)
FT                   /locus_tag="Pfl01_0398"
FT   CDS_pept        complement(451341..452057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72142"
FT                   /db_xref="GOA:Q3KJB4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB4"
FT                   /protein_id="ABA72142.1"
FT                   /translation="MAAKKKPAPKRGASRYQAPAKQPIPGWLWMAIGLTVGAFIVFLMK
FT                   LEPGKGSDTVKREKIEQQQQQKATKIAEANKTPPSPTQPVKPKYDFYTLLPESEVIVPP
FT                   DAVPEKTLPTPQVPAIPTTPVTPAEAAKIDTARAQAALAGITPPPAPPVTKAAPVTKFF
FT                   LQAGSFRKETDADKVRAQIILLGQAVAVESGTVKDETWYRVLVGPFSNREQLTTAQKQL
FT                   AGAGFSNLLLQQRQSR"
FT   gene            complement(452059..453795)
FT                   /locus_tag="Pfl01_0399"
FT   CDS_pept        complement(452059..453795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0399"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72143"
FT                   /db_xref="GOA:Q3KJB3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJB3"
FT                   /protein_id="ABA72143.1"
FT                   /translation="MKDTIRQLIQQALTQLVNEGVLPEGLTPAIQVENARDKTHGDFAS
FT                   NIAMMLAKPAGMKPRDLAEKIIAALPADENVTKAEIAGPGFINFFQNTQALASRLDAAL
FT                   ADAHVGVRKAGPAQRTVVDLSAPNLAKEMHVGHLRSTIIGDGVARVLEFLGDTVIRQNH
FT                   VGDWGTQFGMLMAYLQENPITSDELSDLENFYRAAKQRFDESPEFADRARGLVVKLQAG
FT                   DAECLALWTKFKDISLSHCQKIYELLNVKLTMADVMGESAYNDDLINVVNDLKAAGMLV
FT                   ESNGAQCVFLDEFKNAEGEPLPVIIVKADGGYLYATTDLAAVRYRSGKLKADRALYFVD
FT                   QRQALHFQQVFAVARKAGFVTHPMEMEHMGFGTMNGADGRPFKTRDGGTVKLIDLLTEA
FT                   QERAYALVKEKNPTLADDELRSIAKVVGIGAVKYADLSKHRTSDYSFNFDQMLNLEGNT
FT                   APYLLYAYTRVAGVFRKLEKEYSEVDGQIVLEAPQEHDLAAKLAQFGEVLNNVAEKGTP
FT                   HTLCTYLYEVAGLFSSFYEKCPILTAETPAQMQSRLRLAALTGRTLKQGLELLGLETLE
FT                   RM"
FT   gene            complement(453938..456172)
FT                   /locus_tag="Pfl01_0400"
FT   CDS_pept        complement(453938..456172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0400"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72144"
FT                   /db_xref="GOA:Q3KJB2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB2"
FT                   /protein_id="ABA72144.1"
FT                   /translation="MRIPRVPDAILRLALPSPLRRLFDYRAPAGVLRSQLQPGMRLRVP
FT                   FGRREMIGILVEVTDTSEVPVEKLKPALALLDVTAPLPPALFKLCLWTSQYYQHSLGDT
FT                   LSWALPVLLRQGELAEVRQERFWSAAPGASLDDPRIARAPRQREALATLAQHPHGVAHQ
FT                   LLSKLMLSKDSLDLLLAKDLVQVEVRRHAPGARHEHWLAQPELPLNSEQRAAYEAIRAG
FT                   FDSYHAFLLAGVTGSGKTEVYLQLIRETLEAGKQALVLIPEINLGPQTLARFEQRFNAR
FT                   IALLHSAVNDRDRLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIIDEEHDGSYKQQE
FT                   GLRYHARDLALVRARQENIPIVLGSATPSLESLHNAYTGRYGLLRLNERAGGAKQPRFL
FT                   RLDVKSRPLDSGISGPMQQAIGQTLAAGQQVLVFLNRRGFAPTLLCHDCGWMSECQRCD
FT                   ARMTVHQRYGELRCHHCGYVERVPRQCPKCNKVDLRPVGAGTERAEERLAILFPDYPVL
FT                   RVDRDSTSRKDAMNQLFATIQKGQPCILVGTQMLAKGHHFPRVTLVSILDADGGLFSGD
FT                   FRASERMAQLIVQVAGRAGRAEEPGKVIIQTHLADHPLLVQLTEQGYFAFAEQALSERR
FT                   AAGLPPFAHLALLRAEAHKPGQAEGFLDEACSEAERLLAEQNLSGIELLGPVPAPMERR
FT                   AGRFRAQLLLQATARAPLHRLLASWLLVLEQMPSGRAVRWSLDVDPVDLY"
FT   gene            456326..456544
FT                   /locus_tag="Pfl01_0401"
FT   CDS_pept        456326..456544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0401"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72145"
FT                   /db_xref="GOA:Q3KJB1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJB1"
FT                   /protein_id="ABA72145.1"
FT                   /translation="MKADIHPNYPEVAVTCSCGNKFETRSTFGKALAIDVCNECHPFYT
FT                   GKQKTLDTGGRVQKFADRFGAFGAKKA"
FT   gene            456586..457368
FT                   /locus_tag="Pfl01_0402"
FT   CDS_pept        456586..457368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0402"
FT                   /product="putative nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72146"
FT                   /db_xref="GOA:Q3KJB0"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB0"
FT                   /protein_id="ABA72146.1"
FT                   /translation="MKKASLAGAFFVSAIWLSAAQAFCPVPARLDSATVQRVVDGDTLR
FT                   LSDGRNVRMIGLNTPELGKQGRSDEPFAVAARKRLEALVAESDGRVGLRLGAESKDRYG
FT                   RTLAHVFSAKGENIEAQMLADGLGFQVAVAPNVDLVDCQQAAEHRARQAGLGLWKRSPV
FT                   LKAEQIERSGFALVSGRVSKVQRNRGGIWIELQDKLVLRVAPNLLDRFDGAALQALKGK
FT                   QIEARGWVVDRSRRGGLKSGQARWLLPLTDPSMLQPSR"
FT   sig_peptide     456586..456654
FT                   /locus_tag="Pfl01_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.804 at
FT                   residue 23"
FT   gene            457469..458821
FT                   /locus_tag="Pfl01_0403"
FT   CDS_pept        457469..458821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0403"
FT                   /product="putative NADP-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72147"
FT                   /db_xref="GOA:Q3KJA9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA9"
FT                   /protein_id="ABA72147.1"
FT                   /translation="MTGQSCGDFARRVSSLTSLSNSKKRNAKMSDLKTAALEYHANPRP
FT                   GKLSVELTKATATARDLSLAYSPGVAEPVREIARDPELAYKYTGKGNLVAVISDGTAIL
FT                   GLGNLGPLASKPVMEGKGVLFKRFAGIDVFDIEVDSESPQAFIDTVKRISITFGGINLE
FT                   DIKAPECFEIERALIEQCDIPVFHDDQHGTAIVTAAGMINALEIAGKTLADAKIVCLGA
FT                   GAAAISCMKLLVSMGAKVENIFMVDRTGVIHAGRDDLNQYKAVFAHPTEKRTLDDAIEG
FT                   ADVFVGLSGPNLLSAEQLKRMAANPIVFACSNPDPEISPELAHATRNDVIMATGRSDYP
FT                   NQVNNVLGFPFIFRGALDVRAKRINEEMKIAAANALRELAKLPVPQEVCDAYGGISLEF
FT                   GREYIIPKPMDKRLITVISDAVAKAAIETGVATLPYPKNYPLKSVDDVFNG"
FT   gene            complement(459017..461464)
FT                   /locus_tag="Pfl01_0404"
FT   CDS_pept        complement(459017..461464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0404"
FT                   /product="putative penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72148"
FT                   /db_xref="GOA:Q3KJA8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA8"
FT                   /protein_id="ABA72148.1"
FT                   /translation="MIRLLKFFGWSIVAVFCGLLLGLSGAFLYLSPGLPSVEALRSIQL
FT                   QIPLRVYSSDNKLIAEFGEMRRTPIRFADIPPNFINALLSAEDDNFANHYGVDPSSLMR
FT                   AATQLVKSGHIQSGGSTITMQVAKNFFLTSERSFSRKTTEILLALQIERQLTKDEILEL
FT                   YVNKIYLGNRAYGIEAAAQVYYGKSIREVSLAQMAMIAGLPKAPSRFNPLANPARSKER
FT                   RDWILGRMYKLGKITEADYTAAINEPLNASYHVPTPEVNAPYIAEMARAEMVGRYGSDA
FT                   YTEGFRVTTTVPSNLQEMANTALHEGLMTYDQRHGYRGPESRLPGKTREAWATELTKQR
FT                   TISSLEPAIVTQVDKTGLQVLTRTGEEHVAWDTMKWARPFLNTNSMGAAPRQPSDVAQI
FT                   GDLIRVQRQPNNSLKFSQIPQAQGALVSLDPQNGAIRSLVGGFAFEQSNYNRAMQAKRQ
FT                   PGSSFKPFVYSAALDNGYTAASLVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIRLREAL
FT                   YKSRNLVSIRLLQAMGVGKTIDYITRFGFNKQDLPPNLSLALGTATLTPMEIATGWSTF
FT                   ANGGYKITPYIIDKIESRNGDTLFVANPPTVPQGAAATDGIAAPATQAFTVNVAPVPGE
FT                   APGNAAVPQAPAVAERIVDGRTTYILNSMLQDVIKLGTGRRALALGRSDIAGKTGTTNE
FT                   SKDAWFSGYNADYVTTVWTGFDQPESLGRREFGGTVALPIWMNYMAAALKDKPPHVQPE
FT                   PEGILSLRVDPVSGRAASPSTPGAYFELFKAEDTPPSVNEIGNGAVPGSPLPADEQAPI
FT                   DLF"
FT   sig_peptide     complement(461378..461464)
FT                   /locus_tag="Pfl01_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.460 at
FT                   residue 29"
FT   gene            461682..462746
FT                   /gene="pilM"
FT                   /locus_tag="Pfl01_0405"
FT   CDS_pept        461682..462746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="Pfl01_0405"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72149"
FT                   /db_xref="GOA:Q3KJA7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA7"
FT                   /protein_id="ABA72149.1"
FT                   /translation="MLGLFNKKANTLLGIDISSTSVKLLELSRQGERYRVEAYAVEPLP
FT                   ANAVVEKNIAELEGVGQALSRVLVKARTGLKTVAVAVAGSAVITKVIEMDAGLSDDELE
FT                   NQLKIEADQYIPYPLDEVAIDFEVQGVSPRNPERVNVLLAACRKENVEVREAALALAGL
FT                   TARVVDVEAYALERSFGLLATQLAASQDRLTVAVVDIGATMTTLSVLHNGRIIYTREQL
FT                   FGGRQLTEEIQRRYGLTLEQAGLAKKQGGLPDDYVSEVLQPFREALVQQVSRSLQFFFA
FT                   SGQYNAVDHILLAGGTASVPGLDRLIEERLHTPTQVANPFSDMALSSKVNAGALASDAP
FT                   ALMIACGLALRSFD"
FT   gene            462746..463312
FT                   /gene="pilN"
FT                   /locus_tag="Pfl01_0406"
FT   CDS_pept        462746..463312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="Pfl01_0406"
FT                   /product="putative fimbriae biogenesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72150"
FT                   /db_xref="GOA:Q3KJA6"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA6"
FT                   /protein_id="ABA72150.1"
FT                   /translation="MARINLLPWREERREERRKRFLLALTGVVVGSVGAVLIADQIISA
FT                   AIARQVARNDYIGKQIAVVDERIKQISELKAHRQQLVERMRIIQDLQGNRQISGRIFDQ
FT                   LARTLPDGVYFTDVKMVGKTLSISGAAESNNRVSDLMRNLDASDWFDAPNLNEVKATTA
FT                   GQVDQANVFQLTVRQTRPRLEEDDQ"
FT   sig_peptide     462746..462865
FT                   /gene="pilN"
FT                   /locus_tag="Pfl01_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.299 at
FT                   residue 40"
FT   gene            463309..463932
FT                   /gene="pilO"
FT                   /locus_tag="Pfl01_0407"
FT   CDS_pept        463309..463932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="Pfl01_0407"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72151"
FT                   /db_xref="GOA:Q3KJA5"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA5"
FT                   /protein_id="ABA72151.1"
FT                   /translation="MKPSEWLDSLRNVDFNDLDTSNIGSWPPVVKGLAGGLLMVLVLAL
FT                   GYNFFISDLESQLELKREEEVTLKEQFASKAHMAANLELYTQQMKEMENSFGVLLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVTQQFYIELPIQITVTGAYHDLATFVSG
FT                   VAGLPRIVTLHDFELAPANPEGGPKLRMSILAKTYRYNDKGLQK"
FT   gene            463929..464453
FT                   /gene="pilP"
FT                   /locus_tag="Pfl01_0408"
FT   CDS_pept        463929..464453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="Pfl01_0408"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72152"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA4"
FT                   /protein_id="ABA72152.1"
FT                   /translation="MSPIRFIALSALLLVLGGCGGDDFSDLDAYMNEVRLRPPGKIGPT
FT                   PTFRSYPTFTYSAANLRSPFSRQLRVDLAGQKHGSRDVKPDPNRVKQYLEGFNIEQFEM
FT                   VGTIANASGSFALLRGAGGVHRLKVGDYLGRNDGRIVAISASQVDVVEIVPDGQGAWLE
FT                   RPRTIPLKEHS"
FT   sig_peptide     463929..463994
FT                   /gene="pilP"
FT                   /locus_tag="Pfl01_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.831 at
FT                   residue 22"
FT   gene            464468..466546
FT                   /gene="pilQ"
FT                   /locus_tag="Pfl01_0409"
FT   CDS_pept        464468..466546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="Pfl01_0409"
FT                   /product="pilus secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72153"
FT                   /db_xref="GOA:Q3KJA3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA3"
FT                   /protein_id="ABA72153.1"
FT                   /translation="MNRIFSTLGFSLWIALLSPMVQAANLKALDVAALPGDRVELKLSF
FT                   DGPPPQPKGYTTDSPARIALDLPGVASQLASKTRDLGSGNARTATVVEANNRTRLIISL
FT                   TQLAPYDTRVEGNTVFVVVGQGSKAAAPRTAARAPRAAPAAAPVRTYTPTARAIRGVDF
FT                   QRGTAGEGNVVIDLSDPAIAPDIQEHDGKIILNFARTQLPEPLRVRLDVKDFATPVQFV
FT                   NAGVSGDRATITVEPSGTFDYSTYQTDNKLTVSIRPLTVDDLQKRNADRNSYNGEKLSL
FT                   NFQDIDVRSVLQLIADFTNLNLVASDTVQGGITLRLQNVPWDQALDLVLKTKGLDKRKV
FT                   GNVLLVAPADEIAARERQELESQKQIAELAPLRRELLQVNYAKAADIAKLFQSVTSAEA
FT                   KVDERGSITVDERTNNIIAYQTQDRLDELRRIVAQLDIPVRQVMIEARIVEANVDYDKS
FT                   LGVRWGGSIQNKGNWNTSGVSNGSSTTIGTPGSTSTNSPFVDMGTVNNTSGIGIAFITD
FT                   NVLLDLELTAMEKTGNGEIVSQPKVVTSDKETAKILKGTEIPYQEASSSGATSVSFKEA
FT                   SLSLEVTPQITPDNRIIMEVKVTKDEPDYLNKVQDVPPIKKNEVNAKVLVNDGETIVIG
FT                   GVFSNTQSKVVDKVPFLGDVPYLGRLFRRDVVSEKKSELLVFLTPRIMNNQAIAVSR"
FT   sig_peptide     464468..464539
FT                   /gene="pilQ"
FT                   /locus_tag="Pfl01_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            466551..467069
FT                   /locus_tag="Pfl01_0410"
FT   CDS_pept        466551..467069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0410"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72154"
FT                   /db_xref="GOA:Q3KJA2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJA2"
FT                   /protein_id="ABA72154.1"
FT                   /translation="MRNLILVGPMGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIP
FT                   WIFDKEGEPGFRDREQAMIAELCAFDGVVLATGGGAVMRDANRKALHEGGRVVYLHASV
FT                   EQQVGRTSRDRNRPLLRTANPEKTLRDLLAIRDPLYREIADLVVETDERPPRMVVLDIL
FT                   DRLAQLPPR"
FT   gene            467222..468322
FT                   /locus_tag="Pfl01_0411"
FT   CDS_pept        467222..468322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0411"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72155"
FT                   /db_xref="GOA:Q3KJA1"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJA1"
FT                   /protein_id="ABA72155.1"
FT                   /translation="MQTLKVDLGERSYPIHIGEGLLDQPELLAPHIHGRQVAIISNETV
FT                   APLYLERLTRSLAQFSVVSVVLPDGEAFKNWETLQLIFDGLLTARHDRRTTVIALGGGV
FT                   IGDMAGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPNVVLI
FT                   DTASLKTLPARELSAGLAEVIKYGLICDEPFLTWLEDNVDALRALDQTALTYAIERSCA
FT                   AKAAVVGADEKETGVRATLNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSARLG
FT                   WISEQERDRGIRLFQRAGLPVIPPEEMTEADFLEHMAIDKKVIDGRLRLVLLRRMGEAV
FT                   VTDDYPKEVLQATLGADYRALAQLKG"
FT   gene            468333..469934
FT                   /locus_tag="Pfl01_0412"
FT   CDS_pept        468333..469934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72156"
FT                   /db_xref="GOA:Q3KJA0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA0"
FT                   /protein_id="ABA72156.1"
FT                   /translation="MTSLHADEAFLGHFQLSHDPFAPRVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLVVTGPQGSGKTLLRQALVASTNKQSVQSVVVSARGAGDAAGVLRQIAQALD
FT                   VAQAEVGAILDQVVQLALTGQEVYLLVDDAEQLDESALEALMALGAGAPEGRPHVFLFG
FT                   ESSLIAQLEALHLEEERFHVIELQPYTEEETREYLDQRLEGAGRGVELFTADQISDIHE
FT                   SSEGWPGNINQVARDALIEVMIASRSAVKRPSMGFNMPKKHVLAISAVVVVAVAAAWLM
FT                   PGRNKAPTTGAPANEQAQLPLGQGAPQAGGAPSVEFNGNTQPMPLPLVGNSQPVMRGPL
FT                   AEAAGGITEGDDGVPVEGSSNTPPTVTTTAPPAGVQAGPAPTPVPVPVPAAKPTPAPTQ
FT                   VATAKPAPAAPVAKPAPAPAKPVAAAKPAEKPVTVAKAAGGSWYAGQPTSNYVVQILGT
FT                   SSEATAQNFVKEQGGEYRYFKKVLNGKPLYVITYGNFANRDAAVSAIKALPAKVQAGKP
FT                   WPRTVASVQQELATTR"
FT   gene            470285..474730
FT                   /locus_tag="Pfl01_0413"
FT   CDS_pept        470285..474730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0413"
FT                   /product="glutamate synthase [NADPH] large chain precursor"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72157"
FT                   /db_xref="GOA:Q3KJ99"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ99"
FT                   /protein_id="ABA72157.1"
FT                   /translation="MKAGLYQPDEFKDNCGFGLIAHMQGEPSHTLLQTAIEALTCMTHR
FT                   GGINADGKTGDGCGLLIQKPDAFLRAIAQETFSVELPKQYAVGMVFFNQDPAKAEAARE
FT                   NMNREILAEGLQLIGWRKVPIDTSVLGRLALERLPQIEQVYIGGEGLSDQDMAVKLFSA
FT                   RRRSSVANAADTDHYICSFSHKTIIYKGLMMPADLAAFYPDLGDQRLQTAICVFHQRFS
FT                   TNTLPKWPLAQPFRFLAHNGEINTITGNRNWAQARRTKFTNDLMDLEELGPLVNRVGSD
FT                   SSSMDNMLELMVTGGIDLFRGVRMIIPPAWQNVETMDPDLRAFYEYNSMHMEPWDGPAG
FT                   VVMTDGRYAVCLLDRNGLRPARWVTTKNGFITLASEIGVWNYQPEDVLAKGRVGPGQIF
FT                   AVDTETGQILDTDAIDNRLKSRHPYKQWLRKNALRIQATMEDNDHGSAFYDVDQLKQYM
FT                   KMYQVTFEERDQVLRPLGEQGYEAVGSMGDDTPMAVLSQRVRTPYDYFRQQFAQVTNPP
FT                   IDPLREAIVMSLEICLGAERNIFQESPEHASRVILSSPVISPAKWRSLMNLDRPGFERQ
FT                   IIDLNYDESVGLEAAIRNVADQAEEAVRAGRTQIVLSDRHIAPGKLPIHASLATGAVHH
FT                   RLTEKGLRCDSNILVETATARDPHHFAVLIGFGASAVYPFLAYEVLGDLIRTGEVLGDL
FT                   YEVFKNYRKGITKGLLKILSKMGISTIASYRGAQLFEAIGLSEEVCELSFRGVPSRIKG
FT                   ARFVDIEAEQKALATESWSPRKPIQQGGLLKFVHGGEYHAYNPDVVNTLQAAVQQGDYA
FT                   KFKEYTSLVDNRPVSMIRDLFKVKTLDTPLDISEVEPLESVLKRFDSAGISLGALSPEA
FT                   HEALAEAMNRLGARSNSGEGGEDPARYGTIKSSKIKQVATGRFGVTPEYLVNAEVLQIK
FT                   VAQGAKPGEGGQLPGGKVNGLIAKLRYAVPGVTLISPPPHHDIYSIEDLSQLIFDLKQV
FT                   NPKALVSVKLVAEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIKYAGAPWELGL
FT                   AETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMIALGCKYLRIC
FT                   HLNNCATGVATQNEKLRKDHYIGTVDMVVNFFTYVAEETREWLAKLGVRSLEELIGRTD
FT                   LLEVLEGQTAKQHHLDLTPLLGSDHIPADKPQFCGVERNPPFDQGLLAEKMVEMATSAI
FT                   NDLSGAEFDLDICNCDRSIGARISGEIARKHGNQGMAKAPITFRFKGTAGQSFGVWNAG
FT                   GLNMYLEGDANDYVGKGMTGGKLTIVPPKGSVYKTQESAIIGNTCLYGATGGKLFAAGT
FT                   AGERFAVRNSGAHTVVEGTGDHCCEYMTGGFVCVLGKTGYNFGSGMTGGFAYVLDQDNT
FT                   FVDRVNHELVEIQRISGEAMEAYRSHLQNVLNEYVAETDSEWGRELAENLDDYLRRFWL
FT                   VKPKAANLKSLLSSTRANPQ"
FT   gene            474764..476182
FT                   /locus_tag="Pfl01_0414"
FT   CDS_pept        474764..476182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0414"
FT                   /product="glutamate synthase [NADPH] small chain"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72158"
FT                   /db_xref="GOA:Q3KJ98"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ98"
FT                   /protein_id="ABA72158.1"
FT                   /translation="MAERLNNDFQFIDVGRKDPKKKLLRQRKKEFVEIYEPFKPQQSAD
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVAEGNILQAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVKPTGKRVAIIGAGPAGLG
FT                   CADVLVRGGVTPVVFDKNPEIGGLLTFGIPEFKLEKTVLSNRREVFTGMGIEFRLNTEV
FT                   GKDVTMEQLLAEYDAVFMGMGTYTYMKGGFAGEDLPGVYDALDFLIANVNRNLGFEKSP
FT                   EDFVDMKGKKVVVLGGGDTAMDCNRTSIRQGAKSVTCAYRRDEANMPGSRKEVKNAKEE
FT                   GVKFLYNRQPIAIVGEDKVEGVKVVETRLGEPDARGRRSPEPIPGSEEIIPADAVVIAF
FT                   GFRPSPAPWFEQFEIQTDSQGRVVAPEQGQYKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRNAAEGILDYLGV"
FT   gene            476414..477481
FT                   /locus_tag="Pfl01_0415"
FT   CDS_pept        476414..477481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0415"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72159"
FT                   /db_xref="GOA:Q3KJ97"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ97"
FT                   /protein_id="ABA72159.1"
FT                   /translation="MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRAQAGD
FT                   FMSLCMNPEFACEVTLQPLDRYPQLDAAILFSDILTIPDAMGQGLYFETGEGPRFKKVV
FT                   STLADIEALPIPDPHKDLGYVMDAVSTIRRELNGRVPLIGFSGSPWTLATYMVEGGSSK
FT                   DFRKTKAMLYDNPQAMHLLLDKLAQSVTSYLNGQIQAGAQAVQIFDTWGGNLSAAAYQE
FT                   FSLAYMKKIVSGLIREHDGRKVPVILFTKNGGLWLESIAEAGADALGLDWTCDIGNARA
FT                   RVGDKVALQGNMDPTVLYAKPEAIRTEVGRILASYGKGSGHVFNLGHGITPEVDPEHAG
FT                   AFLRAVHELSAQYHE"
FT   gene            complement(477548..478822)
FT                   /locus_tag="Pfl01_0416"
FT   CDS_pept        complement(477548..478822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0416"
FT                   /product="putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72160"
FT                   /db_xref="GOA:Q3KJ96"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ96"
FT                   /protein_id="ABA72160.1"
FT                   /translation="MKTAVAPLAHEVPPAAADDVMTELQEIYIEKGTPAFMRTVLALFS
FT                   GGFATFALLYCVQPMMPLLSHEYSINAAQSSLILSVATGMLAFGLLITGPISDRVGRKP
FT                   VMVAALFAAALCTIASSMMPSWHGVLIMRALIGLSLSGLAAVAMTYLSEEIHPQHIGLA
FT                   MGLYIGGNAIGGMSGRLITGVLIDFVSWHTAMMVIGGLALIAAAVFWKILPESRNFRSR
FT                   SLHPRSLLDGFTMHFRDAGLPLLFLEAFVLMGAFVTLFNYIGYRLLAEPYHMDQVFVGL
FT                   LSVVYLSGIYSSAKIGSLADKLGRRKVLWATIALMFAGLALTMFTPLPLVIIGMLIFTF
FT                   GFFGAHSVASSWIGRRALKAKGQASSLYLFSYYAGSSIAGTAGGVFWHMAGWNGIGLFI
FT                   GALLLVALLVALKLAKLPPLGGVKA"
FT   gene            478941..479837
FT                   /locus_tag="Pfl01_0417"
FT   CDS_pept        478941..479837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0417"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72161"
FT                   /db_xref="GOA:Q3KJ95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ95"
FT                   /protein_id="ABA72161.1"
FT                   /translation="MELRHLRYFIAVAEELHFGRAAQVLGISQPPLSQQIQALEQEVGA
FT                   RLFERTNRRVELSEAGRLFLEEARLVLAQVDKAADVARRAQLGELGELKIGFTSSAPFN
FT                   STIPQAIFSFRQRFPAVHLNLREMSSTMVADALVDESIEVGIMRPLGLPDSLSVVELMR
FT                   EPLVAVLSSKHPLAQGSEEGLFLSALALEPFVFFPRSYGSGLYSQLISLARDAGFSPHF
FT                   AQEAGEAMTIIGLVAAGLGVSVMPASYQRMRIDGVVYRPLLDPEAVTAVWLVQRKDQKS
FT                   PMAKAFVELLTRKVDAG"
FT   gene            complement(479838..480275)
FT                   /locus_tag="Pfl01_0418"
FT   CDS_pept        complement(479838..480275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ94"
FT                   /protein_id="ABA72162.1"
FT                   /translation="MQAKALIAAALFSLLPSASHATNLMYMPFETVVSDAMRAGRLDGS
FT                   VKFYLVGNGPQGTQRLLQRGVVSDLKTNGFNKSDHDSCEWVLQSNLIALQAEAKRVGAN
FT                   AVTNIVSYYDQHVRKDLNTYECRAGIFVTRVALKGDLVRLP"
FT   sig_peptide     complement(480210..480275)
FT                   /locus_tag="Pfl01_0418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            480394..480699
FT                   /locus_tag="Pfl01_0419"
FT   CDS_pept        480394..480699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72163"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ93"
FT                   /protein_id="ABA72163.1"
FT                   /translation="MTEILRSSTFSSWLVKLADSRARMRIQVRIDRMAEGNFGDVKAID
FT                   EGISEARIDYGPGYRVYFMQQGRQLVILLCGGDKSSQSRDIKQARLIAESWQEQNP"
FT   gene            480696..480983
FT                   /locus_tag="Pfl01_0420"
FT   CDS_pept        480696..480983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0420"
FT                   /product="putative phage DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72164"
FT                   /db_xref="GOA:Q3KJ92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ92"
FT                   /protein_id="ABA72164.1"
FT                   /translation="MTEQFTRWDSAEYLKTEEDMANYLDACMEEAGDDPAFIAKALGTI
FT                   ARARGMTQVARDAGLSRESLYRALSGEVNPEFGTILKVMKALGLKLHAST"
FT   gene            complement(481032..481472)
FT                   /locus_tag="Pfl01_0421"
FT   CDS_pept        complement(481032..481472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ91"
FT                   /protein_id="ABA72165.1"
FT                   /translation="MHFKKLAATLLICAMPAVSQARDTAVYLPFDKAVAEATRTGKIDG
FT                   SVKFYLAGNAPAGKVTVVSPGAVTNKKTNAFNKTDQEACEWVVQSAIISLHQAAKNAGA
FT                   NAVTNIVSFYKSNERKDAKTYECHAGAIMAGVALKGDLATVQ"
FT   sig_peptide     complement(481407..481472)
FT                   /locus_tag="Pfl01_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(481493..482728)
FT                   /locus_tag="Pfl01_0422"
FT   CDS_pept        complement(481493..482728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0422"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72166"
FT                   /db_xref="GOA:Q3KJ90"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ90"
FT                   /protein_id="ABA72166.1"
FT                   /translation="MKRVVVTGMAGITSLGSDWDTIAGNFAANRSGIRRMDEWDRFSEL
FT                   NTRLAGPIDDFQVPAHWTRKQLRSMGRVSRLAVGAAEKALADAGLLGDESIKDGRMGVA
FT                   CGSSTGSTDEIKAFGNMLLNSVAEGLNANSYVRMMPHTTAANISIFFGLTGRLIPTSSA
FT                   CTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTSPRPY
FT                   DKDRDGLVIGEGGGMLVLEELEHALARGAHIHAEIVGFGSNADGQHTTRPEQITMRRAM
FT                   ELALEDAGLAPDVIGYVNGHGTATEQGDVAETLATSALFGERMPISSQKSFLGHTLGAC
FT                   GALESWFSIEMLNRDLYVHTLNLDEVDPHCGKLDYLRGEFRQMSHDYVMNNNFAFGGVN
FT                   TSLIFRRWPQPN"
FT   gene            complement(482728..483456)
FT                   /locus_tag="Pfl01_0423"
FT   CDS_pept        complement(482728..483456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0423"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72167"
FT                   /db_xref="GOA:Q3KJ89"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ89"
FT                   /protein_id="ABA72167.1"
FT                   /translation="MTESILVTGSSRGIGRAIALRLASAGHDIVLHCRSGVTEAQAVKA
FT                   EVEALGRTARILQFDVADRETCKAILEADVEAHGAYYGVVLNAGLTRDGAFPALSDDDW
FT                   DVVLRTNLDGFYNVLHPVMMPMIRRRAAGRIVCITSVSGLIGNRGQVNYSASKAGVIGA
FT                   AKALAIELAKRKITVNCVAPGLIDTAMLDENVPVEELLKMIPAQRMGTPEEVAGAVNFL
FT                   MSAEASYITRQVLAVNGGLC"
FT   gene            complement(483449..483913)
FT                   /locus_tag="Pfl01_0424"
FT   CDS_pept        complement(483449..483913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72168"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ88"
FT                   /protein_id="ABA72168.1"
FT                   /translation="MTHWPLAELLPHAGDMILIDRILSFDDEQIHTTLTVRPGGLFSLP
FT                   DGSLPAWVGVELMAQSVAAFAGCHARQKGNPVELGFLLGTRKFECNVAAFPVGSELTIH
FT                   GLRSLEDDNGMGVFECHINAPGIEASARLNVFRPPQAADYLEQSKESNDD"
FT   gene            complement(483910..485106)
FT                   /locus_tag="Pfl01_0425"
FT   CDS_pept        complement(483910..485106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0425"
FT                   /product="putative fatty acid biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72169"
FT                   /db_xref="GOA:Q3KJ87"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ87"
FT                   /protein_id="ABA72169.1"
FT                   /translation="MTAYLNALGVICALGRDKQTVARNLFAGDCSGMRRESGWVPEREL
FT                   PVAAVHGDLAPIPEALADQRSRNNQLLLEAALQIRDDIEQAIQTYGRDRIGVVLGTSTS
FT                   GIDEASRGLAHYIRDQQFPADYDYRQQELGAPANFLADWLQLSGPTYVISTACTSSARA
FT                   LMSARRLLDLGLCDAVLCGGVDSLCKLTLNGFSALEAVSDERCNPFSANRNGINIGEAA
FT                   VLFVMSKERGAGPGIALLGAGASSDAHHISAPEPTGRGALQAMQKALDQAHLQADDISY
FT                   LNLHGTATQHNDAMESLAVDALFADGVPCSSTKPMTGHTLGAAGALEAAFCWLSLSADN
FT                   PDHALPPHIWDGQADPDLPALKWVTASERLASIAPRYLMSNSFAFGGNNVSLIIGDAP"
FT   gene            complement(485103..485585)
FT                   /locus_tag="Pfl01_0426"
FT   CDS_pept        complement(485103..485585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0426"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72170"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ86"
FT                   /protein_id="ABA72170.1"
FT                   /translation="MLRVLLLACVLLLGACASQAPLPAGNPSLPLPTQLHIERHLAGQQ
FT                   QDWLLVIQREGPGIRWSMMDPLGIPQARQQLIDGHWQADGLLPPNPEARELFAALLFAL
FT                   TPAGELSRNYPEAQQQGGRRSLPARWDIRYTQPLSFELNLPQGPHYRVTPLGEPTS"
FT   sig_peptide     complement(485526..485585)
FT                   /locus_tag="Pfl01_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.712 at
FT                   residue 20"
FT   gene            complement(485585..486310)
FT                   /locus_tag="Pfl01_0427"
FT   CDS_pept        complement(485585..486310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72171"
FT                   /db_xref="GOA:Q3KJ85"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ85"
FT                   /protein_id="ABA72171.1"
FT                   /translation="MNYLSDNYVEETRFGFWFLRSHTWQHHVLRVAINDLRGLFSESLP
FT                   ASPVLLDAGCGQGKSFGHLRQTFAPQRLIGVDADPHSLELSAAEAARQGFDVELIGSDC
FT                   ATLNVPDASVDLLFCHQTFHHLVEQEKALAEFYRVLKPGGYLLFAESTEAYIDTWVIRW
FT                   LFRHPMHVQKSAAQYLEMIRQQGFEFAEQNVSYPYLWWSRSKDFGLLERFGLRQPKPFG
FT                   QREETLVNVVARKPLNEAV"
FT   gene            complement(486307..487539)
FT                   /locus_tag="Pfl01_0428"
FT   CDS_pept        complement(486307..487539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72172"
FT                   /db_xref="GOA:Q3KJ84"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ84"
FT                   /protein_id="ABA72172.1"
FT                   /translation="MESRQVVIIGAGPSGAIAAALLKRKGHDVLVIERQHFPRFSIGES
FT                   LLCHCLDFVEEAGMLEAVNAAGFQRKNGAAFAWGERYSAFDFGDTFTAGKPTTLQVQRA
FT                   DFDKLLADQATLQGAEIRYGDAIVSVDFERPRPQLNVRREDASEYRVEADFVLDASGYG
FT                   RVLSRLLDLEAPSNFPVRQAVFTHVEDHIDYPGFDREKILITTHPQHRDIWFWSIPFSN
FT                   GRCSVGVVAAAEHFAGRDTDLDACLRGFIAETPSLAKVLNNAVWDTPARTLGGYAANVK
FT                   TLHGPGFALLGNAAEFLDPVFSSGVTIAMRSASMAAAVLHRQLQGETVDWQREFAEPLK
FT                   RGVDTFRCYVEGWYAGTFQDVIFHEQGSPEIRRMICSILAGYAWDERNPFVSEARRRLK
FT                   MISELCARDDT"
FT   gene            complement(487541..488701)
FT                   /locus_tag="Pfl01_0429"
FT   CDS_pept        complement(487541..488701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0429"
FT                   /product="transporter, CPA2 family"
FT                   /note="TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72173"
FT                   /db_xref="GOA:Q3KJ83"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ83"
FT                   /protein_id="ABA72173.1"
FT                   /translation="MMVVIFWLMALALFFVATGVGRHFGLIPIVSQLLLASFGLPLLMY
FT                   FWIEPGWQLNGAELIAPGWLKNLYSLSFALLLGHILSDVIDLRLDRQSVKIALPSFAVP
FT                   FTCGLATAYWLLPVQPWINSLAIGLVFAITAIPVLYLYLRHIDYPPAATRRLVQTAILI
FT                   DLTCWTLFGLAQGSLHLSSLLLPLGLACVPVLLRVFGIRRPLTYSLGFFALLVLAEHYK
FT                   LNALIFGIGYLLCMAALKVPLVLPIPAHWMNRLQTWVAIPLILTFGIVQIDVHSALASL
FT                   GAVQWAALLLLPVASKILGNWLGLGWAGASFAGASRWRESVLLNIRGLSEIVFLNLLLQ
FT                   QRLISPALYFALVLMGLIATLLPAFIGLHRASLNPIAVPRSSRANR"
FT   gene            complement(488698..491031)
FT                   /locus_tag="Pfl01_0430"
FT   CDS_pept        complement(488698..491031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0430"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72174"
FT                   /db_xref="GOA:Q3KJ82"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ82"
FT                   /protein_id="ABA72174.1"
FT                   /translation="MPSERRLPWLFLILLLAVVALGAWQWRDGAPLSANLMELVPGTHP
FT                   DALELRAEQRMQEPLNRDMLVLVGHTDRQQAVAMAQTLGEQWQASGLFEKVQWNLQADL
FT                   PALRTQLLQGRLAMLSADDRQLLIEHPDAFIQQRVQALFDPFTGFSLVPSQDDWLGLTG
FT                   RIQNSQPQHGAVQLDIGSGALIADADGKSWVLLRARTTGSAFDMNQPLQVAALLQHSRE
FT                   QAASADVQLLAASGLLYAANGQQQATREMTWVGGGATIGILLLLLLAFRRWRVLLAFIP
FT                   VLVGMLFGAVACVALFGHMHVMTLVLGSSLIGVAVDYPLHYLSKSWSLKPWHSWPALRL
FT                   TLSGLTLSLITSAIGYLALAWTPFPALTQIAVFSAAGLLGAYLSAVCLLPALLKNVELR
FT                   PAQWPLQLAERLVRLRETLLEHVRTPVLLALLIAFCVGGLLQLESKNDIRQWVGAPQRL
FT                   TDEAQTIARMTGYQPTSQFFLVRAADQQQLLERQAALSERLDQLVNLDKLQGYLALNQL
FT                   VSPPAQQQQVREALSKLPQFWQPLLEVGVPLAALQTELQQLQALPAEDIDAALAGPLGE
FT                   PYRTLWLGPTEDGVAAMVSLQGLNNPSLLRVQALDLPGVMLVDRLGDLNKVFAQTQISA
FT                   AELKLASCVLIVLVLMLPFGLGGALRIVALPLLAALCSLASLGWLGQPLTLFSLFGLLL
FT                   VTAISVDYAILMREQVGGAAVSLLGTLLAAATTWLSFGLLAVSSTPAVSNFGLSVSLGL
FT                   AFSFMLAPWAGRQPHAVAVTEPAA"
FT   sig_peptide     complement(490963..491031)
FT                   /locus_tag="Pfl01_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.978 at
FT                   residue 23"
FT   gene            complement(491021..491623)
FT                   /locus_tag="Pfl01_0431"
FT   CDS_pept        complement(491021..491623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0431"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72175"
FT                   /db_xref="GOA:Q3KJ81"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ81"
FT                   /protein_id="ABA72175.1"
FT                   /translation="MNVFLKSLGALALLTLSSLANAFDLQQLSEQLAKPDVIHGQFIQE
FT                   KHLRALPQPLISKGSFVLAKNHGLLWLLKTPLQQDYRISAKGIARRDATGWQLLPNKSA
FT                   GAEQNRLFLAVLQGDSSGLQRDFELALSGDAQKWQLTLTPRSVLLKQVFNQINISGGTL
FT                   VNTIELLETQGDSTVLRMQDSTAGQPLSDAEQHDFAE"
FT   sig_peptide     complement(491555..491623)
FT                   /locus_tag="Pfl01_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(491620..492045)
FT                   /locus_tag="Pfl01_0432"
FT   CDS_pept        complement(491620..492045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72176"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ80"
FT                   /protein_id="ABA72176.1"
FT                   /translation="MRSAGVLHADTEILVPFFDVDTMHVVWHGHYVKYLEVARCALLDK
FT                   IGHNYNQMVDSGYAWPVIDLQLRYVRGAVFGQRLNVRASLVEWENRLKIHYLITDAQTG
FT                   ERLTRASSVQVAVEVSSREMQLASPKVFTDAVERMLR"
FT   gene            complement(492038..493582)
FT                   /locus_tag="Pfl01_0433"
FT   CDS_pept        complement(492038..493582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0433"
FT                   /product="putative histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72177"
FT                   /db_xref="GOA:Q3KJ79"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ79"
FT                   /protein_id="ABA72177.1"
FT                   /translation="MTTPTPEPVTFGERPLRIEDVLALANRQAPVQLQSDAPYRERIAK
FT                   GARFLDSLLDKEGVIYGVTTGYGDSCVVAVPLHHVEALPRHLYTFHGCGLGKLLDAQAT
FT                   RAVLAARLQSLCHGVSGVRIELLERLHAFLEHDILPLIPEEGSVGASGDLTPLSYVAAT
FT                   LSGEREVMFRGERRQAADVHRELGWTPLVLRPKEALALMNGTAVMTGLACLAYARADYL
FT                   LQLATRITALNVVALQGNPEHFDERLFAAKPHPGQMQVAAWLRKDLAIDAPTAPLHRLQ
FT                   DRYSLRCAPHVLGVLADSLNWLRSFIETELNSANDNPIIDAEAERVLHGGHFYGGHIAF
FT                   AMDSLKNLVANVADLLDRQLALLVDERYNHGLPSNLSGASADRAMLNHGFKAVQIGASA
FT                   WTAEALKNTMPASVFSRSTECHNQDKVSMGTIAARDAIRVLELTEQVAAATLLAANQGV
FT                   WLRGRDEDARPLPPSLAAMHEQLAQDFPPVIEDRALEGELRLCLQRIAEQHWRLHA"
FT   gene            complement(493563..494510)
FT                   /locus_tag="Pfl01_0434"
FT   CDS_pept        complement(493563..494510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0434"
FT                   /product="putative acyl transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72178"
FT                   /db_xref="GOA:Q3KJ78"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ78"
FT                   /protein_id="ABA72178.1"
FT                   /translation="MTVETDKKHWADREERGSFLLMKFTALAAKVLGRRLLSPLLYGIV
FT                   LYFFLFGRTARRSAWQYQQRLADWSGRHELRPTRWRVFRQFMAFADSLLDKLDVWNGKL
FT                   KIEQIEIIDPALLRNQLRGSRGQMLVGAHLGNLEVCRALAELGEKVTMNVLVHTKHAEQ
FT                   FNRLLGEAGATNLRLIQVSELDPVIMLQLHERLERGEWLAIAGDRVPLHGGRSVTVDFL
FT                   GHPAPFPQGPWLLAGLLKCPVNLLMCLKQPDGHYRLTLEPFADAVVWSRREREQVIHQW
FT                   ATRYAERLSHYCLEAPCQWFNFYPFWKTDDNANS"
FT   gene            complement(494507..495241)
FT                   /locus_tag="Pfl01_0435"
FT   CDS_pept        complement(494507..495241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0435"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72179"
FT                   /db_xref="GOA:Q3KJ77"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ77"
FT                   /protein_id="ABA72179.1"
FT                   /translation="MHNPCAVIPVYNHETAIGTVVDALLAEDLPCILVDDASSKSCAAV
FT                   LDALAERERVYLVRLTANQGKGGAVMTGLREAARLGFSHALQVDADGQHDLQDVARFIE
FT                   ESRAHPESLVCGYPLYDASVPKGRLYARYLTHVMVWINTLSLQIRDSMCGFRVYPLEPT
FT                   LGVIDSARIGKRMDFDSDILVRLAWRNQPMRWLQTSVHYPLDGVSHFRLFHDNVLISSM
FT                   HTRLFFGMLLRLPVILWRRWRP"
FT   gene            complement(495234..496913)
FT                   /locus_tag="Pfl01_0436"
FT   CDS_pept        complement(495234..496913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72180"
FT                   /db_xref="GOA:Q3KJ76"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ76"
FT                   /protein_id="ABA72180.1"
FT                   /translation="MNWIKLEQLLLKALPARAVTSAPALDHAQLREQALSLAAGLQARG
FT                   VQRLAVHLEDAADLAVALLGAWRAGVSVLLPSDLQAQTRQRWSNDVDLWLTDHSDDARL
FT                   SDLQQPALPAAELDLDQCRLSLCTSGSSGEPKRIDKSLRQLANEVEALEQLWGADLGEA
FT                   CILGSVATQHIYGLLFRVLWPLCAGRPFLRKQLAFPEDLQRASREHPAFAWVASPALLK
FT                   RMGDNLDWPALSAVRRVFSSGGALPTDAAKSLHQRLGQWPTEILGSSETGGIAWRQGES
FT                   LWQPFAGIELSQDSDGALLIASPYLPAGQVEHTADAARIQADGRFELLGRLDRIVKLEE
FT                   KRISLPMLEQALVAHDWVAEARLGVVQENRASLGALLVLSESGLFALREHGRRSLTETL
FT                   RRHLGDHCEALALPRRWRLLRQMPLTSQGKLPQADVEALLLAPRPKAPEILEQAETEGE
FT                   WNLQLSVPPDLAYFSGHFPKAPVLPGVVQVEWALNLGRQLLNLPGAFAGMEVLKFQQLV
FT                   RPGDEIQLHLRFDPERGKLYFAYRNDTATCSSGRILLGAGDA"
FT   gene            complement(496910..497455)
FT                   /locus_tag="Pfl01_0437"
FT   CDS_pept        complement(496910..497455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0437"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72181"
FT                   /db_xref="GOA:Q3KJ75"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ75"
FT                   /protein_id="ABA72181.1"
FT                   /translation="MSRLIGLGLLLAGLLYPFAVYFGMEHFAPWQFGLLLGGLWLARAL
FT                   TGERKPGSLWMAFVAIVFCLLLAVFDSPLLLRWYPVLISGFMLVLFSLSLKYGPPMVER
FT                   LARLREPQLPPKAIRYTRQVTVAWSVFFFCNGLCAALLTLWAPLNWWMLYTGLISYGLI
FT                   GLMFAIEWLIRQRVRGRP"
FT   sig_peptide     complement(497396..497455)
FT                   /locus_tag="Pfl01_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.714 at
FT                   residue 20"
FT   gene            complement(497452..497706)
FT                   /locus_tag="Pfl01_0438"
FT   CDS_pept        complement(497452..497706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0438"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72182"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ74"
FT                   /protein_id="ABA72182.1"
FT                   /translation="MQTRDDIFNTLRDALVELFELDPARVSLESNLYQDLEIDSIDAVD
FT                   LIDHIKRQTGKKIAAEEFKSVRTVSDVVEAVYRLVQPAA"
FT   gene            complement(497716..497976)
FT                   /locus_tag="Pfl01_0439"
FT   CDS_pept        complement(497716..497976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0439"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72183"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ73"
FT                   /protein_id="ABA72183.1"
FT                   /translation="MSDLNRDIKELIIDALGLEDISAEDIGDDQTLFGEGLGLDSVDAL
FT                   ELGLAIQKKYGIKIDADAKDTRNHFSNVASLAAFVTAKQAA"
FT   gene            complement(497957..498745)
FT                   /locus_tag="Pfl01_0440"
FT   CDS_pept        complement(497957..498745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0440"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72184"
FT                   /db_xref="GOA:Q3KJ72"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ72"
FT                   /protein_id="ABA72184.1"
FT                   /translation="MIGKNRDAYYWRLLATATSFALFGLGGLCLRLLVFPLLGFLPGDA
FT                   IAHRERARQTVSRLFWFFVRFMARTGVLTYDIQGAERLGRPGQMIIANHPSLIDVVFLI
FT                   GLVRGANCVVKKSLWENPFTRGPLRSTEYISNDGSMDMLDAAAGALQSGQTLIIFPEGT
FT                   RTQPGQAPAFHRGAAAIALRGAKIVTPVVIKVSPTTLTKAEPWYRIPGRRVHFSFHVGA
FT                   DIDPQTFAAQGPAPQASRKLNDYLHQFFIKELAEDERSKP"
FT   gene            complement(498742..499467)
FT                   /locus_tag="Pfl01_0441"
FT   CDS_pept        complement(498742..499467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72185"
FT                   /db_xref="GOA:Q3KJ71"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ71"
FT                   /protein_id="ABA72185.1"
FT                   /translation="MSVINFNIAQWRAWAPGLDSVEAWQAWSRQPVVLESSDAAPDVSF
FT                   LPAMQRRRLSRLARMAFSVGWPLADGRENLPLVFVSRHGETPRTFEILSDLANDQPLSP
FT                   TQFSLSVHNAIIGLWSIMRGETSEMTALAAAGDGLEHGMLEAATLLNEGAPAVLLVITE
FT                   EQPPEAYSTWIDDVPFPYAVGLLLTPGTDWRLTLNSAPEARSKTQWPHALNLLRTLLDQ
FT                   QPHCQHAWKNRLWTWQRNP"
FT   gene            499837..500607
FT                   /locus_tag="Pfl01_0442"
FT   CDS_pept        499837..500607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0442"
FT                   /product="putative chromosome partitioning-related ParA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72186"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ70"
FT                   /protein_id="ABA72186.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLVDLDAQANSTQ
FT                   YLTGLTGDDIPMGIADFFKQTLSSGPFSKKNQADIYETPFDNLHIITATAELADLQPKL
FT                   EAKHKINKLRKLLDELSEDYDRIYLDTPPALNFYAVSALIAADRVLIPFDCDSFSRQAL
FT                   YGLIAEIDELKEDHNEDLEVEGIVVNQFQARASLPQQILDELIAEGLPVLPVYLASSVR
FT                   MRESHQANTPLIHLDPRHKLTQQFVELHNLLEDA"
FT   gene            complement(500615..501049)
FT                   /locus_tag="Pfl01_0443"
FT   CDS_pept        complement(500615..501049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0443"
FT                   /product="thioredoxin"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72187"
FT                   /db_xref="GOA:Q3KJ69"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ69"
FT                   /protein_id="ABA72187.1"
FT                   /translation="MTDPLLIPCPSCNGLNRIPAERLNDHPKCGRCKSEVLLNKPFELK
FT                   QGDYASQIKGDLPLLVDVWADWCGPCKSFAPVFEQAAAQLAGKCRLAKLDSEANQQLSA
FT                   QLGIRSIPSLILLRNGREVARQSGAFPLPQLMAWLRSQGI"
FT   gene            complement(501131..502594)
FT                   /locus_tag="Pfl01_0444"
FT   CDS_pept        complement(501131..502594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72188"
FT                   /db_xref="GOA:Q3KJ68"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ68"
FT                   /protein_id="ABA72188.1"
FT                   /translation="MKALDELTFDNRFARLGDAFSAHVLPEPIDNPRLVVASPAALALL
FT                   DLDPAMADTQEFAELFGGHKLWADAEPRAMVYSGHQFGGYTPQLGDGRGLLLGEVYNAA
FT                   GEHWDLHLKGAGQTPFSRMGDGRAVLRSSIREFLASEALHALNIPSSRAACVIGSDTPV
FT                   WREKQERAAMVLRLAPSHIRFGHFEYFYYTKRPEQQKLLGEHVLAMHYPECLEQPEPYL
FT                   AMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDANFICNHS
FT                   DDQGRYSFSNQVPVGQWNLSTLAQALTPLISVEALRETLGLYLPLFQAHYLDLMRRRLG
FT                   FTTAEDDDQMLLEQLLQLMQNSGVDYTLFFRRLGEESAEQAVARLRDDFVDIKGFDAWG
FT                   ERYVARVARDGATDQEQRRARMHAVNPLYILRNYLAQKAIDAAEQGDYSEVRRLHAVLS
FT                   NPFEEQPGMESYAERPPEWGKHLEISCSS"
FT   gene            complement(502643..505996)
FT                   /locus_tag="Pfl01_0445"
FT   CDS_pept        complement(502643..505996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0445"
FT                   /product="putative potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72189"
FT                   /db_xref="GOA:Q3KJ67"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ67"
FT                   /protein_id="ABA72189.1"
FT                   /translation="MPTLRSFFVAALLGLSLTVGPLQAAEPPSSDAVQASLDKLTDSKL
FT                   PEADKKALQTVLQNTLNQLNNRRDYEQKLIDLKQQLATAPKQTIENSRELTRLKASAVV
FT                   PVAQRFPKENIQQLEQMLTERSTQQSDLQKALADANSLIITAQTRPERAQAEISSSQTR
FT                   IQQINNILKTGKDAGKTVSAEQRDLLNAELAALNALIPLRRQELAGNNQLQDLGNSQHD
FT                   LLSEKSDRLDREIQELQTLINQKRLTLSQETVTQQSIEAQKSGSSALLATESAANLKLS
FT                   DYLLKSTDRLNELTQQNLQTKQQLDSVTQSDSALDEQINVLKGSLLLSKILYKQKQALP
FT                   RLKVDRDLADQIADIRLYQFEINQQREQLSNPATYVDNLLSTQPPEQVTPQLRKSLLEL
FT                   ANTRVDLLERLSRELSAMLNESITLQLNQKQLLSTAQSLRATLDEQMFWIPSNKPLDTE
FT                   WMRGVPERLKRQIDTLPLASSFSELTDGLTQRPLLFLPLALLIGALLWRRKQLYSRLNK
FT                   VHQDIGHFKRDSQWHTPQAILINILLAMPVALGLALCGLALQIDARGQNANMGAALLQM
FT                   AQAWLVFYTAYRILAPGGVAELHFRWEKPQVEFLQGWVRRLGLVVMALVAVVAVAELQP
FT                   AALADDVLGMPVVLTCYALMAWLLSRLLISSPTHENASLFRKAVGVMFTLLPIALFVAV
FT                   CFGYYYTALKLSDRLINTLYLLMFWLVIEATFVRGLAVAARRLAYQRALAKRQAAKEAG
FT                   DGEAVIEEPTLDIEKVNEQSLRLIRLALLGGFIAALYWVWADLITVFSYLDNITLYEYT
FT                   SGTGANMSMVPISIGDMLGALIIIGITFALARNLPGLLEVFVLSKLNLAQGSAYATTTL
FT                   LSYVIAGVGFVSTLSTLGVSWDKLQWLVAALSVGLGFGMQEIFANFISGIMILFERPVR
FT                   IGDTITIGNLSGTVSKIRIRATTITDFDRKDIIVPNKTFITGQLINWSLTDTITRVTLK
FT                   LGVDYGSDLDLVKELLLKAARENPRVLKEPEPHVYFLNFGESTLDHELRMHVRDLGDRN
FT                   PVLDEVNRFINREFKKQHINISFRQMEVYLKNLHGQEYKMVPIEPETKTIVPVSDDQKP
FT                   LQEPPPAKLD"
FT   sig_peptide     complement(505922..505996)
FT                   /locus_tag="Pfl01_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(506031..507773)
FT                   /locus_tag="Pfl01_0446"
FT   CDS_pept        complement(506031..507773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0446"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72190"
FT                   /db_xref="GOA:Q3KJ66"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ66"
FT                   /protein_id="ABA72190.1"
FT                   /translation="MNATTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMSA
FT                   GVDGGGIIFDNYPTAYLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATVGVLITTG
FT                   LTGMAAAWLFDLNLIQGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPM
FT                   AVFLTVTLIDMLASGQTGLHWSLLTHLIREFGIGGVIGLGGGWLMLQLVNRINLATGLY
FT                   PILVIAGGLVVFALTNALHGSGFLAVYLCGLVIGNRPVRSRHGILHMLDGMAWLAQIGM
FT                   FLVLGLLVTPHDLLPIALPALGLALWMILFARPLSVLVGLLPFKAFHGREKAFISWVGL
FT                   RGAVPIILAVFPLMAGLPNAQLYFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPEPAP
FT                   ISRAALEVHVTSEWELFVYKLGAEKWCIGSPLRELKMPEGTRIAALFRGQQLLHPSGST
FT                   VLEVDDLLCVIGHEHNLPALGKLFSQAPQRGLDLRFFGDFVLEGDAQLKAVAALYGLPA
FT                   EGIDPDMTLGHFIAQKVGGAPIVGDQVEWNNTHWTVAVMDGNKIGKVGVRFPEGSRPGP
FT                   GLFL"
FT   sig_peptide     complement(507681..507773)
FT                   /locus_tag="Pfl01_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.429 at
FT                   residue 31"
FT   gene            complement(508115..509740)
FT                   /locus_tag="Pfl01_0447"
FT   CDS_pept        complement(508115..509740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0447"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72191"
FT                   /db_xref="GOA:Q3KJ65"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ65"
FT                   /protein_id="ABA72191.1"
FT                   /translation="MSLRNMNIAPRAFTGFALIGGLMLILGVFALNQMSKIRGAAEDIS
FT                   SSSVPSIKNLDEFTQLTLRLRVLSYRLLVNREPDVQQKTMDLLDMRNQQIRKAQTDYEP
FT                   LIGSPEERAAYDQYVQLLGQYRQIEDRMKTLSRNNQVDELRNLLNTQLLDNSEAINTVL
FT                   NRLMQINGQQISETNQQAADQYSSAFNLVVTLLVIATGLTFLFAWLLTVSITKPIAKAL
FT                   DAAETIAEGNLTQPIQVDGTDEAGRLLAAMAKMQSKLRDTLQRISGSATQLASAAEELN
FT                   SVTDESARGLTQQNNEIEQAATAVNEMTSAVEEVARNAVSTSEASKNATTSAGDGRDLV
FT                   QETVSAIERMSADVQSTATLIGDLANESRDIGKVLDVIRGLADQTNLLALNAAIEAARA
FT                   GEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQSGTEHAVDSMRNSTERAESTLNI
FT                   ARGAGLSLDTINTAIVEINERNLVIASAAEEQAQVAREVDRNLVNIRDLSVQSATGANQ
FT                   TSAASNELSRLALDLNNMVGRFSL"
FT   sig_peptide     complement(509648..509740)
FT                   /locus_tag="Pfl01_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.844 at
FT                   residue 31"
FT   gene            510021..510251
FT                   /locus_tag="Pfl01_0448"
FT   CDS_pept        510021..510251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ64"
FT                   /protein_id="ABA72192.1"
FT                   /translation="MLEASLSQLEQLVSDLVQQNQALSETNQTLSTELAQAKDENESLQ
FT                   LSLMEQEEKHGATAARIQALVDRVNAGPVSA"
FT   gene            510248..510550
FT                   /locus_tag="Pfl01_0449"
FT   CDS_pept        510248..510550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72193"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ63"
FT                   /protein_id="ABA72193.1"
FT                   /translation="MNHGTAGVKVISILGEDYSIKAPAGEEQTLLDAALMLKAALADTK
FT                   RKYPTLIGDRLLVLAAMNLCSQQIEMKKQHQQELERYQEQVSATVETIAKTINQG"
FT   gene            510651..512588
FT                   /locus_tag="Pfl01_0450"
FT   CDS_pept        510651..512588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0450"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72194"
FT                   /db_xref="GOA:Q3KJ62"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ62"
FT                   /protein_id="ABA72194.1"
FT                   /translation="MQFWRRSIQWQLILGMGTALLVSILIVVGIYTLVVNRLAQSYLVE
FT                   QALPSSIEATRNDIERILVQPLTAAKDIASNTMVRDWLANGEDSAKTAGFAQYLEGIRA
FT                   EHKAFTALIIGTESNHYITEKGLDRTLSRDKPADAWFYSFLDSNQPRTLNIDNDGATGE
FT                   LALFIDLKVEQAGKVVGVAGLGLSMKELSELIHNFSFGERGKVYLVRSDGLIQVHPEAQ
FT                   FSGKRTLSEQIGVSAAQAVMGHKVAANSSFQRDGEDFLAFSLPLRDLGWTLVAEVPRSQ
FT                   IYAEARRAMWMSSGIGLVVALVCLALVIWLAQGLVRPIRQVTAALVAIGSGGGDLTHRL
FT                   DSSRADELGDLARGFNRFLDSQRGMIGEVLTTSVRLRVAVGQVARVVDNTAERSGRQQE
FT                   MTDMVATAVHEMGLTVQEIAQNAGNAALASQTARDEAMQAREVVGGSIRHIESMSDEIG
FT                   VAAGAVGELAHQVASIDQVLAVIRGVSEQTNLLALNAAIEAARAGDMGRGFAVVADEVR
FT                   TLARRTQASTDEIQQMIGSLKQGAENAVSSMRTGQAATGTGVESSQRTGASLTAITGQV
FT                   ERISDMNHQVATATEEQSAVTEEINRNVQGISDLARATAGEVRACREDCQMLQRLADDL
FT                   ARQMGGFKLS"
FT   gene            complement(512653..514455)
FT                   /locus_tag="Pfl01_0451"
FT   CDS_pept        complement(512653..514455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0451"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72195"
FT                   /db_xref="GOA:Q3KJ61"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ61"
FT                   /protein_id="ABA72195.1"
FT                   /translation="MSETLLSSRNLAFELYEVLDAEGLTRRERFAEHNRETFDAAIGTA
FT                   RNIAEKYFAPHNRKGDENEPRYENGQAILIPEVKPAVDAFLEAGFLNAARSFDAGGMQL
FT                   PTLLSQACFAHFQSANAASTSYPFLTMGAANLIESFGTEEQKQRFLQPMIDGRFFGTMA
FT                   LTEPHAGSSLSDIRTRAEPASDGTYRLKGNKIFISGGDHPLSENIVHMVLAKLPDAPAG
FT                   VKGISLFIVPKFLVNDDGSLGKRNDVLLAGLFHKMGWRGTTSTALNFGDNGECVGYLVG
FT                   KPHHGLSYMFQMMNEARIGVGMGAVMLGYAGYLYSLEYARERPQGRVPDSKDPTTAPVA
FT                   IIQHADVRRMLLTQKSYVEGAFDLGLYAARLFDDTTTLEIEAERKQAHELLDLLTPIVK
FT                   SWPSEFCLKANELAIQILGGHGYTREYPVEQYYRDNRLNPIHEGTHGIQSLDLLGRKLA
FT                   QNGGAGLKQLIRLIANTAERAVPYESLTALREPLEKLVARLQSVTIGLLTDLAQGKVNS
FT                   SLANSALYLKVFGHAVIGWRWLEQAIRAEEGLAKGNAADADFYKGKLQAARYFLTWEVP
FT                   GCQHELTLLEARDDTCLAMQDAWF"
FT   gene            complement(514599..518552)
FT                   /locus_tag="Pfl01_0452"
FT   CDS_pept        complement(514599..518552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0452"
FT                   /product="bifunctional PutA protein"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72196"
FT                   /db_xref="GOA:Q3KJ60"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ60"
FT                   /protein_id="ABA72196.1"
FT                   /translation="MATTTLGVKLDDPTRERLKAAATSIDRTPHWLIKQAIFNYLEKLE
FT                   GGATLTELNGLTAKDADDAGEVHTDHAHQCFLEFAESILPQSVLRASITAAYRRPEPEV
FT                   VPMLIEQARLPAPMAEATNKLAATIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVAL
FT                   MCLAEALLRIPDKGTRDALIRDKISTGNWQPHLGNSPSLFVNAATWGLLLTGKLVSTHN
FT                   EAGLTSSLSRIIGKSGEPMIRKGVDMAMRLMGEQFVTGETIAEALANASKFEAKGFRYS
FT                   YDMLGEAALTEHDAQKYLASYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQY
FT                   ERVMDELYPRLLSLTLLAKQYDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGF
FT                   VIQAYQKRCPYVIDYVIDLARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKV
FT                   YTDVSYIACARKLLSVPEVIYPQFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEP
FT                   LYEQVVGKVSEGKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADQSVSIQ
FT                   ELVADPVAQIEQMATVEGGFGLPHPRIPLPRDLYGSERANSAGIDMANEHRLASLSCAL
FT                   LATAHNNWKAAPMLGCASSNEAPAPVLNPSDLRDVVGHVQEATVEDVDNAIQCALNAAP
FT                   IWQATPPAERAAILERAADLMEGEIQPLMGLLAREAGKTFANAIAEVREAVDFLRYYAV
FT                   QARNDFSNDAHRPLGPVVCISPWNFPLAIFSGQVAAALAAGNPVLAKPAEQTPLVAAQA
FT                   VRLLLEAGIPEGVLQLLPGRGETVGAGLVGDERVKGVMFTGSTEVARLLQRNIAGRLDN
FT                   QGRPIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADR
FT                   VIEMLKGAMAESRLGNPERLSVDIGPVIDAEAKAGIEKHIQGMRDKGRNVYQVAIADTE
FT                   EVKRGTFVMPTLIELESFDELQREIFGPVLHVVRYKRKEIDQLIAQINASGYGLTLGVH
FT                   TRIDETIAKVIDNVNAGNVYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLST
FT                   RPTDAIEQSFARADAAVAPDVRLRDAMSKPLTALKAWADSNKFADLSTLCVQYAAQSQS
FT                   GITRVLAGPTGEKNSYAILPREHVLCLADIEGDLLTQLAAVLAVGGSAVWPESDTSKAL
FT                   FARLPKEIQARIKLVSDWNKDDVVFDAVLHHGHSDQLRAVCQQIAKRAGAIVGVQGLSQ
FT                   GETNIALERLVIERALSVNTAAAGGNASLMTIG"
FT   gene            519009..520493
FT                   /locus_tag="Pfl01_0453"
FT   CDS_pept        519009..520493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0453"
FT                   /product="sodium/proline symporter (proline permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72197"
FT                   /db_xref="GOA:Q3KJ59"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ59"
FT                   /protein_id="ABA72197.1"
FT                   /translation="MSASNPTLITFVIYIAAMVLIGFMAYRSTNNLSDYILGGRSLGSV
FT                   VTALSAGASDMSGWLLMGLPGAIYMSGLSESWIAIGLIVGAYLNWLFVAGRLRVQTEHN
FT                   GDALTLPDYFSSRFEDKSGLLRIISAVVILVFFTIYCASGIVAGARLFESTFGMSYETA
FT                   LWAGAAATIAYTFVGGFLAVSWTDTVQATLMIFALLLTPIIVLLATGGVDTTFLAIEAQ
FT                   DPSNFDMLKGTTFIGIISLMGWGLGYFGQPHILARFMAADSVKSIANARRISMTWMILC
FT                   LGGTVAVGFFGIAYFSAHPEVAGPVTENHERVFIELAKILFNPWIAGVLLSAILAAVMS
FT                   TLSCQLLVCSSALTEDFYKAFLRKSASQVELVWVGRAMVLLVALIAIAMAANPDNRVLG
FT                   LVSYAWAGFGAAFGPVVLISVIWKKMTRDGALAGILVGAITVIVWKHFELLGLYEIIPG
FT                   FIFASLAIYFVSLMGQPSAGMVQRFEAAEKDFHLNK"
FT   gene            520721..522736
FT                   /locus_tag="Pfl01_0454"
FT   CDS_pept        520721..522736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72198"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ58"
FT                   /protein_id="ABA72198.1"
FT                   /translation="MFAPANQPRFTLTVEGAQFDLKVLEFTGKEAISQPFRFDLELVSE
FT                   RPDLDLESLLHCQAFLSFDEEGSGIHGQIYRVGQGDSGKRLTRYHVSLVPRLAYLGHRI
FT                   NQRIFQHQSVPQIVTQILKDHAILRDAFAFRLGSDYPPREYCVQYAESDLAFIQRLCAE
FT                   VGIHFHFQHSPDGHLLVFGDDQTVFPRLTEPTLYLPGSGMAASAPAIKRFTVRVETRTS
FT                   VVTRRDYDFTKPRLALQSRAESEQRPVLEDYHFPGQFTERETGKQLAQRTLERHVADYR
FT                   QAEGRSDQSALVSGHFLQLTEHPRQDLNDLWLLTAIEHRGRQPQVLEESVTSDGDDFQG
FT                   YRNTFFATPWDVFFRPPLGPEKPRMLGYQPAVVTGPQDSEIHCDEYGRVKVQLAWDRDG
FT                   ELNEHSSCWLRVASGWAHDRYGSVLIPRVGMEVLVGFIDSDADKPLVMGCLPNAATPVP
FT                   LELPADKTRSIFRSQSSPGGGGYNELRIEDRKGAEEIYLRAQRNWTQHVLNDQQVQVDN
FT                   QRSVVVTGLAKHELKADEQHITHGQRQTEVKQDDHLTVTGDRHIRVSNQAINASAQFHV
FT                   SAGQQVVIDGGASATIQAGGQWINIGPGGIFSSVPIVVGGAPMAAISAAPTVPGLPEKL
FT                   AAAPAAILTAAQIMSLKGDAPFCEECERCKGGVCAA"
FT   gene            522753..523433
FT                   /locus_tag="Pfl01_0455"
FT   CDS_pept        522753..523433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72199"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ57"
FT                   /protein_id="ABA72199.1"
FT                   /translation="MPLKPSEQLFAIFSSASAAEPLKAWPLKAQMPKPVWAETIYAEWD
FT                   AVMPYVGIVDAGSEFLDWVATTESRDWGWLAVSSAGLEAVVEHFRSLTQVLMPDGKAVF
FT                   FRFWDGRFLLPILESSEVDAGQLLPVLTRGLINGQTVEIGGRARVSGREFPWWSVPEKL
FT                   LAQFGDDARINNALQWLSEEQPALFEAFPADVLRCKVVRFFAVSASDESSASALLDYLR
FT                   DESE"
FT   gene            523763..524080
FT                   /locus_tag="Pfl01_0456"
FT   CDS_pept        523763..524080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72200"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ56"
FT                   /protein_id="ABA72200.1"
FT                   /translation="MSTLHPDPPYEPFIPHPDNRLMALTSNCNDMPTLFIDTHAPLDIL
FT                   MDAANYRIRAVIQVLENMCMRGSVECDSVILSDFAQLCVIPLRDGCDVLDVIGRKLRDR
FT                   P"
FT   gene            complement(524384..524797)
FT                   /locus_tag="Pfl01_0457"
FT   CDS_pept        complement(524384..524797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72201"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ55"
FT                   /protein_id="ABA72201.1"
FT                   /translation="MRRPIISLLCLLSSYQIVASEGRTEQARQNLKNYGLSHCILAPFK
FT                   EHSAMKKDIELSAGAYSFMGKGLHTIVQNEDTLEVTHDPYAETEKHMADAYLKTSSTSK
FT                   QAGKNIVFYSCLEIYNSPEFDAFIKSQDRYLQN"
FT   sig_peptide     complement(524738..524797)
FT                   /locus_tag="Pfl01_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.602 at
FT                   residue 20"
FT   gene            525178..526017
FT                   /locus_tag="Pfl01_0458"
FT   CDS_pept        525178..526017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72202"
FT                   /db_xref="GOA:Q3KJ54"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ54"
FT                   /protein_id="ABA72202.1"
FT                   /translation="MNYRHAFHAGNHADVFKHLTLTRLIALMSRKEQPFAYLDSHAGIG
FT                   LYDLQGDQANRTGEYLEGIARLWDQPDLPALTADYMNVLHEMNPDGQLRYYPGSPELAR
FT                   RLTRSQDRVLLNEKHPEDGVLLKDNMKGDRRVAVHLGEGWHVARALLPVAEKRAVMLID
FT                   PPFEKLDEMQRCAASLREAISRMRQTVAAIWYPVKDQRALRRFYQDLAGTGAPKLLRVE
FT                   LLVHPLDTPNSLNGSGLAIANPPWGLEEELRELLPWLSKKLGQTQGGWQMDWLIAES"
FT   gene            complement(526067..526732)
FT                   /gene="msrA"
FT                   /locus_tag="Pfl01_0459"
FT   CDS_pept        complement(526067..526732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Pfl01_0459"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72203"
FT                   /db_xref="GOA:Q3KJ53"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ53"
FT                   /protein_id="ABA72203.1"
FT                   /translation="MVLRSEILVNKNVLPTKEQALPGRETPMALPEKHFVFTETPLLGP
FT                   FFQDVDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPNPTYEEVCSGLTGHAEVV
FT                   LVVFDKAKVSYEELLAMFWELHNPTQGMRQGNDIGTQYRSVIYATHPEQLDAALKSKAV
FT                   YQAELSKAGLGEISTEIEQAPTVYFAETYHQQYLAKNPEGYCGIGGTGVCMPPSLAGN"
FT   gene            complement(526838..529534)
FT                   /locus_tag="Pfl01_0460"
FT   CDS_pept        complement(526838..529534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0460"
FT                   /product="conserved GGDEF/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72204"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ52"
FT                   /protein_id="ABA72204.1"
FT                   /translation="MKSQPDAASRMVAEVVTQLPVPSRLGMLRFERLNEASWAMLFLDP
FT                   NCERQFGQPAVELCALVGSPYASLMEPEARYQLHDAIQQQLGQSPHYLVRYTLHTAAGA
FT                   LSILELGEAYKQHNRHLLRGYLLAVDNVFDETPSLPSVDLETQNSRLQIALELNQRAQQ
FT                   EQLQHLERVRAQQDLILLLARQRYSSQNSLQEAAELITRCACDIYEIDCASLWNLEGQK
FT                   LVPISAYHRATQEYILPDVIDVSGFPDYMDALHGSRAIDAHNAMRDPRTREMAEALRPR
FT                   DVNAMLDASIRVDGQVVGVLCLEQTGVTRAWQSDEIAFAGELADQFAQVINNHNRRTAT
FT                   SALHLFQRAVEQSANAFLLVNCDGVVEYVNPSFTAITQYTTEEVHGQRLSELPALENLS
FT                   ELLFDAPSALAKSNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDITQT
FT                   KLAQQRIERLAYTDNLTNLGNRPAFIRNLDERFARDSDTPISLLLVDIDNFKRINDSLG
FT                   HQTGDKLLISLARRLRNSLSPSGSLARFASNEFAVLLDDTDLATGQQIANQLLATLDKP
FT                   MFVDNQLISVTGSVGLACAPLHGRDPQTLMRNAGLALHKAKANGKHQVQVFTEALNAEA
FT                   SYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGMEALLRWNHPERGMIRPDQFISV
FT                   AEETGLIIPIGKWIARQACRMSKALTAAGMGNLQVAINLSPKQFSDPDLVASIANILKE
FT                   EALPANLLELELTEGLLLEATEDTHLQLDQLKRLGLTLAMDDFGTGYSSLSYLKKFPID
FT                   IIKIDRSFIHEIPDNQDDMEITSAVIAMAHNLKLKVVAEGIETAEQLAFLRRHRCDVGQ
FT                   GYLFDRPIPGGELIQALKRYPRGPLSL"
FT   gene            complement(529774..531183)
FT                   /locus_tag="Pfl01_0461"
FT   CDS_pept        complement(529774..531183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72205"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ51"
FT                   /protein_id="ABA72205.1"
FT                   /translation="MDSNMLKPTVGPIIGHTTTNQARIFIRGGLQHNAAVFAGIRYRTL
FT                   DSKQWQPSQFVKLDPTRDMTEVLVLDHLQADTDYEYQTGWFSPMSPVHTIHSVAELPLQ
FT                   WPRETYRLRTRSHQPLQPRAYILGSCRYLRMTSGIPVLPHLGDRIFASISQLIEGAQPA
FT                   ISAIMMCGDQIYADDLNLFAPDRDYDEIIAKYRAAFSLPNIRRLMSGTSTYMILDDHEI
FT                   EDNWPMNAEKSDDILFRNAMAAYEIYQASHSPICSTTTNGTIDLTSLKHYWYQFSDGDI
FT                   EWFVTDSRTRRNLSRDNRRLLDEEQEQALCKWLVESPARVKFVVTSVMFYPDRKLNGDD
FT                   AWAGFPEQRLRLLETIRRHRIRNVVFISGDVHGSLTSRLSHSEDPEFEVHTVVSSPLSN
FT                   SKLLPYATAATFTLDQPLAQTEAGTYRHALTSQVISQDNFAHMVVEAERIQVNYHDRDG
FT                   RHLQSIDIPLR"
FT   gene            complement(531451..533406)
FT                   /locus_tag="Pfl01_0462"
FT   CDS_pept        complement(531451..533406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0462"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72206"
FT                   /db_xref="GOA:Q3KJ50"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ50"
FT                   /protein_id="ABA72206.1"
FT                   /translation="MSELIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASME
FT                   VPAPKAGVIKSLKVKLGDRLKEGDELLELEVEGAAQAAPAPAAAPAAKAEAAPAAAPAP
FT                   AAPAAAPAAASVQQVHVPDIGSSGKAQIIEIQVKVGDTVEADQSLITLESDKASMEIPS
FT                   PAAGVVKAISVKLNDEVGTGDLILDLEVAGAAAPAAAAPAQAAAPAAAPAPAAAPAAPV
FT                   ADSVQDIHVPDIGSAGKAKIIEVLVKAGDSVEADQSLITLESDKASMEIPSPAAGVVES
FT                   ISIKLDDEVGTGDLILKLKVKGAAPAAAPAPAAAAAPSAPAPAAAPAAAAPAAAAPVAA
FT                   PAKPGAKVHAGPAVRQLAREFGVELSAVGASGPHGRILKEDVQTYVKAMMQKAKEAPAA
FT                   AAGATGGAGIPPIPVVDFSRFGEIEEVPMTRLMQVGAANLHRSWLNVPHVTQFDSADIT
FT                   ELEAFRTAQKSVAEKAGVKLTILPLLLKSCAHLLKELPDFNSSLAPSGKAIIRKKYVNI
FT                   GFAVDTPDGLLVPVIKNVDQKSLLQLAAEAASLAEKARTKKLSSDEMQGACFTISSLGH
FT                   IGGTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARF
FT                   TKRLSDLLADIRTILL"
FT   gene            complement(533418..536063)
FT                   /locus_tag="Pfl01_0463"
FT   CDS_pept        complement(533418..536063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0463"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72207"
FT                   /db_xref="GOA:Q3KJ49"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ49"
FT                   /protein_id="ABA72207.1"
FT                   /translation="MQDLDPVETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGSQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSLVRWNAMAMVMRTNLKDSDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTDEHGGDLIYFQGHTSPGVYARAFMEGRITEDQMNNFRQE
FT                   VDGQGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEHRGFIQPGKQKVWCF
FT                   LGDGECDEPESLGAISLAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGVFRGAQ
FT                   WNVTKVIWGRFWDPLLAKDVDGILQRRMDEVIDGEYQNYKAKDGAFVREHFFNTPELKA
FT                   MVADLSDDEIWKLNRGGHDPYKVYAAYHEAVNHKEQPTVILAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLKLFRDRFDIPVKDEELENLPFFKPEPNSAEARYLAERRAALGGFVPQR
FT                   RAQSFSVPTPDLDTLKAILDGSGDREISTTMAFVRILAQLVKDKEIGPRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYKEDQKGQILEEGINEAGAMSSFIAAGT
FT                   SYSSHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHLLAATIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYITVMNESYQQPAMP
FT                   AGAEEGIKKGMYLLEEDTRDAAHHVQLMGSGTILREVREAAKILREEFNIGADVWSVTS
FT                   FNELRRDGLAVERSNRLKPGQKPKRSYVEECLSGRKGPVIASTDYMKLFAEQIRQWVPS
FT                   KEFKVLGTDGFGRSDSRKKLRHFFEVDRHFVVLAALEALADRGDIEPKVVAEAITKFGI
FT                   DPEKRNPLDC"
FT   gene            536448..539387
FT                   /locus_tag="Pfl01_0464"
FT   CDS_pept        536448..539387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0464"
FT                   /product="putative glutamate-ammonia-ligase
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72208"
FT                   /db_xref="GOA:Q3KJ48"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ48"
FT                   /protein_id="ABA72208.1"
FT                   /translation="MTLPALAELPAILLPLVSRSEQSFRAAVAQLEDDHGFSSWTPERW
FT                   AQFARVSAASDFVIEQGVRDPFMLLSLVQSGELDRPFARGELCGQIAEAVSTAQTEDEL
FT                   GRVLRRQRTRHQVRIIWRDLNRQADLVQTCRDLSDMADASIDQAYQWLYRRHCEQFGTP
FT                   TGRRSGEPQQMVILGMGKLGAVELNLSSDIDLIFAYPEGGETVGVKRPLDNQEFFIRLG
FT                   QRLIKALDPITVDGFVFRVDMRLRPYGSSGALVLSFNALEQYYQDQGRDWERYAMIKSR
FT                   VVAGDQVAGEQLQEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMADNIKLGSGG
FT                   IREVEFIAQAFQLIHGGRDLSLQQRPLLKVLSTLEGQGYLPPAVISELREGYEFLRYTE
FT                   HAIQAIADRQTQMLPDSAQDQARIAFMLGFSDWDAFHEKLMFWRGRVAWHFAQVIADPD
FT                   EDEGVESEVVVGGEWLPLWEEAQDEEAACRQLEEGGFADATKALKALASLRASPQLRAM
FT                   QRLGRERLDAFIPRLLAQAVEHENPDLVLERVLPLVEAVARRSAYLVLLTENPGALRRL
FT                   LTLCAASPWIAEQITRFPLLLDELLNEGRLFKPPLAPELAAELRERLTRIPEDDLEQQM
FT                   EALRHFKLAHRLRVAASEIAGSLPLMKVSDYLTWLAEAILEQVLALAWRQTVAKYGTPL
FT                   RTDGTLCDPGFIIVGYGKVGGIELGHGSDLDLVFIHDGDQQAETDGPKPIDGTQFFTRL
FT                   GQRIIHLLTAQTNSGQLYEVDMRLRPSGASGLLVSSLGAFARYQENEAWTWEHQALVRA
FT                   RVLVGSKDVGQAFENVRAQVLGKARDLAKLQQEVSEMRAKMRDNLGSKSTAAGTGANAF
FT                   EATAPFDLKQDAGGIVDIEFMVQYAALAWSQTHPALLRWTDNIRILEELEHEGLMPAED
FT                   ASLLREAYKAYRSAAHRQALQKDAGVIPGDQFADERRQVMRIWRELGLS"
FT   gene            539439..540473
FT                   /locus_tag="Pfl01_0465"
FT   CDS_pept        539439..540473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0465"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72209"
FT                   /db_xref="GOA:Q3KJ47"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ47"
FT                   /protein_id="ABA72209.1"
FT                   /translation="MNILIVGPSWVGDMVMAQTLFQCLKQRHPQCEIDVLAPEWSRPIL
FT                   ERMPEVRKALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKR
FT                   TGWRGEFRYGLLNDVRTLDKERYPLMIERFMALAFEPNAELPKPYPRPSLQIDPVTREA
FT                   ALAKFGLTLDRPVLVLCPGAEFGEAKRWPSEHYAKVAEARIREGWQVWLFGSKNDHAVG
FT                   EDIRARLIPGLREESVNLSGGTSLAEAIDLMSCADSVVSNDSGLMHVAAALNRPLVAVY
FT                   GSTSPGFTPPLAEHVEIVRLGLDCSPCFDRTCRFGHYNCLRQLMPDAVNDALQRLQGSV
FT                   VEVH"
FT   gene            540475..541536
FT                   /locus_tag="Pfl01_0466"
FT   CDS_pept        540475..541536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0466"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72210"
FT                   /db_xref="GOA:Q3KJ46"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ46"
FT                   /protein_id="ABA72210.1"
FT                   /translation="MRVLLIKTSSLGDVIHALPALTDAARAIPGIRFDWVVEEGFAEIP
FT                   TWHPAVSKVIPVAIRRWRKNIWKTITGGEWKRFKQSVRANKYDLVIDAQGLLKSAWLTR
FT                   YVKAPVAGLDKGSAREPIAARFYDRKLAVARGQHAVERVRQLFAIALGYDLPKGLGDYG
FT                   LNVERLVELPRKNAYVVFLHGTTWDTKHWPEAYWRELTERVGYLGVGIKLPWGNPLEKA
FT                   RAERIAAGFKHAEVLPKLNLAGVGKVLAGAQACVAVDTGLGHLAAALDVPTISLFGPTN
FT                   PGLTGAYGKLQIHLGSDFPCAPCLQKKCTYQPTAQDAGQFDLKREWPLCFTRLNPERVA
FT                   SRLSTLLMAEELR"
FT   gene            541536..542657
FT                   /locus_tag="Pfl01_0467"
FT   CDS_pept        541536..542657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0467"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72211"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ45"
FT                   /protein_id="ABA72211.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGDV
FT                   PPGFEVLVAPVKAFFNHRRNEKLSAWMEADLAKRPVDRLIGFNKMPGLDVYYAADGCFE
FT                   DKAQNLRNSLYRRWGRYRHFAEYERAVFAKDAKTEVLMISEVQQPLFIKYYDTPLERFH
FT                   LLPPGIAQDRRRPADADQIRAGFRAEFNLKDDELLLVQIGSGFKTKGVDRSLKTLAALP
FT                   AELKKRTRLFVIGQDDPKLFQMQSATLGLGDNVTFLKGRSDIPRFLLGADLLIHPAYNE
FT                   NTGTVLLEALVAGLPVLVSAVCGYAHYIAEADAGRVLDEPFDQAQLTQYLTDMLNDDAA
FT                   RAAWSRNGLAFAETADLYSMPQHAADVILAEHA"
FT   gene            542658..543464
FT                   /gene="rfaP"
FT                   /locus_tag="Pfl01_0468"
FT   CDS_pept        542658..543464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaP"
FT                   /locus_tag="Pfl01_0468"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72212"
FT                   /db_xref="GOA:Q3KJ44"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ44"
FT                   /protein_id="ABA72212.1"
FT                   /translation="MKLMLAEPFKSLWAGRDPFAEVEGLQGEVYRELEARRTLRTEVDG
FT                   NGFFVKIHRGIGWGEIFKNLLTAKLPVLGAGQEWKAIQRLQEVGVPTMTAVAYGEKGSN
FT                   PADQHSFIVTEELAPTISLEDFSIDWVKQPPQPKLKRALIAEVARMTGMMHRAGVNHRD
FT                   CYICHFLLHTDKPVTPEDFKLSVIDLHRAQTRPAITQRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQQPLRRILAEEAPLLSWLEGKANKLYARKQRYGDAL"
FT   gene            543464..544198
FT                   /locus_tag="Pfl01_0469"
FT   CDS_pept        543464..544198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0469"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72213"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ43"
FT                   /protein_id="ABA72213.1"
FT                   /translation="MAGWNLEPEYSDLAQHFGSLEAVFALQGERLTRDPLSEVIRVQLN
FT                   GVNYYVKRYVGAGKGLRRYLGKPRVKMEWQNLKRFAKWGIPTAEVVAWGLERNGMAYDR
FT                   GAMITRELPRTEDLSALAERNDPKLKDRAWVDGVSRQLAGYTRVMHDHRFTHNDLKWRN
FT                   LLIDDQAQLFLIDCPNGDFWRGFWLKYRITKDLACLDKVAKYHLSNTQRLRFYLQYRQR
FT                   DRLNAADKQRIRHVVRFFEGRE"
FT   gene            544195..544947
FT                   /locus_tag="Pfl01_0470"
FT   CDS_pept        544195..544947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0470"
FT                   /product="putative lipopolysaccharide biosynthesis-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72214"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ42"
FT                   /protein_id="ABA72214.1"
FT                   /translation="MTDFLSAEDRALLERHGLGTFDALWSKQLDAVDEPNTDGGGWSSV
FT                   FRLDLEGHGYYLKRQCNYLTRTLHAPFGEPTFAREFRNISRYNKLGIPALQAAFFGERK
FT                   VNGEVRAILLTRALDGWDDLDSLLQRWSDLDAAQQSAILKSCGLLARHLHGMRQVHGCF
FT                   YPKHIFLRAEGDGYQAQLIDLEKTRPLLFGMRDRVKDLEPLLRRAPEWSEAQLRELLAA
FT                   YLDQSTDSSLVDSWVTRLTARRSRKETR"
FT   gene            544947..546398
FT                   /locus_tag="Pfl01_0471"
FT   CDS_pept        544947..546398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72215"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ41"
FT                   /protein_id="ABA72215.1"
FT                   /translation="MQLSDLKNAGRTPSLPLTVSLADAAGAADLQLLSLLRVLPGQRYV
FT                   GAGVWRGRAVLAKLLVGSKAARHFQRELEGVKLLAAQGMTTPLLLADGLKDGEGGWLLF
FT                   EFLEGAESLGDAWSKVESLPVLADEQSAVLAEALGAIGQLHGKGLWQEDLHLDNLLRHG
FT                   GQLYLIDGAGICAENAGQPLSRQKVLENLGVFFAQLPKSLEPFTEELLVYYLLSNSEHA
FT                   LPLEALQKQIDKVRAWRLRDYLIKVGRECTLFSVKRGAFALRSIRREEEAAMLPVLEQA
FT                   DALLDQGHLYKTGGAASVGKVEVAGRALVIKRYNIKNFAHWLKRFWRPSRAWHSWREGN
FT                   RLAFLGIATPKPLAVLETRFFWLRSKAYLITEHLAGPDIIERFAPYVESGEAPEAELQA
FT                   LDQLFARLIAERISHGDFKGHNLFWQEDRWALIDLDSMCQHGSLGSFAPAYARDRARFM
FT                   RNWPENSALYQVIDQRLPKDVAGAA"
FT   gene            546522..546893
FT                   /locus_tag="Pfl01_0472"
FT   CDS_pept        546522..546893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0472"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72216"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ40"
FT                   /protein_id="ABA72216.1"
FT                   /translation="MLVCPDVPGGQILTIKNAIAIGAFSLALSGCGTAVTVLQGDEAAT
FT                   RGLRKQKTYCQSIPRIYSGLAHDFCLLHAPPDPTGILVPVVLLDLTLSGVFDTAFLPYT
FT                   IYRQAVDGNISVYWRPSRG"
FT   gene            547066..548823
FT                   /locus_tag="Pfl01_0473"
FT   CDS_pept        547066..548823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0473"
FT                   /product="putative carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72217"
FT                   /db_xref="GOA:Q3KJ39"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ39"
FT                   /protein_id="ABA72217.1"
FT                   /translation="MALTILGLSGALSHDPSAALYIDGKLVAAAEEERFVRDKHAKNRM
FT                   PYESAKFCLEQAGIKPSDVDVVAIPFAPISIFGKARWQYAKRYWYAPDRALDAILMGNR
FT                   RYKRYRNKIVWCLEQLGFDPKKIKIEPVEHHLAHASSAYHCSGFKEKTAILGIDGKGEY
FT                   ATTFFGYGENGKIHKIKEFFDPDSLGGLYGAITEFLGFDMLDGEFKVMGMAPYGDASKY
FT                   DFSRLASFENGELVINTDYANVIGLRRYKEKGKGYYFSPKLIEWLGPKREGDIADEPYI
FT                   HYAASIQALFEKIALQMIDYYLGDVLKETGKLAYAGGCALNVKLNQKIIARDDVKELFV
FT                   QPASGDAGTAVGAAAYVSNARGVPVEKMEHVYLGPSYSNEDVIAACARHENKPTWRKLD
FT                   NMPEQIAKIMVDGNPVAWFQGRMEFGPRALGGRSIIGCPSVAGVADRINHQIKFRERWR
FT                   PFCPSMLDTVAPQMIKIDHPAPFMTFTFEVAEEWKTRVPEVVHEDGTSRAQVLKREYNP
FT                   RYYDMMKALEVLTGNGVSLNTSLNRRGEPMICSPTDALNMFFGSDLQYLIMEDILVVKE
FT                   GANAYDTLG"
FT   gene            548807..549937
FT                   /locus_tag="Pfl01_0474"
FT   CDS_pept        548807..549937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0474"
FT                   /product="putative glycosyltransferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72218"
FT                   /db_xref="GOA:Q3KJ38"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ38"
FT                   /protein_id="ABA72218.1"
FT                   /translation="MTRSAERHVLQFCHGYDGPFLDCARQYASLFAGTGYRVTTVFLTG
FT                   AADSEVAAACASDEVLFMEYSSKAIRGLKLGAIGDLRKIAASRNFSFCIAHRFKPIYIA
FT                   LLGTSLPVIGVHHAFGDYKRGSRKLFAHIFRKRLSLLGVSDAVRDDMRRCLPKWPATRI
FT                   QTLYNRIDVSALQMSQVSAREARETLGLSADAFIVGNVGRLHPDKDQATLLRGFAAALP
FT                   GLPANSQLVILGKGRLEDELKAQARELGVGDRVLFLGQVPDARNYFRAFDVFALSSDHE
FT                   PFGMVLLEAMAAGVPLLATACGGAKEVVEGVGILFPLGDAEHLAQGLKHLAGMDEQQRR
FT                   QCAEMMFDRLRERFSDRAVRDTFWHLPQVTDLAPRG"
FT   gene            549937..550833
FT                   /locus_tag="Pfl01_0475"
FT   CDS_pept        549937..550833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72219"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ37"
FT                   /protein_id="ABA72219.1"
FT                   /translation="MLNRFQGWRERGWSPVDASTYAQAWQRFGGSVATHPMVVERLADL
FT                   AGIPVRYLAWEQQGEVKAAIPTWGRDLALSKDVLKRNGKKGLFDLGNAELILPAAADAQ
FT                   APLRHRGRYLSALNENRFSGLKLQTEQLAMARTPEELSKKFRYNQRRELRLLEEAGGVV
FT                   RPVSDFSSAELAAIYCDLFQRRWGFPATGAARMAEVIELLRELLIGSVIFLNDAPIAIQ
FT                   LVYRVEAPEWISVEYINGGVDPETREFSPGSVLSFLNTQSAWEHARALDKPLRFSFGRA
FT                   DREYKDRWCNPVPVFTV"
FT   gene            550830..552287
FT                   /locus_tag="Pfl01_0476"
FT   CDS_pept        550830..552287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0476"
FT                   /product="putative deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72220"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ36"
FT                   /protein_id="ABA72220.1"
FT                   /translation="MSQPMSRKQQLLKRHRRNKRISLLIALLVLIALGVLVAWWLPLVL
FT                   AVVGWIAHEAWFADHLFYSPKDDYQYSFPPFTPQPKVHLNGEQLRLDEGVMLVDDATLI
FT                   LAVKVKSSFLGRFFDPRVELAGGTHPDAQTFERGVNGLRYLNLSGQAQALSQGQLRLRG
FT                   RFCRVSGEPVLWALEQPDYRQQRVMVIAPHADDAELAAYGLYSQAKEAWIVTLTAGEIE
FT                   AEHYQQMGLNKVEAARLKGRLRAWDSLAVPRWAGVPQEHCVQLGYFCLQLAAMQAAPNQ
FT                   PVGSREADLSDTRLFRQLNPFALPGDADGAPTWNNLLADLRDVLLRARPDVIVLPHPTL
FT                   DPHPDHICAQEAVLEALRGLDYQPTLLGYANHLHDNDRWPMGDSGQGIALPPTFDATHA
FT                   MQPLCLPLSIQLQRDKAMALGMMHDLQPPAPFKRRLRRLFQRLLAGRRPSVYGENEFFR
FT                   KAVRRQELFWVLKQSETGATGSHRGEV"
FT   sig_peptide     550830..550946
FT                   /locus_tag="Pfl01_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.502 at
FT                   residue 39"
FT   gene            552284..553438
FT                   /locus_tag="Pfl01_0477"
FT   CDS_pept        552284..553438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0477"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72221"
FT                   /db_xref="GOA:Q3KJ35"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ35"
FT                   /protein_id="ABA72221.1"
FT                   /translation="MSQRAKVLQLQPDYNVKSHDFADLAEQIVKALPTDRYEVTAAFLR
FT                   GKPGPGEAVSRADRSVYFEFSDKSLKGMRLRAMWQLYKFCRREKFDVVICNRFKPVNMM
FT                   LTLNRWLKVPLCIGISHGFGEYDRFYRRRQTQRLIDRHWRFVGVSPAVKQYLLDCDCGF
FT                   TDQNTYAITNAIDIEQAEGLQHSRERARELLGIDPNVRLIGALGRLVSVKGHTYLLQAF
FT                   AQLKDKYPNAQLAIIGAGRLQAPLAAEIEQLGLSGRAHLLGFKENALQYVRAFDIWTMP
FT                   SLAEGLGLALLEGMSGHLPVIASNVPAMLPLIEGAGGLSITPKDVPSLVAALDSYLALS
FT                   DDELKAKGEQAYRYLQEQHDIEVFRQEYLNLIDSGLEQARKEQP"
FT   gene            553435..554337
FT                   /locus_tag="Pfl01_0478"
FT   CDS_pept        553435..554337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0478"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72222"
FT                   /db_xref="GOA:Q3KJ34"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ34"
FT                   /protein_id="ABA72222.1"
FT                   /translation="MSDSAATSAEQPLVTVIIASYNHGPYIEESILSVINQSYKNIELL
FT                   VVDDGSKDDSVERINALQAQYGFDFRVQQNQGLTNTLNGAIARAKGSLIVPFGSDDIMY
FT                   PDRIDTQVAYMDGKPEVGICAGNIELMDADGNLYPEKRQRRDVPFRRLDFDDMFLERKP
FT                   YPPAPTLMIRREALDKVGGFDPTIRLEDLYIELKITRAGYFIDGLNVVMARYRKHATNS
FT                   YKNHRFMIENILRTYALFSDHPLYDEVRYKSLNSMFLKTANRDRKLARELLAQIPFKAW
FT                   NKKTWRGLGRLLFSPLEKD"
FT   gene            complement(554356..555573)
FT                   /locus_tag="Pfl01_0479"
FT   CDS_pept        complement(554356..555573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0479"
FT                   /product="putative O-acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72223"
FT                   /db_xref="GOA:Q3KJ33"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ33"
FT                   /protein_id="ABA72223.1"
FT                   /translation="MIQTSPFIAPAAYLLAIVSAALLLRAVPKIARHLQHSGESRYASI
FT                   DGLRGYLAFGVFVHHSVITWIFLRTGVFEFPPSNFYSMLGQGSVALFFMITGFLFWSRL
FT                   LTQGRQHDWLAFGVSRVFRLYPLYLPLMLAVFVTVFYLQDWQLKEPVSQLLKQSLLWLT
FT                   FDRPDVNQYPQTGMLISNVTWTLAYEVFFYLALPLAALVFVYRSNWRQVVLCLIGIYAL
FT                   YQLVGWEHSLKKHFLASFLGGITAAYWVRRPQLVAWSRTTLASIIALAALALAFTAFNR
FT                   AFKTAPLFLLSLFFVIVASGNTLFGALKPRSIRWLGEISYSTYLLHGFVLWLMVQRLPL
FT                   LLHLDARETWVYLPLMAACTCLLILISSATFLYIEQPGMNAGKKVVQWIRQRQKGSKHL
FT                   SEKVAR"
FT   sig_peptide     complement(555493..555573)
FT                   /locus_tag="Pfl01_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.752 at
FT                   residue 27"
FT   gene            complement(555573..557435)
FT                   /locus_tag="Pfl01_0480"
FT   CDS_pept        complement(555573..557435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0480"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72224"
FT                   /db_xref="GOA:Q3KJ32"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ32"
FT                   /protein_id="ABA72224.1"
FT                   /translation="MQFSGFSSTSSRIFDFISLWILPVGYFLLLCALFFLPGRSLHHKL
FT                   FYGLFSIPTLIALCLRPRELKEMLREPVFIALLLFAGWALLSLCWGPQDEPIGGMFKPP
FT                   LHTLMLFAGCFLLVRYRSDILTPLLFAAALVALIATIAFLIPFMLHFEPGARLIGGGAF
FT                   DNPLLSSHLFGFFCAYWLSLSMTCKNRRLYWLSIPAMLIMFMAVIGTGSRTPLVALTMA
FT                   ALWLSLICWNRRSLVLLGTLAIGGATVVVLFSKMIIERGDSYRFEIWQQALEKIAEHPW
FT                   IGHGYNAVLAIDPGVGYNFQEPHSFALGVLYYVGILGMLPWLFFQAWGLLSSWRQRVQP
FT                   LLIIASTWLVFGIGAGLTEGGGIISRPKEHWFLLWIPLALIAALSINQRARRLLAMPVQ
FT                   KLSATALQQLSSDAQVIEEDGLGPKVLRLSDGSFLKLFRHRRWYTSGSFNPYSERFAVN
FT                   SEQLRRMGIPTPQVLNLYRLDDGSSAVHYTPLPGHTLRQVLQGITAPAVRHALVERFGK
FT                   FMASLHEQGVYFRSLHLGNVLVLEDGEFGLIDLADLRIYPSPLSLSLRQRNLRHMQRYT
FT                   VDRRWLFEDHLEALLQGYAVTASKSAVDNLHRQVLAGNTPARVH"
FT   gene            557590..559392
FT                   /locus_tag="Pfl01_0481"
FT   CDS_pept        557590..559392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0481"
FT                   /product="lipid A export ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72225"
FT                   /db_xref="GOA:Q3KJ31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ31"
FT                   /protein_id="ABA72225.1"
FT                   /translation="MTDSSPAASPSSLKIYFRLLGYVRPYISLFLISIVGFLIFASTQP
FT                   MLGYILKYFVDGLSNPEAVLFPTVPYLRDLQLLQAVPLLIILIAAWQGLGSYLGNYFLA
FT                   KVSLGLVHDLRVQLFNNLLVLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIRE
FT                   GMTVIFLFASLLFMNWKLTLVMVAILPLIAVMVRTASKKFRKQSKKIQLAMGDVTHVAS
FT                   ETIQGYRVVRSFGGEAYEEKRFLDASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAILM
FT                   FLVLYLRGDASAGDMVAYITLAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEV
FT                   DTGTVERDSVSGRLDVRNLSFTYPGTERQVLDDISFSVEPGQMVALVGRSGSGKSTLAN
FT                   LIPRFYHHDKGEILIDGVEVEQYKLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAP
FT                   REDIEKAARDAYAMDFIAQLPEGLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILD
FT                   EATSALDTESERHIQAALDQVMKGRTTLVIAHRLSTIEKADLILVMDQGRIVERGTHDD
FT                   LLAQNGYYARLNAMGLDAPAEDIA"
FT   gene            559557..560261
FT                   /locus_tag="Pfl01_0482"
FT   CDS_pept        559557..560261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72226"
FT                   /db_xref="GOA:Q3KJ30"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ30"
FT                   /protein_id="ABA72226.1"
FT                   /translation="MLQRYLWKLLPKPQRAFLLGRLSVVDRQVVNKSMSASLAFPAAFE
FT                   QRDCLFIHVPKCAGSSLCAAMFDGWRPGHLPLYWYEEQFPEQYAAAYKFAFVRDPLERA
FT                   YSAYAFLHGNTLSGRDHAAQQMVRQYRDFDDFVARWLHPETISRQLHFAAQTDFLTDSL
FT                   GHLALDFIGYQEHLEQDFKQVCDRLGMVCQLPHVNSSRQRQPLKAREFCSARTRRLVRR
FT                   AYQRDYELLGYE"
FT   gene            560254..560865
FT                   /gene="cysC"
FT                   /locus_tag="Pfl01_0483"
FT   CDS_pept        560254..560865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="Pfl01_0483"
FT                   /product="adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72227"
FT                   /db_xref="GOA:Q3KJ29"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ29"
FT                   /protein_id="ABA72227.1"
FT                   /translation="MNEALHSLATTPAISPYNLALPRQARAALNGQRPRCLWLTGLSGA
FT                   GKSTLANSLELHLHQFGRHTFLLDGDNVRNGLCRDLGMDDAGRRENIRRMAEVARLMVD
FT                   AGLIVIVAAISPFRAERDAARRLFAEGDFVEVHVSTSLTVCERRDPKGLYQAVRQGRIQ
FT                   HFTGIDSPYEAPLAAECRIDTEEIEPSEACERLAALLLEK"
FT   gene            560968..562392
FT                   /locus_tag="Pfl01_0484"
FT   CDS_pept        560968..562392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0484"
FT                   /product="D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72228"
FT                   /db_xref="GOA:Q3KJ28"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ28"
FT                   /protein_id="ABA72228.1"
FT                   /translation="MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQ
FT                   IEDRPGGAANVALNIAALGAPASLVGVTGDDEAADSLSNSLKGAGVRALFQRIAHQPTI
FT                   VKLRVMSRHQQLLRIDFEEPFATDALALGAQVDDLLEGIKVLVLSDYGKGALKNHQALI
FT                   QAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFEAIVGGCADEHELVTKGATLMHDL
FT                   DLGALLVTRGEHGMTLLRPDHPALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPH
FT                   AVALANLAAGIVVGKLGTAAISAPELRRAIQREEGSERGVLGLEQLLLAVADARAHNEK
FT                   IVFTNGCFDILHAGHVTYLEQARAQGDRLIVAINDDASVSRLKGPGRPINSVDRRMAVL
FT                   AGLGAVDWVISFAEGTPENLLREVKPDVLVKGGDYGIDQVVGADIVKAYGGAVKVLGLV
FT                   ENSSTTAIVEKIRKSE"
FT   gene            complement(562459..563427)
FT                   /locus_tag="Pfl01_0485"
FT   CDS_pept        complement(562459..563427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ27"
FT                   /protein_id="ABA72229.1"
FT                   /translation="MPRTLIRKNPSNFKTLPLFVEATPEGLTYQSVGMPLNFAQTLQRR
FT                   KPVSVADAERFALELANLGVSVRLTLHWQNRDYWVLVRQRRQDRGDVVLKLISGYVPAH
FT                   ELNIPLHTAIQEIAEECLLETPEGWLGGRFNDTWLPAPYASALHYREALPFRLTPLSGS
FT                   ARPVRCANLQLLERPRAYVHLPTASLQLIYDLRLDVPKEAKNLSLFHVDERLEGDQLVA
FT                   RLDRKRPDLYLMPLQDGEPLPELYTLKKGQLYPAGTRGLYLAESFARQDGWLVRDERIR
FT                   WKDWLRQQGLTPPPRDTGLARLRGKAKQLLKKIVPRKKVNS"
FT   gene            complement(563459..564271)
FT                   /locus_tag="Pfl01_0486"
FT   CDS_pept        complement(563459..564271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0486"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72230"
FT                   /db_xref="GOA:Q3KJ26"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ26"
FT                   /protein_id="ABA72230.1"
FT                   /translation="MSLPTLHDLHRPLGSTGLLVSPLGLGTVKLGRDQGVKYPNGFQIP
FT                   DDDAARMLLKQARELGINLIDTAPAYGRSEERLGPLLRGQRQDWVIVSKVGEEFVDGQS
FT                   THDFSAAHTRMSVERSLQRLETDFIDLVLVHSDGNDLAILNDSEVYATLAALKAEGKIR
FT                   GFGFSGKTVDGGLKALEQGDCAMVTYNLNEQNEKAVIDYAAAHGKAILVKKALASGHVC
FT                   LSPGVDPVRASFELLFAQPGVASAIVGTINPLHLAHNVATVAQVLRGH"
FT   gene            complement(564268..565443)
FT                   /locus_tag="Pfl01_0487"
FT   CDS_pept        complement(564268..565443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72231"
FT                   /db_xref="GOA:Q3KJ25"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ25"
FT                   /protein_id="ABA72231.1"
FT                   /translation="MPSPISTDVLIVGAGVAGLWLNARLRRQGFSTVLVESASLGGGQS
FT                   VKSQGIIHGGAKYALHGALTGASEAIADMPRRWREALAGNGELDLTGVRLLSEAHYLWS
FT                   PGTLAGNLTSFFASKAVRGRVDQVKGDQLPLALQDKRFKGKVYRLAELVIDVPSLIQRL
FT                   ADLSGDGLLAGQNIEPLLESGVLVGLKVDGREIRAQRIVLSAGAGTADLLTALGLTHPA
FT                   MQRRPLHMIIAKGPGLKPLYAHCLGGGTKPRITVTTHPAADGQWVWYLGGDIAESEGVA
FT                   REPAEQIATAQKELGQLLPWIDLSTVQWATLRVDRAEPLQTGLTRPDNAFLAEDGRLLV
FT                   GWPTKLALAPDFADRVIASLERDGIQPSHPGPLPELPKPPMGVPAWEQLLP"
FT   gene            complement(565573..565905)
FT                   /locus_tag="Pfl01_0488"
FT   CDS_pept        complement(565573..565905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0488"
FT                   /product="quaternary ammonium compound-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72232"
FT                   /db_xref="GOA:Q3KJ24"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ24"
FT                   /protein_id="ABA72232.1"
FT                   /translation="MNAYVYLAIAICAEVIATVSMKAVKGFSTPLPLLLVVVGYGIAFW
FT                   MLTLVVRSVPVGVAYAVWAGMGIVMVSVAALFIYGQKLDIPAMLGMALIVLGVVVIQLF
FT                   SKTAGH"
FT   gene            566008..566910
FT                   /locus_tag="Pfl01_0489"
FT   CDS_pept        566008..566910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0489"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72233"
FT                   /db_xref="GOA:Q3KJ23"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ23"
FT                   /protein_id="ABA72233.1"
FT                   /translation="MSMQWNLEQLRVFVEVAEQRSFSAVARQQRKAQSAISSAIAMLED
FT                   DLGVSLFERSSGRQPSLTEAGEALLEEAREVLRQCERLNGRAVAMMRGQEAQLRVAQDE
FT                   AMPYQALVESFGALAEQFPSLEVQLTSAAQGEVSRKLVERRADLGLLFYHDEIPEALER
FT                   RVLGSVEMVTVCGVNHPLASQAYVTCQQLAQHRQLLMSTQTSIYPGNEPASPQVWRADS
FT                   FYVMAEWLVRDLGWAWLPRHVVQYSAYQGLMVELDSEWTPPALVVELVWRRDEPLGPAA
FT                   RWLAERFAIHLRAIGGKSR"
FT   gene            566922..568202
FT                   /locus_tag="Pfl01_0490"
FT   CDS_pept        566922..568202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0490"
FT                   /product="3-deoxy-d-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72234"
FT                   /db_xref="GOA:Q3KJ22"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ22"
FT                   /protein_id="ABA72234.1"
FT                   /translation="MNRTLYTALFYLGLPLVAIRLWLRSRKAPAYAERIGERFSCGMPA
FT                   LQPGGIWVHAVSVGESIAAAPMIRALLQRYPQLPITVTCMTPTGSERILAMFANEPRIQ
FT                   HCYLPYDLPCAAARFLDRVQPKLAVIMETELWPNHIHQCAKRGIPVALANGRLSERSAK
FT                   GYGRFSKLTAPMLAEMSLFAVQTEAEAQRFRDLGARPETVEVTGSIKFDLTIDPQLLQR
FT                   AHELRGQWQALERPVWIAASTHEGEDEVVLSAHRRLLANHPDALLILVPRHPERFNSVF
FT                   ELCQREGFATVRRSTGASVDAQTSVLLGDTMGELLFLYALADSAFVGGSLVPNGGHNLL
FT                   EPAALAKPVISGPHLFNFLDIAAQLRSAGALAEVDDAEGLATEVQRLFELPRDAQRMAD
FT                   AGLSVMRRNQGALQRLLDGLGRLIDRP"
FT   gene            complement(568234..569667)
FT                   /locus_tag="Pfl01_0491"
FT   CDS_pept        complement(568234..569667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0491"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72235"
FT                   /db_xref="GOA:Q3KJ21"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ21"
FT                   /protein_id="ABA72235.1"
FT                   /translation="MLRKLSLAVAVSCASTTTVWAAEAPLSTKTDLVSVYQEAVDNNAD
FT                   LAAARAQYGAQKEVVPQARAGLLPNLSGGAEVANVRTSIDQPSAIANRSAHSYQATLAQ
FT                   PLFRADRWFQYQAAKDVNEQAALQLSATEQNLILQTAESYFNVLRSQDNLASTKAEEAA
FT                   FKRQLDQSNERFDVGLSDKTDVLQSQASYDTARANRIVAQRQVDDAFEALITLTNRQYN
FT                   SIQGIVHTLPILPPAPNDAKAWVDTAAKQNLNLLASNYAVSSAEQTLKQRKAGHLPTLD
FT                   AVAKYEKGDNDALGFSNPNAFGTPYSGNVEQSTVGLQLNIPIYSGGLTSSQVRESYSRL
FT                   DQTEQQREGLRRQVVENTRNLHRAVNTDVEQVQARRQSIISNQSAVEATEIGYQVGTRN
FT                   IVDVLDAQRQLYTSVRNYNNTRYDYILDNLRLKQAAGTLNPGDLQDLTRYLKADYNPDK
FT                   DFLPPDLAKAAEAQLKARP"
FT   sig_peptide     complement(569602..569667)
FT                   /locus_tag="Pfl01_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            570117..572006
FT                   /locus_tag="Pfl01_0492"
FT   CDS_pept        570117..572006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0492"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72236"
FT                   /db_xref="GOA:Q3KJ20"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ20"
FT                   /protein_id="ABA72236.1"
FT                   /translation="MTTKSKNAINLSDSAKVDEQSVQPFTRSQKVYVQGSRPDIRVPMR
FT                   EITLDVTPTDFGGEINAPVTVYDTSGPYTDPNVVIDVRKGLGDVRSAWIDDRGDTERLP
FT                   GLSSNFGQERLADPELTKLRFAHVNNPRRAKAGANVSQMHYARKGIITAEMEYVAIREN
FT                   MKLQEARAAGLLKQQHAGHSFGASIPKEITPEFVREEIARGRAIIPANINHVELEPMII
FT                   GRNFLVKINGNIGNSALGSSIEEEVAKLTWGIRWGSDTVMDLSTGKHIHETREWIIRNS
FT                   PVPIGTVPIYQALEKVNGVAEDLTWELFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAK
FT                   RVTGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGDGLRPGSIADAN
FT                   DEAQFGELETLGELTKIAWKHDVQCMIEGPGHVPMQLIKENMDKQLECCDEAPFYTLGP
FT                   LTTDIAPGYDHITSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKDDVKTGIITYKIAAHA
FT                   ADLAKGHPGAQIRDNALSKARFEFRWEDQFNLGLDPDTARSYHDETLPKDSAKVAHFCS
FT                   MCGPKFCSMKITQEVREYAANQRIDAVDVDVAQGLAEQAERFKKEGSQLYKKV"
FT   gene            572127..573419
FT                   /locus_tag="Pfl01_0493"
FT   CDS_pept        572127..573419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0493"
FT                   /product="putative membrane transport-related permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72237"
FT                   /db_xref="GOA:Q3KJ19"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ19"
FT                   /protein_id="ABA72237.1"
FT                   /translation="MSTQPGTYSPDLAVPANQRVFGGRDLFSLWFSLGIGLMVLQTGAL
FT                   LAPGLGLSGSLLAIFLGTLVGVLLLAAVGVIGSDTGLSSMAALKLSLGSKGASLPALLN
FT                   LLQLIGWGSFEIIVMRDAASLLGTRAFSEGSLWASPMLWTLCFGALATLLAISGPLTFV
FT                   RKILRKWGIWLILAACIWLTWNLFAKADLAALWAQAGDGSMSLAVGFDIAIAMPLSWLP
FT                   LIADYSRFGQRAKNVFGGTAIGFFIGNFWLMSLGVAYTLAFAPSGEVNALLLALAGAGL
FT                   GIPLLLILLDESENAFADIHSAAVSSGILLRLKVEHLALAIGVICTLIALLAPLAQYQN
FT                   FLLLIGSVFAPLFGVVLVDHFILRKRSAQVASAALRWPALLAWLGGISTYHLLANLYPD
FT                   VGATLPALVLAGLLQLVLGRAFSYGRETARA"
FT   gene            complement(573388..574134)
FT                   /locus_tag="Pfl01_0494"
FT   CDS_pept        complement(573388..574134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0494"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72238"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ18"
FT                   /protein_id="ABA72238.1"
FT                   /translation="MSLFKIASVAAIALTLGACASLFQPNYRTPLETTRDASETLKPGC
FT                   SNQDCPLVNIDTLRFPAEPALDGIIEKRLLQMTRTAPNAPVAPTLAAYREQFLANAGPR
FT                   NSSYLQAKVREQHDGLVIIETSSYLDTGGAHGTPGRGFINYSRQQHKVLTLADMLLPGQ
FT                   EEAFWKAAQVAHNSWLISTKLDQEPEFVKSWPFVKTPNVALTYGGVILKYDVTTIAPYA
FT                   LGHVELKIPYPRLNGILKPELFPGRN"
FT   sig_peptide     complement(574072..574134)
FT                   /locus_tag="Pfl01_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.970 at
FT                   residue 21"
FT   gene            574356..574973
FT                   /locus_tag="Pfl01_0495"
FT   CDS_pept        574356..574973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72239"
FT                   /db_xref="GOA:Q3KJ17"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ17"
FT                   /protein_id="ABA72239.1"
FT                   /translation="MTDFAKAIPTAVDIVRREQCYKGFYKLDRLHLRHELFAGGMSREI
FT                   NREVFVRHDAVCMLPYDPQRDEVVLIEQFRVGALGKTDNPWLVELVAGLIDKDEQPEEV
FT                   AHREAQEEAGLDIKALWPMTKYFPSPGGSNEFVHLYLGRCSTEGAGGLHGLEEEAEDIR
FT                   VTVWAFEDALQAVRDGRIANAASIIALQWLALNRAEVRGLWS"
FT   gene            574964..575416
FT                   /locus_tag="Pfl01_0496"
FT   CDS_pept        574964..575416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72240"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ16"
FT                   /protein_id="ABA72240.1"
FT                   /translation="MVVNKLRDRYRVDLVGLQAACEANYARLMRLLPDMRSDPEARRIA
FT                   VTQGDQMLGVLTLEVLQACPYTTTLQVRQEHSLPWLPVPQLEVQVYHDARMAEVISAEH
FT                   ARRFRGVYPYPNAAMHQPDEKAQLNLFLGEWLSHCLACGHEYAAVR"
FT   gene            575522..576337
FT                   /locus_tag="Pfl01_0497"
FT   CDS_pept        575522..576337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0497"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72241"
FT                   /db_xref="GOA:Q3KJ15"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ15"
FT                   /protein_id="ABA72241.1"
FT                   /translation="MPSVSTLTTADTALLVQLSDSHLFAEADGTLLGMNTRESLQKVID
FT                   LVLEQQPRIDLIVASGDLSQDGTLESYQLFRQMTAQIDAPARWIPGNHDEPQIMARATV
FT                   KSALLESVVDVGNWRVTLLDSAVPGSVPGYLQDDQLQLLARSLSEAPDRHHLVCFHHHP
FT                   VSIGCAWMEPIGLRNPEAFFEVLDRFPQARAVLWGHVHQEIDRERNGVRLIASPSTCIQ
FT                   FEPGSEDFKVGEQAPGYRWLRLLPDGRLETGVERVTGFDFQVDYGSNGY"
FT   gene            576434..577042
FT                   /locus_tag="Pfl01_0498"
FT   CDS_pept        576434..577042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72242"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ14"
FT                   /protein_id="ABA72242.1"
FT                   /translation="MSGSILYIHGFNSAPASKKACQLVEVMERLGLSDQLRVPALHHHP
FT                   REAIGQLEQAIAELGRPLLVGSSLGGYYATHLAERHGLKALLVNPAVSPHRMFDGYLGT
FT                   QKNLYTDETWELTHDHVTALAELEVPAPQDLQRYQVWLQTGDETLDYRLAQQYYRACAL
FT                   RIQAGGDHSFQGFVTQLPALLSFAGIGADTYQAIDFTAL"
FT   gene            577085..578992
FT                   /locus_tag="Pfl01_0499"
FT   CDS_pept        577085..578992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0499"
FT                   /product="topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72243"
FT                   /db_xref="GOA:Q3KJ13"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ13"
FT                   /protein_id="ABA72243.1"
FT                   /translation="MATPSASSYNADAIEVLSGLDPVRKRPGMYTDTSRPNHLAQEVID
FT                   NSVDEALAGHAKSIQVILHADHSLEVCDDGRGMPVDIHPEEGVSGVELILTKLHAGGKF
FT                   SNKNYQFSGGLHGVGISVVNALSTQVRVRVKRDGNEYEMTFADGFKATDLQVIGTVGKR
FT                   NTGTSVYFAPDPKYFDSPKFSISRLKHVLKAKAVLCPGLLISFEDKGTGEKVEWHYEDG
FT                   LRSYLVDAVSEFERLPDAPFCGNLAGTKEAVEWALLWLPEGGTSVTESYVNLIPTEQGG
FT                   THVNGLRQGLLDAMREFCEFRSLLPRGVKLAPEDVWERIAFVLSMKMQEPQFSGQTKER
FT                   LSSREAAAFVSGVVKDAFSLWLNANPETGLALAELAISNAGRRLKASKKVERKRITQGP
FT                   ALPGKLADCAGQDPMRSELFLVEGDSAGGSAKQARDKEFQAILPLRGKILNTWEVDGSE
FT                   VLASQEVHNIAVAIGVDPGAEDMSQLRYGKICILADADSDGLHIATLLCALFVQHFRPL
FT                   VDAGHVYVAMPPLYRIDLGKEIYYALDEAERDGILDRLVAEKKRGKPQVTRFKGLGEMN
FT                   PPQLRETTMDPNTRRLVQLTLGGDFAETSEMMDMLLAKKRAGDRKTWLESKGNLAEVLA
FT                   "
FT   gene            578992..579981
FT                   /locus_tag="Pfl01_0500"
FT   CDS_pept        578992..579981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0500"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72244"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ12"
FT                   /protein_id="ABA72244.1"
FT                   /translation="MRFGRALAGALLLGSMTVSAEPAQELRVLAEHPVEGMRGGNLSGL
FT                   ALCGNDLWTVSDRDDDQIYRLDTRDPVWQATAVRIDPPPVPDSGLPWGIKSRTWAASFV
FT                   RGGDLDFEGITCDSAGNRYIVSEGHAAVLQVPPQGPSSWLKISPMMVREARASGMLLQF
FT                   NAIFEGLAINPAGDQMWLAAERQSRGLLLIKRQQTVWDCDGRCVLLSEGGMEMQPPQFP
FT                   KARPVNRDFSDVSLFDGKLFTLERNAYQICRRDAQTAKVELCWSYAAELLQANRRYSQN
FT                   FGLEEALVVDAQGAWIGVDNNFGPRADGEVRPIIWRFAAPEGGWSAKP"
FT   sig_peptide     578992..579054
FT                   /locus_tag="Pfl01_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            580303..581313
FT                   /locus_tag="Pfl01_0501"
FT   CDS_pept        580303..581313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72245"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ11"
FT                   /protein_id="ABA72245.1"
FT                   /translation="MMKLNYVVAGILFVCSSLVLAADPELLMLSEHPVDGMRAGNLSGL
FT                   ARCGEQLWTISDRDDDRLYKLDTRATVWKAEAVLINVPPAPDDAGRTLGMKTQSFFRSL
FT                   AGNGALDFEGITCDSARNLYVLSETYSAILKVPSSGASAWFLTISPNMQIKAREAGLLA
FT                   HANALFEGLVITGIASTQIWLAAERQKRGLVKIERRITPIYYTWYCAVGCVVMTEGGLA
FT                   PQPPQFPGSKLVEKDFSDIALFNNKLFLLDRNAFKICRHEMLTGKQERCWSFAADALVP
FT                   SRQYDAEHGMAEALLVDAQGAWIGVDNNSATRADGESRPIVWRFAAPAGGWDASP"
FT   sig_peptide     580303..580368
FT                   /locus_tag="Pfl01_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            581310..581834
FT                   /locus_tag="Pfl01_0502"
FT   CDS_pept        581310..581834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0502"
FT                   /product="Putative aspartyl protease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72246"
FT                   /db_xref="GOA:Q3KJ10"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ10"
FT                   /protein_id="ABA72246.1"
FT                   /translation="MSQQPPGKRAGRVLMILAWCAALFLATRFFGQWEERQRNPNVEVA
FT                   SQQGNGFIEVKLIGNAQGHFVASGLINGRPVEFMLDTGATDVAIPAEVAKNLRLEEGFG
FT                   VTLSTANGLSQGYRTRIDRLQLGDIVLRDVRALVAPGLHGDQVLLGMSALNKLEFTQRG
FT                   GTMLLRQTTNR"
FT   gene            581842..584106
FT                   /locus_tag="Pfl01_0503"
FT   CDS_pept        581842..584106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0503"
FT                   /product="topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72247"
FT                   /db_xref="GOA:Q3KJ09"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ09"
FT                   /protein_id="ABA72247.1"
FT                   /translation="MSDNLADSLDGVERRSLADFTENAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIVYAMSELGLDADSKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRY
FT                   TLVDGQGNWGAPDDPKSFAAMRYTEARLSRYSEVLLSELGQGTADWGPNFDGTLQEPLV
FT                   LPARLPNILLNGTTGIAVGMATDVPPHNLREVATACVRLLDEPKATVEQLCEHIQGPDY
FT                   PTEAEIITPRADLLKMYETGKGSVRMRAVYHVEDGDIIVTALPHQVSGAKVLEQIAALM
FT                   QAKPSKAPQIADLRDESDHENPCRIVIIPVNSRVDHEALMQHLFASTELESTYRVNVNI
FT                   IGLDGKPQLKNLRALLVEWLEFRVLTVRRRLQFRLDKVERRLHLLDGLLIAYLNLDEVI
FT                   HIIRTEEHPKAKLIERFALSEIQADYILDTRLRQLARLEEMKLRDEQDELLKEQAKLQA
FT                   LLSSEAKLKKLVRSELLKDAETYGDDRRSPIVERAEAKALTEHDLLPNEKVTVVLSEKG
FT                   WIRSAKGHEIDATGLSYKAGDGFKTSAAGRSNQSAVVIDSTGRSYSLATHTLPSARGQG
FT                   EPLTGRLTPPPGATFECVLMPEEDSLYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPN
FT                   NAKVIAPRPVADREHNWLASVTTEGRLLIFKISDLPQLGKGKGNKIIGISGERVASREE
FT                   YVTDIAVLPEGATLVLQAGKRTLSLKADDLEHYKGERGRRGNKLPRGFQRVDALLVENL
FT                   N"
FT   gene            584335..585048
FT                   /locus_tag="Pfl01_0504"
FT   CDS_pept        584335..585048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0504"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72248"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ08"
FT                   /protein_id="ABA72248.1"
FT                   /translation="MMTSLRPLIFLLAGVLGLAGCSVHQPVSLYQLDSGSPAQPAQSAG
FT                   MAVLLGPVIVADYLQRETLLQRQPDGSLQASVDGRWAGSLSSDIDQLLLRQVAGHLDSQ
FT                   RVVLAPATLGFTPDVQVLLTITRLDSGAKQPAILDAQWRLIDRRGQVRDNRIVHLQEQH
FT                   AGTTAAQVQAQGVLLQRLAEQLSVALKPLANQPPVAEAPRKPAPKPAAPAAEAEKQPKI
FT                   PMASPIRTDMEVFRF"
FT   sig_peptide     584335..584406
FT                   /locus_tag="Pfl01_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.364 at
FT                   residue 24"
FT   gene            complement(585425..586939)
FT                   /locus_tag="Pfl01_0505"
FT   CDS_pept        complement(585425..586939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0505"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72249"
FT                   /db_xref="GOA:Q3KJ07"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ07"
FT                   /protein_id="ABA72249.1"
FT                   /translation="MNRPTPVKTDNFFLLIFRALRHRRVPIALRIASHNVILVALALVI
FT                   YACVMGLQFKQAMHEQADALGESLTTQTATSATELLVSNDILSLNVLLNNLTKNKLVAH
FT                   AAIYSVDNRILAESGQRPKHGLLGEAEGMYESKITFQDVTAGQLRISLDMDQFQQPMTI
FT                   SLQSMGILSAILLALSLALSLRLGRHISTPLLQLRVWLRRIDEYTPGIERQDEIGDLAR
FT                   QLHANYAPEPAEPEPEPEPEFEDDDIEPEFEVRNLRDPSFDESRPMAAQKPAPRHVVST
FT                   VEDDDDEDPFADLRDESLSEAAQPAVRRPTPSVPQHTAVLAVQLGSQEQLRRLPRARLE
FT                   ELQDRYRDCLDQAASLYQGEIETLNDGSTLMLFHTEDSGDDYLTNAICCGELLRALGHQ
FT                   LQIEVADSGITLQLQLGLTLGDELFGLSQIDLLLTDSAQDALALSQHSRNLLLVERKIG
FT                   DDALIRQRARIRPIASPEGACCVERLMEPYPSMLERQLARMHERRA"
FT   gene            587074..588288
FT                   /locus_tag="Pfl01_0506"
FT   CDS_pept        587074..588288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0506"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72250"
FT                   /db_xref="GOA:Q3KJ06"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ06"
FT                   /protein_id="ABA72250.1"
FT                   /translation="MREIVLINITGVDRPGLTAAITGVLAQGGVNILDIGQAVIHDMLS
FT                   FGILVEIPDSEQGKSVLKDILFKGYELDQQVRFTPVSEEDYQQWVGNQGKKRHIVTLLT
FT                   RKVTAGQLQAVSSITAKYGLNIDHIDRLSGRMPLDTPADKGKGCIEFSVRGEAADPQAL
FT                   RAEFLSVAQELNVDIAFQEDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGDQVSQ
FT                   ITERAMAGELDFRASFKERLALLKGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTA
FT                   ILSGGFTYFAKQLQAKLGIDYVFANELEVVNGKCTGVAIEPIVDAQRKADLLKQLAEKE
FT                   GLRLEQTIAVGDGANDLPMLAIAGLGVAFRAKPLVKQSAKQAISTLGLDGVLYLLGFRD
FT                   RDGQL"
FT   gene            complement(588328..590082)
FT                   /locus_tag="Pfl01_0507"
FT   CDS_pept        complement(588328..590082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72251"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ05"
FT                   /protein_id="ABA72251.1"
FT                   /translation="MSEPQSRPQLSAPTPTQLRLSFCEATPRDLKRWIAGLPKANIGET
FT                   ARLLYQGLGELNQLLTPSDNRLHLLELLRPEVYFVCQHLERHFLHQAIMLDERSRKISN
FT                   LCQALQSQLAIGYKHIILRIAPKYSRDRAALVSEALQRAAHALKGQLVRATQLYSPAPE
FT                   QLWFELHQLFRCACELQLQHRRVRDDLASLTGELSVEQTYLAALLLGCARCNQLRQNQI
FT                   ARLAQVVEPWSAWLKLHPAHPGEGLFAVSAEIDAGPRYRSQFRSEQQASLLGFDPQPLV
FT                   NAIEAHLQHQDTTTPLPVPAGLTLDTLQHLHATWGETAERSFQRTVGQGNLTVCVGMSA
FT                   LHFYLGGERTFSELLKHPGARAANFSRAVVQGEKDSWSQAFDAAPQGTSDELLPYEEIR
FT                   YEPLADDESGTDSPPHYPTYALPVINHSPGGYCLAWPKEVPAELQAGEMVGIQDSLNQG
FT                   WSIAVVRWIRQVRGAGTQMGIELVAPHAQPCGLQLVRTRDDHSHYLRGLLLPEISAIDL
FT                   PATLLAPRLPFQEGNKVLINTQGEEHRAGLDRRVASTHSFNQFAYRSLETAKNGESEED
FT                   FDSLWKSL"
FT   gene            590305..590706
FT                   /locus_tag="Pfl01_0508"
FT   CDS_pept        590305..590706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72252"
FT                   /db_xref="InterPro:IPR040964"
FT                   /db_xref="PDB:4FBO"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ04"
FT                   /protein_id="ABA72252.1"
FT                   /translation="MSKYAVANQWGGSSAPWHPGGTWVLGARDNQNVVAIEIKSGDGGK
FT                   SFTGTMTYAGEGPIGFKAQRTGQNQYNVENQWGGNDAPWHPGGKWVIGGRDNQNVIALS
FT                   VTSSDGGKNLSGTNTYANEGPIGFRGQIE"
FT   gene            complement(590767..591627)
FT                   /locus_tag="Pfl01_0509"
FT   CDS_pept        complement(590767..591627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0509"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72253"
FT                   /db_xref="GOA:Q3KJ03"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ03"
FT                   /protein_id="ABA72253.1"
FT                   /translation="MKERLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTTWFAKRY
FT                   QVDMSQALVEDVTAYEHFNAFFTRALKDGARPLDQTPGAILSPADGAISQLGPIEHGRI
FT                   FQAKGHSFSVLELLGGDAANAAPFMGGEFATVYLSPKDYHRVHMPLAGTLREMVYIPGR
FT                   IFSVNQTTAENVPELFARNERVACIFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKR
FT                   ELKTFRYDEAARAPIHLEKGAELGRFKLGSTAIVLFGPDQVKWVEELKAGSPVQMGQAL
FT                   AQSNA"
FT   gene            complement(591646..592461)
FT                   /gene="sseA"
FT                   /locus_tag="Pfl01_0510"
FT   CDS_pept        complement(591646..592461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="Pfl01_0510"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72254"
FT                   /db_xref="GOA:Q3KJ02"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ02"
FT                   /protein_id="ABA72254.1"
FT                   /translation="MSDFSGLALVIEPSDLLPRLESRDLILVDLTSAARYAEGHIPGAR
FT                   FVDPKRTQLGQAPAPGLLPSKEKLEELFGELGHRKDAVYVVYDDEGGGWAGRFIWLLDV
FT                   IGHDQYHYLNGGLPAWLAEGSPMSIQIPPAVGGPVALTLHEEPTATREYLQSRLGAADL
FT                   AIWDARGPLEYSGEKVLAAKGGHIPGAVNFEWTAGMDQARQLRIRTDMPQILEDLGITR
FT                   DKEIITHCQTHHRSGFTYLVAKALGYPRVKGYAGSWGEWGNHPDTPVEL"
FT   gene            complement(592501..594039)
FT                   /locus_tag="Pfl01_0511"
FT   CDS_pept        complement(592501..594039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72255"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ01"
FT                   /protein_id="ABA72255.1"
FT                   /translation="MANETNVPHVKPTTLDGWVKLLDSVRLPVPQDAHDRVCRAIRDDR
FT                   SSLRDIADLMQDSPALALSIIREANRHTHGNMTAPAENLEVAINRLGLARTEELLARLP
FT                   AEPAAQIPQALRQLQMISQHATQQANGFFASRLARLWQDIHWGSLLFLSPLWPLALTFP
FT                   QLLEEWEVRVIHKGESARVVEKQLFGVRLLKIGEALVQVWRLPVWVQQGYRLLLTEQRE
FT                   LVKVLRIARDVDHPLRQQNRLDDDPTLRRWLNQPANTVLLANGLALSAQQAWDSPHSER
FT                   WQFLTSLYLQISMDEVQQQLHQQAAVSARHHFMPDLWHPALSLLWPWGTRRLPAGMLPA
FT                   AAPSAEDLSQWRRQCAELLAVPSRFTNAMSLTVAARDALVASGMRRVMILMTDRGHANL
FT                   RVHQTSGLPKDAAALNFVVSQSSVLQRLLAQQAQVRITPDNNAQFSALLPPSLRALFRG
FT                   EHLFLRSLVNNGRVIMIVVADQGGGPFADITVQAFGKTAQCIEKALHSFSQRGQ"
FT   gene            594207..595058
FT                   /locus_tag="Pfl01_0512"
FT   CDS_pept        594207..595058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0512"
FT                   /product="chemotaxis MotA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72256"
FT                   /db_xref="GOA:Q3KJ00"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ00"
FT                   /protein_id="ABA72256.1"
FT                   /translation="MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVMIIGGAALGAF
FT                   LQANPGYMTMHVLKKSLSMFSSRFSHTFYLEVLGLIYEILNKSRREGMMAIEGDIEDAA
FT                   ASPIFAKYPAVLKDERMTAFICDYLRIMSSGNMAPHELEGLFDMELYSLKEDLEHPSHA
FT                   VNGIADAMPGFGIVAAVLGIVVTMASLGEGDQKSIGLHVGAALVGTFFGILAAYGFFGP
FT                   LAHSLAHDAKEELNVYEAIKASLVASASGMPPSLAVEFGRKVLYPAHRPSFAELEQAVR
FT                   GR"
FT   sig_peptide     594207..594272
FT                   /locus_tag="Pfl01_0512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.606 at
FT                   residue 22"
FT   gene            595062..596129
FT                   /locus_tag="Pfl01_0513"
FT   CDS_pept        595062..596129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0513"
FT                   /product="chemotaxis MotB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72257"
FT                   /db_xref="GOA:Q3KIZ9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ9"
FT                   /protein_id="ABA72257.1"
FT                   /translation="MENNQPIIIKRVKRIAGGHHGGAWKIAFADFATAMMAFFLVLWLL
FT                   STATPEQKIAIAGYFKDPVGFSESGTPYIIDLGGTPTLAPENTLNPEVKSQPQPDKVTV
FT                   DTEQVEGMAEQVEKERLELLLQELQNKVDENPQLQKFKDQILFEITPNGLRIQIMDAEN
FT                   RPMFDSGSARLKPYFEDILLAMADTIKAVPNKISISGHTDAKPYVGNGDFGNWELSANR
FT                   ANAARRALVAGSYPDSQVARVVGYASSALFDKENPFNPVNRRIDIVVLTKKAQAAIEGA
FT                   QGADPSKPADQGQNGAAPATPVDPNALPADQQPVPAHELRERLNLFDDPLPKPTEPGSA
FT                   APAPVPAAPAPAPKQ"
FT   gene            complement(596185..597216)
FT                   /locus_tag="Pfl01_0514"
FT   CDS_pept        complement(596185..597216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0514"
FT                   /product="putative GTP-ase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72258"
FT                   /db_xref="GOA:Q3KIZ8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIZ8"
FT                   /protein_id="ABA72258.1"
FT                   /translation="MAKRQLNRRQNWRIEKIQGERAARAAKRESSAVEALEGGDLGPEQ
FT                   HGLVIAHFGVQVEVEAVDGELAGQVFRCHLRANLPALVTGDQVVWRAGNQGIGVIVAQL
FT                   PRTTELCRPDSRGQLKPVAANVDMIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLN
FT                   KFDLIDEQNAPALNALLAVYRTLGYPVLEVSAHHGNGMEQLQKQLDGRISVFVGQSGVG
FT                   KSSLVNSLLPEVETRVGPLSELSGQGTHTTTTARLFHFPGGGELIDSPGIREFGLGHVS
FT                   RADVEAGFIEFNDLLGTCRFRDCKHDREPGCALLKALEDGRVQQQRMNSYRSIIASLPE
FT                   NGY"
FT   gene            597324..597866
FT                   /locus_tag="Pfl01_0515"
FT   CDS_pept        597324..597866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0515"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72259"
FT                   /db_xref="GOA:Q3KIZ7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIZ7"
FT                   /protein_id="ABA72259.1"
FT                   /translation="MQNPQNLIWIDLEMTGLDPENDVIIEMATIVTDSDLNTLAEGPVI
FT                   AIHHSDEVLARMDEWNTRTHGNSGLTQRVRESRVSMAEAEAETIAFLEQWVPKGKSPIC
FT                   GNSICQDRRFLYTHMKALESYFHYRNLDVSTLKELAARWAPDVRDSFKKGSTHLALDDI
FT                   RESIAELQHYRKHFIKF"
FT   gene            597950..598561
FT                   /locus_tag="Pfl01_0516"
FT   CDS_pept        597950..598561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0516"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72260"
FT                   /db_xref="GOA:Q3KIZ6"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ6"
FT                   /protein_id="ABA72260.1"
FT                   /translation="MLLMLYLVAITAEAMTGAMSAGRRGMDWFGVVLIACVTALGGGSV
FT                   RDVLLGHYPLTWVKHPEYLVLTTVAAMITVFTARWMRHLRSLFLVLDAVGLVAFTLIGC
FT                   MTALEMGHGMLVASVSGVITGVFGGILRDIFCNDIPLIFRRELYASVSFAAAWCYMLCL
FT                   FLSVPSEQAILITLFGGFLLRLLAIRFHWEMPKFVYNDAP"
FT   gene            complement(598543..599622)
FT                   /locus_tag="Pfl01_0517"
FT   CDS_pept        complement(598543..599622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0517"
FT                   /product="putative iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72261"
FT                   /db_xref="GOA:Q3KIZ5"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ5"
FT                   /protein_id="ABA72261.1"
FT                   /translation="MSAITTDLPALAQSIKDWGRELGFQQVGISGLNLAEHEQHLQRWL
FT                   EAGYHGEMDYMGAHGSKRSHPEELVPGTLRVVSLRMDYLPGDTQMAQLLTKPEKAYISR
FT                   YALGRDYHKLIRKRVQQLADRIQSEIGPFGFRAFVDSAPVLEKAIAEQAGLGWIGKNTL
FT                   VLNRKAGSYFFLSELFVDLPLPVDEPHSTEHCGRCTACLDICPTNAFVGPYVLDARRCI
FT                   SYLTIELKNAIPEDLRPLIGNRVFGCDDCQICCPWNRFARPSGESDFKPRHNLDNAELA
FT                   ELFLWDEDKFLSSTEGSPLRRAGYERWLRNLAVGLGNAPSSIPVLEALKARREYPSELV
FT                   REHVEWALKQHADRQGASL"
FT   gene            599686..601185
FT                   /locus_tag="Pfl01_0518"
FT   CDS_pept        599686..601185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0518"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72262"
FT                   /db_xref="GOA:Q3KIZ4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ4"
FT                   /protein_id="ABA72262.1"
FT                   /translation="MPHTKDQLPDALYRAAQVRELDARLIAGGTPGFELMQRAAHATWR
FT                   ALVRQWPAANEMTVFAGHGNNAGDGYLVAALAHRAGWQVQVLAVGEPQRLKGDAAVAHA
FT                   EAVAEGVSIAAWDLSCELRGIVVDALLGTGLNGEVREPYAAAIAAINASGLPVVAVDIP
FT                   SGLCADTGHALGDAVHADLTVTFIGLKLGLFTGAAADHVGELRFNDLQATAENFSDIPA
FT                   AAQRLSAINLPRLAARAPAAHKGRFGHVLLIGGDHGFGGAILLSTESALRSGAGMVSVA
FT                   TRPEHVPAALSRVPEAMVLGTSSANQLMGLLEKVSVLVVGPGLGQAAWGRALLSAAANA
FT                   SLPQVWDADALNLLARGFVSLPKDCVITPHPGEAARLLGISTAEVQADRPAAALALSKK
FT                   YTAVVVLKGAGSLIAHPDGRLALCHQGHPAMATAGLGDVLAGLIGALLAQGMDGFDAAC
FT                   LAVWLHASAGAQQGKFGRGLAASDLIPAIRQLLEEHAPCLK"
FT   gene            601212..601643
FT                   /locus_tag="Pfl01_0519"
FT   CDS_pept        601212..601643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72263"
FT                   /db_xref="GOA:Q3KIZ3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ3"
FT                   /protein_id="ABA72263.1"
FT                   /translation="MSDFGARIARITQGHGLIFLEGNLGMGKTTLSRGIIRGLGHVGAV
FT                   KSPTFTLVEPYEIGDVRAFHFDLYRLVDPEELEFLGIRDYFEDDALCLIEWPDKGAGFL
FT                   PKPDLTITISPQDSGRSLTILSQGSRGEAWCAALALETN"
FT   gene            601659..603080
FT                   /locus_tag="Pfl01_0520"
FT   CDS_pept        601659..603080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0520"
FT                   /product="N-acetylmuramoyl-l-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72264"
FT                   /db_xref="GOA:Q3KIZ2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ2"
FT                   /protein_id="ABA72264.1"
FT                   /translation="MRFRALVAAAGLMLMAVTVNAVAETKVNSVRLWRAPDNTRLVFDL
FT                   TGPVQHSVFTLTAPDRLVIDINGATLGAPLNVQTANTPITAMRSAQRTPTDLRVVIDLK
FT                   KAVTPKSFSLAPNAQYGNRLVVDLFDNPADAAPAPTPASTPTVATVPAVPVTPAEPAIK
FT                   LPPAPAGKRDIIVVIDAGHGGEDPGASGSRGQREKDVVLQIARELQRQVNGMKGFRAEL
FT                   TRTGDYFIPLRGRTEIARKKGADLFVSIHADAAPSAAAFGASVFALSDRGATSETARWL
FT                   ADSENRSDLIGGAGNVSLDDKDRMLAGVLLDLSMTASLTSSLNVGQKVLTNIGRVTPLH
FT                   KQRVEQAGFMVLKSPDIPSILVETGFISNANEANKLSAASHQQALARSISSGVRQFFQQ
FT                   NPPPGTYIAWLRDSGKIAQGPRDHRVGPGETVAMIAVRYQISPATLRSANNLKSDDLKV
FT                   GQHLTIPGTELASKE"
FT   sig_peptide     601659..601730
FT                   /locus_tag="Pfl01_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 24"
FT   gene            603077..604984
FT                   /locus_tag="Pfl01_0521"
FT   CDS_pept        603077..604984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0521"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72265"
FT                   /db_xref="GOA:Q3KIZ1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ1"
FT                   /protein_id="ABA72265.1"
FT                   /translation="MNQVLNAARIELLSPRLANQIAAGEVVERPASVIKELLENSLDSG
FT                   AKRIDVDVEQGGVKLLRVRDDGSGISADDLPLALARHATSKIRNLEDLEQVMSLGFRGE
FT                   ALASISSVARLTLTSRTRDADQAWQVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPA
FT                   RRKFLKTEKTEFDHLQEVIKRLALARFDVAFHLRHNGKTILSLHEAHDDAARARRVAAI
FT                   CGSGFLEQALPIEIERNGLHLWGWVGLPTFNRSQADLQYFFVNGRAVRDKLVAHAVRQA
FT                   YRDVLFNGRHPTFALFFEVDPAAVDVNVHPTKHEVRFRDGRMVHDFLYGTLHRALGDVR
FT                   PEDQLAGSVTTAIVRPTGLEAGEFGPQGEMRLAANALLEQPQAQPAFNTASGASAGGAY
FT                   QYQYTPRPQSTVPVAEAQAAYREFFAPLPEANANALPAGQEDIPPLGYALAQLKGIYIL
FT                   SENAQGLVLVDMHAAHERIMYERLKIAMASEGLSGQPLLVPESLAVSQREADCAEEHAA
FT                   WFQRLGFELQRLGPETLAIRQIPALLKQAEANRLVGDVLSDLMEYGTSDRIQAHLNELL
FT                   GTMACHGAIRANRRLALPEMNGLLRDMENTERSGQCNHGRPTWTQLGLDDLDKLFLRGR
FT                   "
FT   gene            604984..605955
FT                   /locus_tag="Pfl01_0522"
FT   CDS_pept        604984..605955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0522"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72266"
FT                   /db_xref="GOA:Q3KIZ0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIZ0"
FT                   /protein_id="ABA72266.1"
FT                   /translation="MSQLPPAIFLMGPTAAGKTDLAIELTKVLPCELISVDSALVYRGM
FT                   DIGTAKPSKELLAEFPHRLIDILDPAEAYSAADFRRDALEAMAEITARGKIPLLVGGTM
FT                   LYYKALIEGLADMPAADPEVRAQIEEEAARLGWQALHDQLAAIDPESAARIHPNDPQRL
FT                   SRALEVYRVSGQSMTELRLKQSVQSTEAAASGLQQLPYTVANLAIAPTNRQVLHERIKQ
FT                   RFTNMLEQGFIDEVVALRNRSDLHAGLPSIRAVGYRQVWDFLDGKLTSAEMQERGIIAT
FT                   RQLAKRQFTWLRSWKDLHWLDSLDCDNLPRALKYLGTISILS"
FT   gene            606049..606309
FT                   /locus_tag="Pfl01_0523"
FT   CDS_pept        606049..606309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0523"
FT                   /product="Hfq protein (host factor-I protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72267"
FT                   /db_xref="GOA:Q3KIY9"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIY9"
FT                   /protein_id="ABA72267.1"
FT                   /translation="MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPVRPIRLPSATESEAGDAEPGNA"
FT   gene            606322..607623
FT                   /locus_tag="Pfl01_0524"
FT   CDS_pept        606322..607623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0524"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72268"
FT                   /db_xref="GOA:Q3KIY8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY8"
FT                   /protein_id="ABA72268.1"
FT                   /translation="MFFERHGGGERVILVHLDGQDPEAREDPQEFQELANSAGAETVAF
FT                   FNVPRHRPTAKYLIGSGKVEELRDLVHAEEADLVIFNHTLTPSQERNLERVFECRVIDR
FT                   TGLILDIFAQRARTHEGKLQVELAQLDHMSTRLVRGWTHLERQGGGIGMRGPGETQLET
FT                   DRRLLRVRLRQIKRRLEKVRSQREQSRRGRSRADIPTVSLVGYTNAGKSTLFNNVTKSE
FT                   VYAADQLFATLDPTLRRLDLDDLGPIVLADTVGFIRHLPHKLVEAFRSTLEESSNSDLL
FT                   LHVIDAAEPDRMLQIEQVMVVLGEIGAQDLPILEVYNKLDLLEGVEPQIQRDENGKPQR
FT                   VWLSARDGTGLELLEQAIAELLGSDLFVGTLRLPQRFARLRAQFFELGAVQKEEHDEEG
FT                   VSLLAVRLPRSELNRLVSREGVVPTEFIEQHTLQ"
FT   gene            607720..608889
FT                   /locus_tag="Pfl01_0525"
FT   CDS_pept        607720..608889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0525"
FT                   /product="protease FtsH subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72269"
FT                   /db_xref="GOA:Q3KIY7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY7"
FT                   /protein_id="ABA72269.1"
FT                   /translation="MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNG
FT                   LFGGGKKRGDDGGGSGKSGGFGGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYY
FT                   ETVGPGLNIYFPPIDKKYMENVTRERAYTKQGQMLTEDENIVEVPLTVQYKISNLQDFV
FT                   LNVDQPEISLQHATDSALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITV
FT                   TQVNVQSAAAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANG
FT                   YRDETVSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSSTSKVLVTGNKNGQS
FT                   NLLYLPLDKMIQNSSGSNAPVTGSAAASNNTDATPHVTDLPQSRTRETR"
FT   gene            608889..609758
FT                   /locus_tag="Pfl01_0526"
FT   CDS_pept        608889..609758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0526"
FT                   /product="protease FtsH subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72270"
FT                   /db_xref="GOA:Q3KIY6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY6"
FT                   /protein_id="ABA72270.1"
FT                   /translation="MSNKSLIALIVGVVVVLVGWNCFYIVAQTERAVLLQFGRVVQADV
FT                   QPGLHVKVPYVNQVRKFDARLMTLDAPTQRFLTLEKKAVMVDAYAKWRVKDAERFYTAT
FT                   SGLKQIADERLSRRLESGLRDQFGKRTLHEVVSGERDALMADITASLNKMAEKELGIEV
FT                   VDVRVKAIDLPKEVNRSVFERMSTEREREAREHRAKGNELAEGIRADADRQRRVLLAEA
FT                   YRESEEIRGDGDAQAAAIYSKAYGQDQEFYGFYRSLRAYRESFANKSDVLVLDPSSDFF
FT                   RYLEKSKP"
FT   sig_peptide     608889..608972
FT                   /locus_tag="Pfl01_0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.791 at
FT                   residue 28"
FT   gene            610072..611259
FT                   /locus_tag="Pfl01_0527"
FT   CDS_pept        610072..611259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0527"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72271"
FT                   /db_xref="GOA:Q3KIY5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIY5"
FT                   /protein_id="ABA72271.1"
FT                   /translation="MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYEFVVT
FT                   PHIEYLESLLTGAGQDLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLRREGPSRL
FT                   CYAGSVLHAQPRALSSSRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADVPDVHMDL
FT                   GHVGIYRGLAQAAGLSGEVEQQLFDALQRKAIDEVITLTEGLPADLSGMLRALVDLCGG
FT                   REVLSAARERLANAPAPVLAALEDLLAIAERLSVRFPELPLYFDLGELRGYHYHTGVVF
FT                   AVFVPGVGQSIAQGGRYDDIGADFGRARPATGFSTDLKTLVTLGRAEIELPSGGIWMPD
FT                   STDAALWQQVCQLRSEGQRVVQALPGQPLAAARDADCDRQLIQQNGLWQVSPLAS"
FT   gene            611314..612603
FT                   /locus_tag="Pfl01_0528"
FT   CDS_pept        611314..612603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0528"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72272"
FT                   /db_xref="GOA:Q3KIY4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIY4"
FT                   /protein_id="ABA72272.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLREGVQCLIGNGVVVAPDALLREITKLEEKGVPVRERLRISPSC
FT                   PLILSFHVALDQAREKARGELKIGTTGRGIGPAYEDKVARRGLRVGDLLNMPRFEDKLR
FT                   ELVDYHNFMLVGYYKEPAIEFEKTLAECKEYAELLKPLMLDVTAELHDLRRAGKDIMFE
FT                   GAQGSLLDIDHGTYPYVTSSNTTAGGVATGSGVGPMFLDYILGITKAYTTRVGSGPFPT
FT                   ELFDEVGAHLAKQGHEFGATTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLE
FT                   TINICTGYKDAQGNAVAPTDADSYVGLQPVYEEVPGWSESTVGAKTLEELPANARAYIK
FT                   RVEELIGAPIDIISTGPDRNETIVLRHPFA"
FT   gene            612657..614678
FT                   /locus_tag="Pfl01_0529"
FT   CDS_pept        612657..614678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0529"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72273"
FT                   /db_xref="GOA:Q3KIY3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY3"
FT                   /protein_id="ABA72273.1"
FT                   /translation="MPVGRHDLCCDSVYKSAIKLMASEVEGFKVSAVLSLLQSRLLRPV
FT                   FVTLGIALLVQVLVAVALTRSTVTALEADLGTRLGADSQKLSGELEQAGREVTSSLDNL
FT                   SSSTRQRLTAGLSSRLKEEQAQLRATLEKDLKDSANDMAQLLASVAPRAMWDSDVPTLS
FT                   EFARRAQRNPNVLFVVYDDATGQHLTRYLNRENPINKALLEKGQGERALDKVLDAAKND
FT                   PSVYYLEASINPNGVEIGKVLMGVSTASVETDLAALDQRFSALIASSDQLVGDSLKGAA
FT                   ADSATAMQARLQSAQSTAAEMKANTTSTVQDAAATLRWRIGMGLALVGAGVLLLLAVVL
FT                   GHRVVNRLKMLNAAMDDLAAGEGDLTKRVQINSKDEIGDMASAVNRFVDKLQPIVREAG
FT                   DVAQRTGVEIGAMTLRNAGADAAAGMQRDEVAESLRALSQMADEAQSESHAMQAALKQV
FT                   VDIRQATDENTRTSAKVGSLIEALAGQVDTGAKVIERLAQQSEQIEVVLTVIHGIAEQT
FT                   NLLALNAAIEAARAGETGRGFAVVADEVRALASKTQSSTGDIQAHIVALQQGAREAVEA
FT                   IGQAGRQASEGLLVLRDSARLQQSVQASVEQVHAAIGLATQAAAHQAQGAQAVRGRVET
FT                   IHAQAEKAAQAVVETTASGKVLDGLAAQLKASLGQFRA"
FT   gene            complement(614720..616285)
FT                   /locus_tag="Pfl01_0530"
FT   CDS_pept        complement(614720..616285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0530"
FT                   /product="iron(III)-transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72274"
FT                   /db_xref="GOA:Q3KIY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY2"
FT                   /protein_id="ABA72274.1"
FT                   /translation="MTASLSAPATRGGYVPRRKRPSIWLVLPVLLLVVMSLLPLAYVGL
FT                   KAWQAGWSEALHLLWRPYVFSLLRNTLALMVGVTVTCGVIGLSLAWLLERSNLPGRQLW
FT                   GVILCLPFAVPAFVSSFTWVSLSAQFEGLGGAILVMSLSKYPLIFLPVAATLRNLDPSL
FT                   EESARTLGQNRWGVFFRVTLPLLWPSLLAGSLLIALHMLVEFGALSIIGLQTFTTAIYQ
FT                   QFELEFSNANAAMLSAVLLALCLMLLWLELRVRGKGRHVRTGQGAARRAEQVRLGPWAI
FT                   AGQLYCLMLAIVGSGIPLGMLAYWLAVGSSAAFPVAAITEALLSSLALSLGGAGLCLVL
FT                   AVPVGLLVVRYKGQLAIWAERLPYLLHALPGLVIALTLVYFALHYVPALYQTSALLLIA
FT                   YALLFLPLAQAPIRTALNKAAPQLEEAARTLGASSFTAFCRVTLPIIFPALGAAFALVF
FT                   LDAMKELTATLLLSPTGLNTLATEVWAHTANVEFAAAAPYAALLIVVSGLPVYLLTTRM
FT                   YLSR"
FT   gene            complement(616285..617295)
FT                   /locus_tag="Pfl01_0531"
FT   CDS_pept        complement(616285..617295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0531"
FT                   /product="putative iron-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72275"
FT                   /db_xref="GOA:Q3KIY1"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY1"
FT                   /protein_id="ABA72275.1"
FT                   /translation="MMFRNTLRRGLTFTLLGLALAPPLTQAADAVSLTLYNGQHKEVGD
FT                   AIAKAFEAKTGIHVNVRKGSSNQLASQIIEEGDRSPADVIYTEESPPLNNLGEQGLLAK
FT                   ADDATLAVLPKEYVAGNGTWIGVTARVRVVAFNPKLIDEKDLPKSVLDFADPQWQGKVG
FT                   FVPTSGAFQEQAVAIIKKHGREAAEEWLTGLRAFGKTYSNNMVALKAVENGEVATVLVN
FT                   NYYWFALQREKGKLDSKLHYFTGGDVGGLITVSSAAVLKSSKHPKEAQQFLAYMASEEG
FT                   QRVITQTTAEYPLHKGMESDRGLKPFSELEAPDVTPADLGNAEEALELEREVGLN"
FT   sig_peptide     complement(617212..617295)
FT                   /locus_tag="Pfl01_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 28"
FT   gene            complement(617488..617574)
FT                   /locus_tag="Pfl01_R0010"
FT                   /note="tRNA-Leu6"
FT   tRNA            complement(617488..617574)
FT                   /locus_tag="Pfl01_R0010"
FT                   /product="tRNA-Leu"
FT   gene            complement(617756..617842)
FT                   /locus_tag="Pfl01_R0011"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(617756..617842)
FT                   /locus_tag="Pfl01_R0011"
FT                   /product="tRNA-Leu"
FT   gene            618068..620698
FT                   /locus_tag="Pfl01_0532"
FT   CDS_pept        618068..620698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0532"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72276"
FT                   /db_xref="GOA:Q3KIY0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY0"
FT                   /protein_id="ABA72276.1"
FT                   /translation="MADWQSLDPEAAREAEKYENPIPSRELILQHLADRGSPAAREQLV
FT                   EEFGLTTEDQIEALRRRLRAMERDAQLIYTRRGTYAPVDKLDLILGRISGHRDGFGFLV
FT                   PDDGSDDLFMSPAQMRLVFDGDRALARVSGLDRRGRREGVIVEVVSRAHESIVGRYFEE
FT                   GGIGFVVADNPKIQQEVLVTPGRNANAQIGQFVEVKITHWPTPRFQPQGDVIEVVGNYM
FT                   APGMEIDVALRTYDIPHVWPEAVLKEAGKLKPEVEEKDKEKRVDLRHLPFVTIDGEDAR
FT                   DFDDAVYCEAKPGKLRLFSGGWKLYVAIADVSSYVKIGSALDNEAQVRGNSVYFPERVV
FT                   PMLPEQLSNGLCSLNPHVDRLAMVCEMTISKSGEMTDYCFYEAVIHSHARLTYNKVSAM
FT                   LETPKATEGRKLRGEYTDVLPHLKQLYALYKVLLAARHVRGAIDFETQETRIIFGSERK
FT                   IAEIRPTTRNDAHKLIEECMLAANVATAEFLKKHEIPALYRVHDGPPPERLEKLRAFLG
FT                   ELGLSLHKGKDGPSPKDYQALLASIKDRPDFHLIQTVMLRSLSQAVYSAQNEGHFGLNY
FT                   EAYTHFTSPIRRYPDLLTHRAIRSVIHSKQDTPHVRRAGAMTIPKARIYPYDEAALEQL
FT                   GEQCSMSERRADEATRDVVNWLKCEFMKDRVGESFPGVITAVTGFGLFVELTDIYVEGL
FT                   VHVTALPGDYYHFDPVHHRLAGERTGRSFRLGDTVEVRVMRVDLDERKIDFEMAEKTIS
FT                   APIGRKKRGTETTAPAAKVVEEKAPAKSTSRRPAKEKAVEAYRPSDAVAKNAELRKSRE
FT                   MKKALLADAKNGGKAASGGKTGRSAPEKASGGKPAKPSKHRKGPPKAGSAPAKSGGARK
FT                   PKAKS"
FT   gene            620695..621462
FT                   /locus_tag="Pfl01_0533"
FT   CDS_pept        620695..621462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0533"
FT                   /product="23S rRNA Gm-2251 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72277"
FT                   /db_xref="GOA:Q3KIX9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX9"
FT                   /protein_id="ABA72277.1"
FT                   /translation="MSQLEKIYGVHAVEALLRHHPKRVKQIWLAESRNDPRVQTLIELA
FT                   NENRVQIGQAERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDG
FT                   VTDPHNLGACLRSADAAGALAVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTL
FT                   EKLQQRGLWIVGTAGEAEVSIYDQDLTGPTILIMGAEGKGMRRLTREHCDYLVHLPMAG
FT                   SVSSLNVSVATGVCLFEAQRQRGAKAKAAAKKA"
FT   gene            621769..622197
FT                   /locus_tag="Pfl01_0534"
FT   CDS_pept        621769..622197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0534"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72278"
FT                   /db_xref="GOA:Q3KIX8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX8"
FT                   /protein_id="ABA72278.1"
FT                   /translation="MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRR
FT                   QLAYAINNVHKAHYVMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK
FT                   AEENRSERRERRERPEHDGSADGDDSDSDSDNSDNADE"
FT   gene            622226..622456
FT                   /locus_tag="Pfl01_0535"
FT   CDS_pept        622226..622456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0535"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72279"
FT                   /db_xref="GOA:Q3KIX7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX7"
FT                   /protein_id="ABA72279.1"
FT                   /translation="MARFFRRRKFCRFTAEDVKEIDYKDLNTLKAYVSETGKIVPSRIT
FT                   GTKARYQRQLATAIKRARFLALLAYTDSHGR"
FT   gene            622493..623383
FT                   /locus_tag="Pfl01_0536"
FT   CDS_pept        622493..623383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0536"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72280"
FT                   /db_xref="GOA:Q3KIX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX6"
FT                   /protein_id="ABA72280.1"
FT                   /translation="MRALAEFIMRGRMQATLVVAGCATLPLLYWLGAAAGSLVLLRRGL
FT                   ADALGVVSLGLLPALIWWLYADDPRALLVLLGSSGLALVLRASESWVRTLLVSVAMGLV
FT                   FSVVLGAAFAPQIEMLAQALIKVMPALLGDAYQHLSVDEQARFASLIAPVLTGLIAALL
FT                   QIVSVLSLIVGRYWQALLYNPGGFGREFRAIRIPLGPAMLLLALMLLGPNLGAQMAMLT
FT                   PLCSVPLVFAGLALIHGLVAQRRLAGFWLVGLYVTLLLFMQLIYPLLVVLAIVDSLIDF
FT                   RGRVSKDTDNANGEG"
FT   gene            623403..623849
FT                   /locus_tag="Pfl01_0537"
FT   CDS_pept        623403..623849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0537"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72281"
FT                   /db_xref="GOA:Q3KIX5"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX5"
FT                   /protein_id="ABA72281.1"
FT                   /translation="MQLILLEKIANLGNLGDKVNVKAGYGRNYLLPFGKATAATAANLA
FT                   AFEERRAELEKAAADRKASAESRAAQLAELEVTITATAGDEGKLFGSIGTHDIADALTA
FT                   SGVEVAKSEVRLPNGTIRNVGEFDVAVHLHAEVEATVRVVVVAA"
FT   gene            623970..625367
FT                   /locus_tag="Pfl01_0538"
FT   CDS_pept        623970..625367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0538"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72282"
FT                   /db_xref="GOA:Q3KIX4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX4"
FT                   /protein_id="ABA72282.1"
FT                   /translation="MNEISAPEQYDLQTAALKVPPHSIEAEQAVLGGLMLDNNAWERVL
FT                   DQVSDGDFYRHDHRLIFRAIAKLADQNLPIDVVTLAEQLDKEGQTSQVGGLGYLGELAK
FT                   NTPSVANIKAYAQIVRQRATLRQLIGISTEIADSAFNPEGRTAEEILDEAERQIFAIAE
FT                   ARPKTGGPVGVNDLLTKAIDRIDTLFNTADSITGLSTGYTDLDEKTSGLQPADLIIVAG
FT                   RPSMGKTTFAMNLVENAVLRSDKVVLVYSLEMPGESLIMRMLSSLGRIDQTKVRSGQLE
FT                   DDDWPRLTSAVNLLNDRKLFIDDTAGISPSEMRARTRRLVREHGDIGLIMIDYLQLMQI
FT                   PGSSGDNRTNEISEISRSLKALAKEFNCPVVALSQLNRSLEQRPNKRPVNSDLRESGAI
FT                   EQDADVIMFVYRDEVYHPETEHKGIAEIIIGKQRNGPIGFIRLAFIGKYTRFENLAPGS
FT                   YNFDDDE"
FT   gene            complement(625377..627956)
FT                   /locus_tag="Pfl01_0539"
FT   CDS_pept        complement(625377..627956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72283"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX3"
FT                   /protein_id="ABA72283.1"
FT                   /translation="MPAKPPSIGVTTVEVHNPPSRPVTGHFPEHSTSPPVPADTRLFTP
FT                   RPAHASLPAIDGPDTISPAPSVTFAESLSNPTASPRRLRLETYGIPSGVRLPEADTQGF
FT                   RTFKGRLFVEAYDGSIVQVGLDPESRIYRIRLSNELNPSGPVLLQDPQSKRWYPLDEFQ
FT                   AGPLALTSSRLDAFRTGLDFSGIAPDSEGLHNFEGKRYVVIESRAYQVMRDVDASSPAH
FT                   TVWRIVASKDPVASDSENTYRASRAGSTLAITRTAEGFWVPSLHGLKGGMRRSAIAQHN
FT                   KTYLLQRHEPIRNAFDALTASNTRYGELWRRAQPLPEGSDAEKAALIEIEVHVIKHTRM
FT                   QADYVKSLIDNRDWLILLKAGGLYKAELHAQQINRIDYFNKLLAVMDRRALPTLHAITV
FT                   ESLKRNLVHLDKKLKIMDERQTVMDQIQKADRSALAVLEEMNRKVPTVDQIQSSQYNIC
FT                   LRLISDDPQNPQDHGMRSAMAMHLLKQDLNEVFGYSEPLALQLTIENIKSDKAGLEALL
FT                   ASTTPAKAEYVRKALTLLDAFESKIETRLNDIFDRIDNNQELPGYDQEIDFDFLPGQVT
FT                   GAAGDAAPRKLFRTRQNGTYRVLVGVPDTAADGRITLSVPDLFKPNDPPQRYEMKEGEW
FT                   QPVRSAPAPTSRPQLVSEALARLGNVEAYLAQARLMESRKDNPTTIVEYLGAETDRLAG
FT                   LAKHLELLGQTAAGAETSHLISRLKAAADSMGAKGQDILIRMYKNKDVLDVPRLNFLLE
FT                   HAQLKVVKTVERKQLGKGKDKSFLDVYSIIDRSDNTPLWEAHFHYDRQDRAALDYTVKG
FT                   AHLKTLEQRRLGSSFQQREEQAGRPHQRIWREFISPRVAQKLFDQLT"
FT   gene            628114..630417
FT                   /locus_tag="Pfl01_0540"
FT   CDS_pept        628114..630417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72284"
FT                   /db_xref="GOA:Q3KIX2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX2"
FT                   /protein_id="ABA72284.1"
FT                   /translation="MQAAKPLFDYPKYWAECFGPAPFLPMSREEMDQLGWDSCDIIIVT
FT                   GDAYVDHPSFGMAIIGRLLESQGFRVGIIAQPNWQSKDDFMKLGEPNLFFGVAAGNMDS
FT                   MINRYTADKKIRSDDAYTPGGMAGKRPDRASLVYSQRCKEAYKHVPIVLGGIEASLRRI
FT                   AHYDYWQDRVRNSILIDASADILLYGNAERAIVEVAQRLSYGHKIEDITDVRGTAFIRR
FT                   DTPAGWYEVDSTRIDRPGKIDKIINPYVNTQDTQACAIEQEKGPVEDPEEAKVVQILAS
FT                   PKMTRDKTVIRLPSMEKVRNDPVLYAHANRVLHLETNPGNARALVQKHGEIDVWFNPPP
FT                   IPMTTEEMDYVFGMPYARVPHPAYGKEKIPAYDMIRFSVNIMRGCFGGCTFCSITEHEG
FT                   RIIQNRSEESIIREIEEIRDKVPGFTGVISDLGGPTANMYRIACKSPEIESACRKPSCV
FT                   FPGICPNLNTDHSSLIQLYRSARALPGVKKILIASGLRYDLAVESPEYVKELVTHHVGG
FT                   YLKIAPEHTEEGPLNQMMKPGIGTYDRFKRMFEKYTKEAGKEQYLIPYFIAAHPGTTDE
FT                   DMMNLALWLKGNGFRADQVQAFYPSPMATATAMYHSGKNPLRKVTYKSDGVTIVKSEEQ
FT                   RRLHKAFLRYHDPKGWPMLREALTRMGRADLIGPGKHQLIPLHQPATDSYQSARRKNST
FT                   PAGSHKVAKEKTTKILTQHTGLPPRASDGGNPWDKREQAKAAAFARNQQAAKERKEAAK
FT                   GKGPKPARKPVVPR"
FT   gene            630724..633999
FT                   /locus_tag="Pfl01_0541"
FT   CDS_pept        630724..633999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72285"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX1"
FT                   /protein_id="ABA72285.1"
FT                   /translation="MSIHVALHHVTHYRYDRAVELGPQIVRLRPAAHSRTRILSYSLKV
FT                   SPEQHFINWQQDPQGNYLARLVFPEKTAELRIEVDLLAEMAVFNPFDFFLEPYAEKIPF
FT                   AYAADERKELAPYLETLPLTPKFKAYLDAIDRTPLPAVDFLVALNQRLSEDINYLIRME
FT                   PGVQTPEHTLEHASGSCRDSAWLLVQLLRNLGLAARFVSGYLIQLTADVKSLDGPSGTE
FT                   VDFTDLHAWCEVYLPGAGWIGLDATSGLFAGEGHIPLACSPDPSSAAPISGLVEPCECE
FT                   FSHEMSVERIWEAPRVTKPYTDEQWLAIQSLGRQIDADLLEGDVRLTMGGEPTFVSIDD
FT                   PDGAEWNTAALGPDKRRLSAELFQRLRKHYAPKGLVHFGQGKWYPGEQLPRWSLNCYWR
FT                   RDGVPIWHNNALIADEQQDYGATGELAGRFLASVAERLKLPTRFVFPAYEDNFYYLWRE
FT                   GALPSNVSAEDSRLEEPLERARLRKVFSQGLDKVIGQVLPLARTAKGDQWQSGRWYLRD
FT                   EHCRLVPGDSPLGYRLPLGSQPWVKAAEYPFIHPNDPNQDFPELPETAQLNQHGEPAPA
FT                   YDRVPKIDESADWLTRTAFCAEAREGRLYLFMPPLERVEDYLELVAAIEATAEELHCPV
FT                   LLEGYEPPSDPRLNNFRITPDPGVIEVNVQPSAAWDELVERTEFLYEEARQTRLSTEKF
FT                   MVDGRHTGTGGGNHFVLGGATPGDSPFLRRPDLLRSLISYWHNHPSLSYLFSGLFIGPT
FT                   SQAPRVDEARNDALYELEIAFAQMPAPGEECAPWLVDRLLRNLLIDVTGNTHRAEFCID
FT                   KLYSPDGATGRLGLLELRGFEMPPHARMSLAQQLLLRALVARFWREPYAPPKLARWGTE
FT                   LHDRFMLPHFIEQDFADVIVELNSAGYPLRAEWFAAHLEFRFPKVGDYAVNGIELELRQ
FT                   ALEPWHVLGEEGAAGGTVRYVDSSLERLQVKLTGLPPQRYLLTCNGIPVPLQPTGRVGE
FT                   FVAGVRFRAWQPANCLQPTIPVHAPLVFDLLDTWMQRSLGGCQYHVAHPGGRNYETLPV
FT                   NANEAESRRMARFFRIGHTPGKLPIPNLTISDELPMTLDLRRF"
FT   gene            634088..636574
FT                   /locus_tag="Pfl01_0542"
FT   CDS_pept        634088..636574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72286"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX0"
FT                   /protein_id="ABA72286.1"
FT                   /translation="MPDLLDRYPLTAGTYHELLDDSGAVRPHWRRLVDQLQRSTPAQLV
FT                   QRQALLTRQIQENGVTYNVYADPKGADRPWELDLLPHVIAADEWQQLSAGIAQRARLLN
FT                   AVLADLYGPQQLIREGLLPAELVFGHNNFLWPCQGIAPPDGAFLHLYAVDLARTPDGRW
FT                   WVTADRTQAPSGAGYALENRTIVSRAFPELYRDLKVQHLAGFFRTLQETLAHQAPCDDD
FT                   APLVVLLTPGRFNESYFEHLYLARQLGYPLVEGGDLTVRDATVYLKTLSGLRRVHAIMR
FT                   RLDDDFCDPLELRTDSALGVPGLLEAVRQGRVLVANALGSGVLESPGLLGFLPKINQYL
FT                   FGEELILPSIATWWCGEAPVLAQALEKLPELLIKPAFPSQSFTPVFGRDLSEKQRESLA
FT                   ARMQARPYAYVAQELAQLSQAPIWQPEDGQLQPRAIGMRMYAVASHDGYRVLPGGLTRV
FT                   AAEADAEVVSMQRGGASKDTWVLGDRPPSGEQWKAQRNIGVPDLVRRDPYLPSRVVENL
FT                   FWFGRYCERCDDSARLLRIMLARYVDGDDPQALQAAVDLGERLMLLPDEGELPERLLAA
FT                   LLGEDWSFSLRSNLQRLQWAASQVRGKLSRENWQALVELQREASELDTDEPDFGELLDF
FT                   LNRLVMSLAALSGFALDDMTRDEGWRFLMIGRRIERLQFLSSSLAGFLRGAGAFDQAGL
FT                   EWLLELGNSSITYRSRYLAVAQLIPVLDLLLLDEQNPHAVLFQLKLVTRTLKRLNDDFG
FT                   VPREAGLPTLVERLARFDLSCLENPLFGEPSVRAALDGLADLLQEIADASSQVSDRLAL
FT                   RHFAHVDDVSQRTVSV"
FT   gene            636574..637464
FT                   /locus_tag="Pfl01_0543"
FT   CDS_pept        636574..637464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72287"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW9"
FT                   /protein_id="ABA72287.1"
FT                   /translation="MSAHYQILHDTCYRYDSPVSLAQQLAHLWPRECEWQRCTEQQLLI
FT                   SPEPTTRRDEQDVFGNPLTRLAFERPHDELQVNARLTVEVLARPVVDFQQSPAWELTRN
FT                   ALTYSSQPLSASLLEACRYRFQSPYVHLKRSFVEFSESCFPAGRPLMLGVQALMQKIFS
FT                   EFTFDAEATQVATPLVEVLERRRGVCQDFAHLMLACVRSRGLAARYVSGYLLTQPPPGQ
FT                   PRLIGADASHAWVSVFCPVLGWVDFDPTNNVQPALEHITLAWGRDFSDVSPLRGVILGG
FT                   GSHDPEVRVTVMPLE"
FT   gene            complement(637529..637708)
FT                   /locus_tag="Pfl01_0544"
FT   CDS_pept        complement(637529..637708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW8"
FT                   /protein_id="ABA72288.1"
FT                   /translation="MAKPNYSFAKRQRDLAKEQKKEEKLQRKKQMAEEAALNPDGEVAT
FT                   DNDVEAPKDQAPDT"
FT   gene            complement(637777..638364)
FT                   /locus_tag="Pfl01_0545"
FT   CDS_pept        complement(637777..638364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72289"
FT                   /db_xref="GOA:Q3KIW7"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW7"
FT                   /protein_id="ABA72289.1"
FT                   /translation="MSLTSVCVFCGANAGTIPAYTEAAIALGTAIAERKLTLVYGGGAV
FT                   GLMGIIADAALAAGGEVIGIIPQSLMDKEIGHKSLTRLEVVDGMHARKARMAELSDAFI
FT                   ALPGGLGTLEELFEVWTWGQLGYHGKPLGLLEVNGFYSKLTAFLDHIVGEGFVRAPHRD
FT                   MLQVSESPQTLLEALDQWQPTVTPKWVDQKPG"
FT   sig_peptide     complement(638293..638364)
FT                   /locus_tag="Pfl01_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.484 at
FT                   residue 24"
FT   gene            638706..639152
FT                   /locus_tag="Pfl01_0546"
FT   CDS_pept        638706..639152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0546"
FT                   /product="azurin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72290"
FT                   /db_xref="GOA:Q3KIW6"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW6"
FT                   /protein_id="ABA72290.1"
FT                   /translation="MFSKVVAVSLLALASSQLMAAECKTTVDSTDQMSFNTKAIEIDKS
FT                   CKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLAAGIDKNYLKDGDERVIAHT
FT                   KIIGAKETDSLTIDVSKLKADEKYGFFCSFPGHISMMKGTVTLK"
FT   sig_peptide     638706..638768
FT                   /locus_tag="Pfl01_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(639208..640035)
FT                   /locus_tag="Pfl01_0547"
FT   CDS_pept        complement(639208..640035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0547"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72291"
FT                   /db_xref="GOA:Q3KIW5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIW5"
FT                   /protein_id="ABA72291.1"
FT                   /translation="MQAVQREIAEQLNVQPPFADDQALEAEVARRISFIQDCLTSSGLK
FT                   TLVLGISGGVDSLTAGLLAQRAMRELRERTGDEAYKFIAVRLPYDVQFDEHDAQASVDF
FT                   IAPDERHTVNIGPAVKSLASEVAAFEGKHAVSVDFVLGNTKARMRMVAQYTIAGATHGL
FT                   VIGTDHAAEAVMGFFTKFGDGACDLAPLSGLVKNQVRAIARSFGAPESLVEKVPTADLE
FT                   DLSPGKPDEASHGVTYAEIDAFLHGEPVRQEAFDIIVNTYKKTHHKRVMPFAP"
FT   gene            complement(640040..641263)
FT                   /locus_tag="Pfl01_0548"
FT   CDS_pept        complement(640040..641263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0548"
FT                   /product="nicotinate phosphoribosyltransferase (naprtase)"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72292"
FT                   /db_xref="GOA:Q3KIW4"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIW4"
FT                   /protein_id="ABA72292.1"
FT                   /translation="MSESVFADRIVQNLLDTDFYKLTMMQAVLHNYPNVEVEWEFRCRN
FT                   SEDLRPYLAEIRFQVERLAELSLSADQLSFLERISFLKPDFLRFLGLFRFNLRYLHTGI
FT                   ENGELFIRLRGPWLHVILFEVPLLAIVSEVRNRYRYRETVLEQAREQLYRKFDWLTANA
FT                   SAEELSQLQVADFGTRRRFSYRVQEEVVNVLKHDFPGRFVGTSNVHLSRELDMKPLGTM
FT                   AHEWIMAHQQLGPRLIDSQIAALDCWVREYRGLLGIALTDCITTDAFLGDFDLFFAKLF
FT                   DGLRHDSGDPVLWGEKCIAHYHKLGIDPMSKTLVFSDSLTLPKSLEIFRALRGRINVSF
FT                   GIGTNLTCDIPGVEPMSIVLKMTACNGQPVAKISDEPGKTHCKDPNFVAYLRHVFQVPA
FT                   VSSLSSKE"
FT   gene            complement(641371..642276)
FT                   /locus_tag="Pfl01_0549"
FT   CDS_pept        complement(641371..642276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0549"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72293"
FT                   /db_xref="GOA:Q3KIW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW3"
FT                   /protein_id="ABA72293.1"
FT                   /translation="MLNKRHLPSITALQCFEAVTRHLSFTRAAEELNLTQSAVSKQVAQ
FT                   LEELLQHLLFRRVRRRLQMTPAGDLYLVEVRKILTQVEMSTHYLRSYGGETEVLRVSTP
FT                   STFGARWLVPRLKGWRLRHPSIHLDLCNEQEADDLLQGRSDLAFYFGQGSRPGTECLKL
FT                   FGEELVPVCAPGSLPDTPLTDPTQLTDLVLLQNASRPQAWHDWFDSQGYQTEHSYHGPR
FT                   FETFYMCIRAAQVGCGVALLPRFLVEEELADGKLVIPWQHAMPSTDAYYLAYPEHAAEV
FT                   PKVRDFVKWMLEQIDSPDAV"
FT   gene            642438..643928
FT                   /locus_tag="Pfl01_0550"
FT   CDS_pept        642438..643928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0550"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72294"
FT                   /db_xref="GOA:Q3KIW2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW2"
FT                   /protein_id="ABA72294.1"
FT                   /translation="MVAALLDRLGVNPALYQNGKVPVHSPIDGSRIGAVNWEGPAEVEQ
FT                   HISRADHAFEQWRKVPAPRRGELVRQFGEVLREYKTELGELVSWEAGKITQEGLGEVQE
FT                   MIDICDFAVGLSRQLYGLTIASERPGHHMRETWHPLGVVGVISAFNFPVAVWAWNTTLA
FT                   LVCGNPVVWKPSEKTPLTALACQALFERVLKNFSDAPAHLSQVIIGGRDAGEALVDDPR
FT                   VALISATGSTRMGREVAPKVAARFARSILELGGNNAMILGPSADLDMAVRAILFSAVGT
FT                   AGQRCTTLRRLIAHESVKEEIVTRLKAAYSKVRIGHPLEGNLIGPLIDKHSFENMQDAL
FT                   EQALSEGGRVFGGKRQLEDQFPNAYYVSPAIVEMPEQSDVVCSETFAPILYVVGYSDFE
FT                   EALRLNNAVPQGLSSCIFTTDVREAEKFMSAVGSDCGIANVNIGPSGAEIGGAFGGEKE
FT                   TGGGRESGSDAWRAYMRRQTNTVNYSLELPLAQGITFD"
FT   gene            644096..645379
FT                   /locus_tag="Pfl01_0551"
FT   CDS_pept        644096..645379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0551"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72295"
FT                   /db_xref="GOA:Q3KIW1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW1"
FT                   /protein_id="ABA72295.1"
FT                   /translation="MPLREECLWEKLTPQRPDNTALRGEVKVDVCVIGAGFTGLSAALH
FT                   LLEKGKSVCVLEAHRAGHGGSGRNVGLVNAGMWIPPDEIEAGFGEAVGSQLNRMLGAAP
FT                   ALVFSLVDKYNIDCQLRREGTLHMAHNARGEADLRSREEQWKRRGAPVELLTGKACEQA
FT                   TGTQKIAAALLDRRAGTLNPMAYVTGLANAVMSLGGQMFDHSPVARLERQGPKWSVQTE
FT                   QGSVLAEQVVIASNAYTEGDWTELKRNFFPGYYYQVASVPLTEDAAQEILPGGQGSWDT
FT                   RQVLSSIRRDKDGRLLLGSLGNGNQKPTWFLKAWADRVQQHYFPNLKPVEWECTWTGRI
FT                   AFTPDHLMRLFEPAPGLVAVTGYNGRGVTTGTVVGKAFADYLCNGNPQALPIPFAPMQP
FT                   LAGVGLRSCLYEAGFSLYHAGQCLRIVI"
FT   gene            645744..646877
FT                   /locus_tag="Pfl01_0552"
FT   CDS_pept        645744..646877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0552"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72296"
FT                   /db_xref="GOA:Q3KIW0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW0"
FT                   /protein_id="ABA72296.1"
FT                   /translation="MSQTFYKKGFLALAVATALGVSAFAQADVKIGVAGPMTGANAAFG
FT                   EQYMKGAQAAADAVNAAGGVNGEKIVLVKGDDACEPKQAVTVAKDLTNQKVAGVVGHFC
FT                   SSSTIPASEIYDEAGIIAITPGSTNPQVTERGLSAMFRMCGRDDQQGIVAGDYIVDVLK
FT                   GKKVVVLHDKDTYGQGLADATKAQLEKRGVKPVLYEGLTRGEKDFSTIVTKIRGAGADV
FT                   VYFGGLHPEAGPLVRQLREQGLKDVKFMSDDGIVTDELVTTAGGPQFVDGVLMTFGADP
FT                   RLLPDSKTVVDAFRKAGTEPEGYTLYAYASVQALAAAFNGAKSNKGEEAAAWLKKNPVK
FT                   TVMGEKTWDSKGDLKVSDYVVYQWDKDGKYHQLEKQK"
FT   sig_peptide     645744..645827
FT                   /locus_tag="Pfl01_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.718 at
FT                   residue 28"
FT   gene            647107..648021
FT                   /locus_tag="Pfl01_0553"
FT   CDS_pept        647107..648021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0553"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72297"
FT                   /db_xref="GOA:Q3KIV9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV9"
FT                   /protein_id="ABA72297.1"
FT                   /translation="MDGIFLQQLVNGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYM
FT                   ISAYLAAISLALLAYFGIESFPLLMLGTLIFTIVITAVYGWVIERVAYKPLRNSTRLAP
FT                   LISAIGISLILQNYAQIAQGAKQQGVPTLLTGAWRVEVGTGFVQLTYTKVFILVAAFVG
FT                   MGLLTYVIKYTKLGRMCRATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMN
FT                   YGTFDFYAGFIIGIKAFTAAVLGGIGSLPGAMLGGIILGISESLFSGLVNSDYKDVFSF
FT                   SLLVLVLVFRPQGLLGRPLVSKV"
FT   gene            648025..649326
FT                   /locus_tag="Pfl01_0554"
FT   CDS_pept        648025..649326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0554"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72298"
FT                   /db_xref="GOA:Q3KIV8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV8"
FT                   /protein_id="ABA72298.1"
FT                   /translation="MSSTTTKSIDVKKSLVEAILAGLIALIVFGPIVGVVLDGYSFNLE
FT                   PTRVAWIIAIVMAGRFALSLFLQTPKGLRILDGFESTGSGVHVLPPDYKSRLRWIIPLM
FT                   IAIAVALPFFSNSYLLGVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLAL
FT                   GYQYLGLGFWTVLPLAAITAGLAGCILGFPVLRLHGDYLAIVTLGFGEIIRLVLNNWLS
FT                   LTGGPNGMPAPLPTFFGLEFGKRAKDGGVPFHEFFGIAYNPDVKYYFIYAVLFLVVLAV
FT                   LYIKHRLVKMPVGRAWEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFATYQ
FT                   GFVNPTSFTFFESALILAIVVLGGMGSTIGVVIAAFVLTVAPELLRGFAEYRVLLFGIL
FT                   MVLMMIWRPRGLIRISRTGVTPRKGAIHYERTAP"
FT   gene            649323..650195
FT                   /locus_tag="Pfl01_0555"
FT   CDS_pept        649323..650195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0555"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72299"
FT                   /db_xref="GOA:Q3KIV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV7"
FT                   /protein_id="ABA72299.1"
FT                   /translation="MSEVVLSVEKLMMHFGGIKALSDVSLKVKRNSIFALIGPNGAGKT
FT                   TVFNCLTGFYKASGGKIELNVRGQQTNVIQLLGESFKPTDFVSPKNFASRLYYKMFGGT
FT                   HLVNRAGLARTFQNIRLFKEMSVLENLLVAQHMWVNRNMLAGILNTKGYRKAESDALDC
FT                   AFYWLEVVDLVDCANRLAGELSYGQQRRLEIARAMCTRPQIICLDEPAAGLNPQETEAL
FT                   SAMIRLLRDEHDLTVVLIEHDMGMVMSISDHIVVLDHGIVIAEGGPDAIRNDPKVIAAY
FT                   LGADEEEVV"
FT   gene            650192..650908
FT                   /locus_tag="Pfl01_0556"
FT   CDS_pept        650192..650908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0556"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72300"
FT                   /db_xref="GOA:Q3KIV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV6"
FT                   /protein_id="ABA72300.1"
FT                   /translation="MTQPILELKDLDVFYGPIQALKGVSLQINEGETVSLIGSNGAGKS
FT                   TLLMSIFGQPRAAGGQILYQGVDITHKSSHYIASNGIAQSPEGRRVFPDMTVEENLLMG
FT                   TIPIGDKYAKEDMQRMFELFPRLEERRNQRAMTMSGGEQQMLAIARALMSRPKLLLLDE
FT                   PSLGLAPIVVKQIFATLRELAKTGMTIFLVEQNANHALKLSDRAYVMVNGEIRLTGTGQ
FT                   ELLVNEEVRNAYLGGH"
FT   gene            651648..652412
FT                   /locus_tag="Pfl01_0557"
FT   CDS_pept        651648..652412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0557"
FT                   /product="putative amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72301"
FT                   /db_xref="GOA:Q3KIV5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV5"
FT                   /protein_id="ABA72301.1"
FT                   /translation="MSNTLFITGATSGFGEACARRFAEAGWKLVLTGRREERLNALCAE
FT                   LSKQTEVHGLVLDVRDRKAMEEAIANLPPSFAKLRGLINNAGLALGVDPAPKCDLDDWD
FT                   TMVDTNVKGLMYSTRLLLPRLIAHGRGAGIINLGSIAGNYPYPGSHVYGATKAFVKQFS
FT                   LNLRCDLQGTGVRVSNIEPGLCESEFSLVRFAGDQARYDATYAGAEPIQPQDIAETIFW
FT                   VLNAPAHININSLELMPVSQTWAGFAIERNKA"
FT   gene            652542..653447
FT                   /locus_tag="Pfl01_0558"
FT   CDS_pept        652542..653447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0558"
FT                   /product="putative cation transport-related membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72302"
FT                   /db_xref="GOA:Q3KIV4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV4"
FT                   /protein_id="ABA72302.1"
FT                   /translation="MSNRGEQSLLKQSTILMFAVSIAGIATGFVSGSQSILFDGFFSLI
FT                   ATFIKVLMLITAKLIAKQSNQRFQFGFWHLEPMVLLIEGSFLLLIAIYAFLNGVFGIIN
FT                   GGREIELGLVIIYAAVFTVVEFAYFFYVRHRNRKFKSSLIQFDNISWLVDAMLSVGLLI
FT                   SFLAALLLKSQGYGEWAKFVDPLILIVLALTMLPPAFKILGPALRDVLGIAPDTLDDQV
FT                   RQVMDAAKVEHGFDDYVSYVQKHGRARFIEIHVVLPANYRLQSVGQLDVLREEISAKLG
FT                   KPDAARWLTISFTGDRKWIA"
FT   sig_peptide     652542..652640
FT                   /locus_tag="Pfl01_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.609 at
FT                   residue 33"
FT   gene            complement(653487..654620)
FT                   /locus_tag="Pfl01_0559"
FT   CDS_pept        complement(653487..654620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0559"
FT                   /product="putative epimerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72303"
FT                   /db_xref="GOA:Q3KIV3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV3"
FT                   /protein_id="ABA72303.1"
FT                   /translation="MPHASRSTSLPELTALFGEVQQHFLDVIVPLWQGPGWNADMALPY
FT                   EALDAAHQPLPPQRYRAMACARQLYLFSSLIGVVDNAEVRAAALFRSLQRHFHDAEHGG
FT                   WFYSIDPQGKPLDKRKDLYTHAFILFACAHYWEKSREPLVESTLNAALEVIGRRFATGD
FT                   GLYEACLDRDWITLETGPLQNPLMHLAEAFLATLAVREDAQVKQALSELCTAMHKRFVD
FT                   PQAGVLMEKPLGAVDNWYEPGHQFEWYFLLESSPLLRGSKLHAALDRAFAFTEQYGVVQ
FT                   PSGAVRAMLDLNMGGRPKDSTQRIWAQAEYLRALTLRPDSEAAVLRQLQALQQRFLHAG
FT                   GWHECRDEQGEVSRKDMPSTTPYHLATCYRGLADYLS"
FT   gene            complement(654721..655293)
FT                   /locus_tag="Pfl01_0560"
FT   CDS_pept        complement(654721..655293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0560"
FT                   /product="putative urease/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72304"
FT                   /db_xref="GOA:Q3KIV2"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV2"
FT                   /protein_id="ABA72304.1"
FT                   /translation="MTLKRILGAVALLLTPALAFAHPGHGDSGLVAGISHPIGGLDHLL
FT                   AMVAVGLWAAQQQGAARWALPCTFVGTMLIGGLLGFEGLELPALESGIAASVLALGLAV
FT                   ALAVRPPLVMAVAATALFALFHGVAHGLELPDMSSPWAYAAGFVVATAALHAAGYAVVR
FT                   FLPQAAAPLVRLAGTASAVTGAWLLAG"
FT   sig_peptide     complement(655228..655293)
FT                   /locus_tag="Pfl01_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 22"
FT   gene            complement(655321..655935)
FT                   /locus_tag="Pfl01_0561"
FT   CDS_pept        complement(655321..655935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0561"
FT                   /product="urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72305"
FT                   /db_xref="GOA:Q3KIV1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIV1"
FT                   /protein_id="ABA72305.1"
FT                   /translation="MNTQPLRVGIGGPVGSGKTALTLALCLALRERYNLAVVTNDIYTR
FT                   EDADFLVRNEALAPERIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESG
FT                   GDNLSATFSPELSDLTIYVIDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLEM
FT                   MNSDTQRMRNGKPFVFSNQKTGQGLEEIIAFIERQGLLTAA"
FT   gene            complement(655958..656632)
FT                   /locus_tag="Pfl01_0562"
FT   CDS_pept        complement(655958..656632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0562"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72306"
FT                   /db_xref="GOA:Q3KIV0"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIV0"
FT                   /protein_id="ABA72306.1"
FT                   /translation="MNPAWALLRLASPQLPIGGYSYSQGLEMAVDNGRVDSPDSARRWI
FT                   SDQLLLNLARFEAPLLLAHCQAAADEHWDELRKLCESHRASRETRELHLESRQMGYSLQ
FT                   QLLNGLPELDQPARDFLEHCAEPHLALCWALAARAWQISPQDALAAWLWSWLENQLAVL
FT                   MKTLPLGQQAAQRLTSELLPLLQQAQQDATRINPEHLGSAAFGLSLACMAHERQYSRLF
FT                   RS"
FT   gene            complement(656629..657129)
FT                   /locus_tag="Pfl01_0563"
FT   CDS_pept        complement(656629..657129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0563"
FT                   /product="urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72307"
FT                   /db_xref="GOA:Q3KIU9"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIU9"
FT                   /protein_id="ABA72307.1"
FT                   /translation="MLVIHRRIDPQPVWAAELHLTFEARSKSRLRCFSAEGEDVGLFLE
FT                   RGQPPLYDGECLQAEDGRIVRVCARPEQLLHVTCANAFELTRAAYHLGNRHVALQVGDG
FT                   WLRLLDDYVLKAMLEQLGAQVESIEAPFQPEHGAYGGGHHHSRHGDEDFNYAPKLHQFG
FT                   VRL"
FT   gene            complement(657333..657965)
FT                   /locus_tag="Pfl01_0564"
FT   CDS_pept        complement(657333..657965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0564"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72308"
FT                   /db_xref="GOA:Q3KIU8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU8"
FT                   /protein_id="ABA72308.1"
FT                   /translation="MLPRAEQKQQTRNALMDAARHLMESGRGFGSLSLREVTKTAGIVP
FT                   TGFYRHFADMDELGLVLVSEVGQTFRETIRLVRHNEFVMGGIIDASVRIFLDVVSANRS
FT                   QFLFLAREQYGGSLPVRQAIGRLREDISSDLAADLALMPKLQHLNREGLSVMADLIVKS
FT                   VFATLPDIIDPPAEALPEHLTPQAKITQQLRFIFIGLKHWQGLGSTE"
FT   gene            complement(658140..658604)
FT                   /locus_tag="Pfl01_0565"
FT   CDS_pept        complement(658140..658604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU7"
FT                   /protein_id="ABA72309.1"
FT                   /translation="MKRQLLFSLTLSMLASTAFALPAADQATPQVKTSHSVFSQTVAAD
FT                   GSDRTPQGQTLAENGRNRLEEKGLVQDGYDKTPQGQTVAEGGRDRLEEKGLVQDGSDRT
FT                   PQGQTLASDGGDRTPQGQTLAADGYDKTPQGQTLAEGGGDRVIERNSALS"
FT   sig_peptide     complement(658542..658604)
FT                   /locus_tag="Pfl01_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 21"
FT   gene            658986..661061
FT                   /locus_tag="Pfl01_0566"
FT   CDS_pept        658986..661061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0566"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72310"
FT                   /db_xref="GOA:Q3KIU6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU6"
FT                   /protein_id="ABA72310.1"
FT                   /translation="MTRTRKIFVWTFATLVLLLAVLVLIIVFFDWNRIKPPLNAKVSEE
FT                   LHRPFAINGNLSVVWRRELDEGGWRAWVPWPHVVAEDLTLGNPDWSKQPQMVTLKRVEL
FT                   RISPLALLAQRVAIPRIDLTEPNAQLQRLADGRANWTFKFDPKDPNAEPSNWVVDIGAI
FT                   GFDKGHVTLDDQTLKTNLNLLIDPLGKPIPFSDIVGDKAAKTAQDKGGAPQDYAFGLKV
FT                   TGQYHGQKLAGQGKIGGLLALQDASKPFPLQAQAKIGDTSVELAGTLTDPLNLGALDLR
FT                   LKLAGASLGNLYPLTGVTLPDTPPYATDGHLIAKLHEPDGAQFRYEQFNGKIGSSDIHG
FT                   DLAYVASQPRPKLSGALLSNQLLFADLAPLIGADSNAKQKARGGESKQPADKVLPVEEF
FT                   KTERWRDMDADVEFTGKRIVHSEELPFTDLYTHLKLNDGELSLEPLRFGVAGGNLDAQI
FT                   RLNGRTEPLEGRARLTARKFKLKQLFPTFEPMKTSFGELNGDADIAGRGNSVAKLLGGA
FT                   NGNLKMLINDGAISRELMELAGLNVGNYVVGKIFGDKEVKINCAAADFDIKTGLATTRL
FT                   FVFDTENAIIYIDGTANMATEQLDLTVTPESKGWRLISLRSPLYVRGKFIKPDAGVKAV
FT                   PLMLRGAGMVALGVIAAPAAGLLALVAPSGGEPNQCAPLLEQMKAGKAPATVKPTK"
FT   sig_peptide     658986..659084
FT                   /locus_tag="Pfl01_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.595 at
FT                   residue 33"
FT   gene            complement(661163..661693)
FT                   /locus_tag="Pfl01_0567"
FT   CDS_pept        complement(661163..661693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0567"
FT                   /product="putative bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72311"
FT                   /db_xref="GOA:Q3KIU5"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU5"
FT                   /protein_id="ABA72311.1"
FT                   /translation="MSDLQLSDVQTLRERARQHVENGAVTESYSANREEVLRLLNESLA
FT                   TELVCVLRYKRHYFMANGLKANVAADEFLEHATQEAEHADRLAERIVQLGGEPEFNPDL
FT                   LSKMSHAQYVAGNTLKEMVYEDLVAERIAIDSYREIIQYIGEKDPTTRRIFEDILAQEE
FT                   EHADDMADILKDL"
FT   gene            complement(661792..662694)
FT                   /locus_tag="Pfl01_0568"
FT   CDS_pept        complement(661792..662694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0568"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72312"
FT                   /db_xref="GOA:Q3KIU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU4"
FT                   /protein_id="ABA72312.1"
FT                   /translation="MFASLPLTALRAFESASRLLSFKAAAEELAVTPTAISHQIRSLED
FT                   WLGVALFERLPRQVRLTEGGERLFRSLHGAFLEVAQSVDTLRPQRSGSSLTLSTTAAFA
FT                   ALWLVPRLGRFYAKHPNINVRLDTHCEVIDLHQDASVDLVLRYSLDDYPNLYGLCLFDE
FT                   SFGVYGSPEQVALAARRTPALISVHWHNSKLYAHGWEAWCAQSGENWLNQHPAVREYDE
FT                   EHYALQAAIAGQGLVLASNILVSQSVASGLLVPYKGEVQVDGAGYSALCVPGRERHPPV
FT                   KAFFAWLREEAQLSGHVPR"
FT   gene            662814..663452
FT                   /locus_tag="Pfl01_0569"
FT   CDS_pept        662814..663452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0569"
FT                   /product="putative acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72313"
FT                   /db_xref="GOA:Q3KIU3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIU3"
FT                   /protein_id="ABA72313.1"
FT                   /translation="MSKILAIHASPRGERSHSRRLAETFLSAWQVRHPQAQVTRREVGR
FT                   ALIPAVNEAFVAAAFYPEPEARPLTMQADLALSDQLVGELFDHDLLLISTPMYNFNVPS
FT                   GLKAWVDQIVRLGLTFDHTLDNGIAQYTPLLHGKKALIVTSRGGFGFGPGGELEALNHA
FT                   DPWLRTALGFIGINDVTVVAAEGEESAERTFAVSVAEAEQRLLDLARAF"
FT   gene            663453..663758
FT                   /locus_tag="Pfl01_0570"
FT   CDS_pept        663453..663758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0570"
FT                   /product="putative chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72314"
FT                   /db_xref="GOA:Q3KIU2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU2"
FT                   /protein_id="ABA72314.1"
FT                   /translation="MAWLFLLIAAGFEVTFAMGMKYAEGFTRLWPSLITVVAAVGGVYF
FT                   LTLAMRELPVSIAYPIWTAIGSLGTVFLGFALLGESLTLVKLLSVGLIVAGVVGLK"
FT   gene            663850..664740
FT                   /gene="lipA1"
FT                   /locus_tag="Pfl01_0571"
FT   CDS_pept        663850..664740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA1"
FT                   /locus_tag="Pfl01_0571"
FT                   /product="Lipase precursor"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72315"
FT                   /db_xref="GOA:Q3KIU1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU1"
FT                   /protein_id="ABA72315.1"
FT                   /translation="MSQDSATRYPLVLVPGMLGFIRLVLYPYWYGIIKALRRGGATVIA
FT                   VQVSPLNSTEVRGEQLLTRIDEILRETGAAKVNLFGHSQGSLTARYAAAKRPDLVASVT
FT                   SVAGPNHGSELADYLAKYYPADSAKGRILEALLRSVGWLMALLETGYHGPKLPVDIHAS
FT                   HHSLTTEGVALFNQLYPQGLPQTWGGHGPEEVNGVRYYSWSGTLQPGKTDRGGNLFDGT
FT                   NRSCRLFAKTFVREPGQCDGMVGRYSSHLGTVIGDDYPMDHFDIVNQSLGLVGKGADPV
FT                   RLFVEHAARLKAAGV"
FT   gene            complement(664737..665630)
FT                   /locus_tag="Pfl01_0572"
FT   CDS_pept        complement(664737..665630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0572"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72316"
FT                   /db_xref="GOA:Q3KIU0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU0"
FT                   /protein_id="ABA72316.1"
FT                   /translation="MQYAFPLLAIFIWAGNTVINKLAVGAIFPAEIGFYRWLLAGLLFT
FT                   PFMLKKVIAHWPQIRPNLGKIFILGVLGMAVYQSLAYFAATLTSATNMGIILSLMPLMS
FT                   LAMAIISLGQQLTAGALVGAVLSFAGVLVVVSSGSLGALLQHGVNLGDAMMLIATLAYA
FT                   IYSTLLKKWQLRLPPLVLLYLQVLVAVVVLFPLYAASPKTGLTLQNIPLVLYACLLASM
FT                   LAPLAWMQAVQRLGPSRTTLFFNLLPLITALIAAVVLKEQLALYHLVGGLLTLGGVILS
FT                   ERWTTVLGRSRTPSAA"
FT   gene            665729..666523
FT                   /locus_tag="Pfl01_0573"
FT   CDS_pept        665729..666523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0573"
FT                   /product="putative AraC-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72317"
FT                   /db_xref="GOA:Q3KIT9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT9"
FT                   /protein_id="ABA72317.1"
FT                   /translation="MNSKHIDLLDFSELPSAVYFRYADFNAHEYAAPHRHPWGTLEYAA
FT                   HGVLHMDVDGSRFMSPPQYAVWVPPQVEHSFYSHQPVNYRAVCLAPDVCSDLPAQACTL
FT                   AISDILKAILKDFAARDVKIPAFEADQRLAQVLVDQLRQAPVHQCYLPYASSPGLLTIL
FT                   ETLQAEPGNNEPLAHWAAQVHVSERTLARQFVRELGMSFGEWRQRLRYLVAIEALESSR
FT                   SVQEIAFDLGYSSGSAFIAMFARQAGCTPEQYRRSHLEARKV"
FT   gene            666587..666892
FT                   /locus_tag="Pfl01_0574"
FT   CDS_pept        666587..666892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0574"
FT                   /product="phosphate starvation-inducible protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72318"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT8"
FT                   /protein_id="ABA72318.1"
FT                   /translation="MKMLRVPLLMIGLLLCSQGFAATAQQNKMTTCNADATAKSLKGDE
FT                   RKAFMSTCLKAAPAANDAKALTPQQQKMKTCNADAATKALTGDARKTFMSDCLKKK"
FT   sig_peptide     666587..666652
FT                   /locus_tag="Pfl01_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.672 at
FT                   residue 22"
FT   gene            667241..668254
FT                   /locus_tag="Pfl01_0575"
FT   CDS_pept        667241..668254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0575"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72319"
FT                   /db_xref="GOA:Q3KIT7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT7"
FT                   /protein_id="ABA72319.1"
FT                   /translation="MPTFSERHVVFWVSCIIIFGGLLLVLPLRLLPSLLAGLLVFELVN
FT                   MLTPQLQRLIEGRRARWLAVALLGTLVVSVLTLIFAGAISFLLHEAENPGASLDKFMGV
FT                   VDRARGQLPPFIDAYLPASAAEFRVAIGEWASKHLSELQLVGKDAAHMFVTLLIGMVLG
FT                   AIIALQRVPDVTKRKPLAAALFDRLHLLVQAFRNIVFAQIKISLLNTFFTGIFLAVVLP
FT                   LFGIKLPLTKTLIVLTFLLGLLPVIGNLMSNTLITIVGLSLSIWVAIAALGYLIFIHKL
FT                   EYFLNARIVGGQISAKSWELLLAMLVFEAAFGLPGVVAGPIYYAYLKSELKLGGMV"
FT   gene            complement(668400..669674)
FT                   /locus_tag="Pfl01_0576"
FT   CDS_pept        complement(668400..669674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0576"
FT                   /product="putative chaperone/heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72320"
FT                   /db_xref="GOA:Q3KIT6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT6"
FT                   /protein_id="ABA72320.1"
FT                   /translation="MKDASPARACGIDFGTSNSTVGWLRPGMETMIALEDDKITLPSVV
FT                   FFNIEERRPVYGRLALHEYLEGYEGRLMRSLKSLLGSKLIKHDTSVLGTAMPFKDLLGL
FT                   FIGQLKSRAEAAAGREFEQVVLGRPVFFVDDDPLADQEAEDTLVEVARKLGFKDVSFQY
FT                   EPIAAAFDYESTIEKEELVLIVDIGGGTSDFSLVRLSPERRGVDNRHDDILATGGVHIG
FT                   GTDFDKQLSLQGLMPLFGYGSRMKSGAFMPTSHHMNLATWHTINSVYSQKSTLALGSMR
FT                   YDIEDTGGIDRLFKLIEQRAGHWLAMEVEETKIHLTHNDSRHVPLDRIEPGLSVELTRA
FT                   LFESAIESQLERVRGSVTQLLADANVAVGQVDTVFFTGGSSGIPALRNSVSAMLPNARH
FT                   VEGNIFGSIGSGLAIEAMKRYGSVN"
FT   gene            669968..670918
FT                   /locus_tag="Pfl01_0577"
FT   CDS_pept        669968..670918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0577"
FT                   /product="curved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72321"
FT                   /db_xref="GOA:Q3KIT5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT5"
FT                   /protein_id="ABA72321.1"
FT                   /translation="MDFKDYYKILGVEPTADDKAIKAAYRKLARKYHPDVSKEKDAEAK
FT                   FKDASEAYEALKSADKRAEYDELRRYGQHGQPFQGPPGWQSRGGFGGGGGDTGDFSDFF
FT                   SSIFGNRGPGFGGGAGRQSRSAGRRGQDVELELPIFLEETLSNESKKISFQVPQYNGSG
FT                   QHVSNTSKSLNVKIPAGVTDGERIRLKGQGAPGIGGGANGDLYLTIRFAPHPKFDVEGE
FT                   NLIITLPLAPWELALGAEVAVPTLTGKINLKVPAGSQNGQRMRAKGHGLQNKAGERGYL
FT                   FVQLKAVMPKANGDDVKALWQELAKKAAFNPRENF"
FT   gene            670942..671247
FT                   /locus_tag="Pfl01_0578"
FT   CDS_pept        670942..671247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT4"
FT                   /protein_id="ABA72322.1"
FT                   /translation="MSSPLMVQLDMAEFCEAADLSDVYVIEIVEHGILEPQGTQPREWR
FT                   FTDYELALAKRAAKLRRDLELEWEGVALALDLLEEVQELRAENRMLRQRLARLVVE"
FT   gene            complement(671257..672384)
FT                   /locus_tag="Pfl01_0579"
FT   CDS_pept        complement(671257..672384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0579"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72323"
FT                   /db_xref="GOA:Q3KIT3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT3"
FT                   /protein_id="ABA72323.1"
FT                   /translation="MRLSEFILANIDAIVDEWEKFAATITPPADHLDSAGLRDHASAIL
FT                   RAAARDMSKPQSRDEQVAKAKGEGPEKSPSLDEAGASHGELRHTVGFDLVQMTSEFRHL
FT                   RAVVIRRWVEHIELPDTTCFQDMIRFNEAIDEALAESTAAYAEQVNRSRDIFLAILGHD
FT                   LRAPLQAVSMSTELLMRKTTLEGDALTCALNIKQGARHMAAMVSDLLELVRSRLGRSLP
FT                   IEPAPMDLADAARAAIAEACAGNPDSDPTLNTEGDTRGVWDAGRIDQLLQNLIGNALQH
FT                   GSDPREVIVTLKGEARQVLLTVHNYGPPISEEAIGTIFDPLVRSADEELGQPSTSLGLG
FT                   LFIVKEVVTAHGGTIEVSSSAANGTLFSVMLPRQV"
FT   gene            complement(672541..674241)
FT                   /locus_tag="Pfl01_0580"
FT   CDS_pept        complement(672541..674241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0580"
FT                   /product="urease alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72324"
FT                   /db_xref="GOA:Q3KIT2"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIT2"
FT                   /protein_id="ABA72324.1"
FT                   /translation="MKISRQAYADMFGPTVGDKVRLADTELWIEVEQDFTTYGEEVKFG
FT                   GGKVIRDGQGQSQLLAAEVVDTVITNALIIDHWGIVKADVGLKDGRIAAIGKAGNPDVQ
FT                   PGVTIAIGASSEVIAGEGMILTAGGIDTHIHFICPQQIEEALMSGVTTMIGGGTGPATG
FT                   TNATTCTSGPWHLARMLQAADAFPMNIGLTGKGNASLPEPLIEQVKAGAIGLKLHEDWG
FT                   TTPASIDNCLSVADQYDVQVAIHTDTLNESGFVETTLGAFKGRTIHTYHTEGAGGGHAP
FT                   DIIKACGFANVLPSSTNPTRPFTRNTIDEHLDMLMVCHHLDPSIAEDVAFAESRIRRET
FT                   IAAEDILHDLGAFSMISSDSQAMGRVGEVITRTWQTADKMKKQRGPLPQDGEGNDNFRA
FT                   KRYIAKYTINPAITHGISHEVGSVEVGKWADLVLWRPAFFGVKPTLILKGGAIAASLMG
FT                   DANASIPTPQPVHYRPMFASYGGSLHATSLTFISQAAQASGLPEALGLKKKIAVVKGCR
FT                   DVQKTDLIHNDYLPNIDVDPQTYQVKADGVLLWCEPAETLPMAQRYFLF"
FT   gene            complement(674412..674717)
FT                   /locus_tag="Pfl01_0581"
FT   CDS_pept        complement(674412..674717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0581"
FT                   /product="urease beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72325"
FT                   /db_xref="GOA:Q3KIT1"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIT1"
FT                   /protein_id="ABA72325.1"
FT                   /translation="MIPGEYQIQPGDIELNVGRRTITLKVANSGDRPIQVGSHYHFFET
FT                   NDALTFDRAASRGMRLNIPASTAVRFEPGQSREVELVDYAGHRRVFGFAGRVMGDL"
FT   gene            complement(674717..675250)
FT                   /locus_tag="Pfl01_0582"
FT   CDS_pept        complement(674717..675250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0582"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72326"
FT                   /db_xref="GOA:Q3KIT0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT0"
FT                   /protein_id="ABA72326.1"
FT                   /translation="MNPAQLRRVNAESFAHYRQGLIELLLDAVGYGASVGFMADLDATQ
FT                   ARAYFDEVQDNLNKGNVLLWVVVKDEQVQASVQLGLCQKANGLNRAEVQKLLVREHARR
FT                   RGLGQQLMQALEQTARQYKRGMLYLDTEAGSPAEDFYKALGYTRAGEIPDYACDPNGTY
FT                   RPTALYYKVLQGAN"
FT   gene            complement(675256..675789)
FT                   /locus_tag="Pfl01_0583"
FT   CDS_pept        complement(675256..675789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0583"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72327"
FT                   /db_xref="GOA:Q3KIS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS9"
FT                   /protein_id="ABA72327.1"
FT                   /translation="MTYTIRDALHADLPAIRDIYNDAVLNTTAIWNESPVDLGNRQAWF
FT                   SARQAQGYPILVIVDADNTTLGYASFGDWRPFDGFRHTVEHSVYVRSDQRGNGLGPQLM
FT                   TALIERAKTCDKHVMVAAIESGNAASIRLHERAGFITTGQMPQVGTKFGRWLDLTFMQL
FT                   TLNPGAEPPPANKE"
FT   gene            complement(675799..676101)
FT                   /locus_tag="Pfl01_0584"
FT   CDS_pept        complement(675799..676101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0584"
FT                   /product="urease gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72328"
FT                   /db_xref="GOA:Q3KIS8"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIS8"
FT                   /protein_id="ABA72328.1"
FT                   /translation="MDLTPREKDKLLIFTAGLVAERRLARGVKLNYPEAMAYISAALLE
FT                   GARDGQTVAELMHYGTTLLTREQVMEGIPEMIPEIQVEATFPDGTKLVTVHQPIV"
FT   gene            complement(676135..676974)
FT                   /locus_tag="Pfl01_0585"
FT   CDS_pept        complement(676135..676974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0585"
FT                   /product="putative uerase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72329"
FT                   /db_xref="GOA:Q3KIS7"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIS7"
FT                   /protein_id="ABA72329.1"
FT                   /translation="MNLPVATALFTPSWHAELELAYARFGDCTRPTRRRHLGPLRVQKH
FT                   LYAEGPEVCQHIIVHPPGGIAGGDRLDISARVAQGAWAQITSPGAAKWYRAAGPAYQSL
FT                   NLHVADGATLEWLPQETIVYSAAQAELTTSIELEGDARLFYWDVVALGRPASGERFDLG
FT                   HFQAHLDIRRDGRLLWHERQRIVGADGLLDSPIGLDGHPVFATLLVTGEIDAELLERCR
FT                   SLGHEVRGDLTQLPGLLVARCLASEALLARAWLIDLWRLLRPALLGREALPPRIWNT"
FT   gene            complement(677005..677703)
FT                   /locus_tag="Pfl01_0586"
FT   CDS_pept        complement(677005..677703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0586"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72330"
FT                   /db_xref="GOA:Q3KIS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS6"
FT                   /protein_id="ABA72330.1"
FT                   /translation="MLQVDKLHQYYGGSHILRGLSFDVKVGEVTCLLGRNGVGKTTLLK
FT                   CLMGLLPAKEGAVNWEGQPITTYKPHQRVHAGIAYVPQGREIFGRLTVEENLLMGLSRF
FT                   PGSEAKEVPAFIYELFPVLLQMKQRRGGDLSGGQQQQLAIGRALASRPRLLILDEPTEG
FT                   IQPSVIKEIGAVIKKLAARGDMAILLVEQFYDFAAELADQYLVMSRGEIVQQGRGENME
FT                   SEGVRGLVTI"
FT   gene            complement(677841..678710)
FT                   /locus_tag="Pfl01_0587"
FT   CDS_pept        complement(677841..678710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0587"
FT                   /product="putative amino acid ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72331"
FT                   /db_xref="GOA:Q3KIS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS5"
FT                   /protein_id="ABA72331.1"
FT                   /translation="MRVTASAEFMLEPAFFPVEPNKDEGTSRDSIGLGQRVGPGLDTRH
FT                   GTILTLEDISVSFDGFRALNNLNLYIGVGELRCIIGPNGAGKTTLMDVITGKTRPSHGK
FT                   AWFGETLDLTQMSEVQIAQAGIGRKFQKPTVFEALSVFENLELAQKTDKSVWASLRAKL
FT                   SGEQKDRISEVLDTIRLTTSVNRPAGLLSHGQKQFLEIGMLLMQDPQLLLLDEPVAGMT
FT                   DAETEFTAELFKSLAGKHSLMVVEHDMGFVGSIADHVTVLHQGSVLAEGSLEQVQDNER
FT                   VIEVYLGR"
FT   gene            complement(678707..679786)
FT                   /locus_tag="Pfl01_0588"
FT   CDS_pept        complement(678707..679786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0588"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72332"
FT                   /db_xref="GOA:Q3KIS4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS4"
FT                   /protein_id="ABA72332.1"
FT                   /translation="MNQPLLVTATQKAGPKVTLAVGVVVLALLIALPLLSLLPADSALH
FT                   VSAYTLTLVGKILCYAIVALALDLVWGYAGLLSLGHGLFFALGGYAMGMYLMRQAAGDG
FT                   LPAFMTFLSWTELPWYWSGTGSFLWAMCLVVLAPGLLALVFGFFAFRSRIKGVYFSIMT
FT                   QALTFAGMLLFFRNETGFGGNNGFTNFRTILGFGITEPGTRAVLFLATVLLLVASLFIG
FT                   WRLARSKFGRVLTALRDAENRLMFCGYDPRGFKLFVWVLSAVLCGLAGALYVPQVGIIN
FT                   PSEMSPTNSIEAAVWVALGGRGTLIGPLLGAGVVNGMKSWFTVAFPEYWLFFLGALFIV
FT                   VTLYLPKGVIGLLKKRGES"
FT   gene            complement(679786..681288)
FT                   /locus_tag="Pfl01_0589"
FT   CDS_pept        complement(679786..681288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0589"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72333"
FT                   /db_xref="GOA:Q3KIS3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS3"
FT                   /protein_id="ABA72333.1"
FT                   /translation="MPTALYRLILAVALLLPMAVHAGDAEDFVAANPMQQAKLLEAWAA
FT                   QPDPARGELINALQQGELTVDGQPKTLRLNNRLRGLIDTALASHQLLAADAKTRLTAAQ
FT                   QLQKSAKPAQLKFLDRQLAGEIDESVHAALSLALANLQLVDTDPAVRLAAVRLLGETGD
FT                   PLARTRLEGLLEPGIETDANVRTAAETSLAQVKRKLLVGELLGQAFSGMSLGSILLLAA
FT                   LGLAITFGLLGVINMAHGEMLMLGAYSTYVVQLMFQRYAPQAIEFYPLIALPVAFFVTA
FT                   AIGMALERTVIRHLYGRPLETLLATWGISLMLIQLVRLVFGAQNVEVANPAWLSGGIQV
FT                   LPNLVLPYNRIVIIAFALFVVVLTWLLLNKTRLGLNVRAVTQNRNMAACCGVPTGRVDM
FT                   LAFGLGSGIAGLGGVALSQIGNVGPDLGQSYIIDSFLVVVLGGVGQLAGSVFAAFGLGI
FT                   ANKILEPQIGAVLGKILILALIILFIQKRPQGLFALKGRVID"
FT   sig_peptide     complement(681220..681288)
FT                   /locus_tag="Pfl01_0589"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(681448..682713)
FT                   /locus_tag="Pfl01_0590"
FT   CDS_pept        complement(681448..682713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0590"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72334"
FT                   /db_xref="GOA:Q3KIS2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS2"
FT                   /protein_id="ABA72334.1"
FT                   /translation="MKRRSLIKAFTLTASIAAMGMTWTVQAAETIKVGILHSLSGTMAI
FT                   SETSLKDMALMTIDEINAKGGVNGKMLEPVVVDPASNWPLFAEKGRQLLTQDKVAVVFG
FT                   CWTSVSRKSVLPVFEELNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLMSEEG
FT                   GSAKRYFLLGTDYVYPRTTNKILRSFLHSKGVADKDIEEVYTPFGHSDYQTIVANIKKF
FT                   SAGGKTAVISTVNGDSNVPFYKELANQGLKATDVPVVAFSVGEEELRGIDTKPLVGNLA
FT                   AWNYFESVENPVNKKFVDDWKAYAKKHNLPGADKAVTNDPMEATYVGIHMWAQAAEKAK
FT                   STDVDKVREALGGQTFAAPSGYTLTMDKTNHHLHKPVMIGEIQSDGQFNVVWQTEGPIR
FT                   AQPWSPFIPGNDKKPEYAVKSN"
FT   sig_peptide     complement(682630..682713)
FT                   /locus_tag="Pfl01_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(682919..683929)
FT                   /locus_tag="Pfl01_0591"
FT   CDS_pept        complement(682919..683929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0591"
FT                   /product="putative iron ABC transport system, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72335"
FT                   /db_xref="GOA:Q3KIS1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS1"
FT                   /protein_id="ABA72335.1"
FT                   /translation="MIDRRYALLLIALGAVLLVSCVVSLGFGPARVPVDVVWRILLHKL
FT                   FGLGAPDWSAGQEHIVWLIRVPRMLLGALVGAGLALIGAVLQAVTRNPLADPHLLGVTS
FT                   GATLGAVIVVLHIGEIVGLLTLPIAAFIGALLSMFLVLGIANRQGRLDSDRLLLCGVAV
FT                   SFVMMAIANLLLFMGDHRASSAVMFWMLGGLGLARWELLAVPALSVLLGLILLIGMARP
FT                   LNALMAGEQTAVTLGLNARAVRLRVFVIASLMTGVLVSISGSIGFVGLMVPHIARRLIG
FT                   AEHRRLLPVCVLLGSVFLVWVDVAARTLIAPEDLPIGVATAALGGLFFIGLMRRR"
FT   sig_peptide     complement(683849..683929)
FT                   /locus_tag="Pfl01_0591"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.859 at
FT                   residue 27"
FT   gene            complement(683926..684873)
FT                   /locus_tag="Pfl01_0592"
FT   CDS_pept        complement(683926..684873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0592"
FT                   /product="putative iron ABC transport system, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72336"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS0"
FT                   /protein_id="ABA72336.1"
FT                   /translation="MTVRSLLCLALLLGTTQAFAEATKYPLTIHSCNREVTFKQAPKHA
FT                   VSHDINMTQMMLVLGLKSKMAGYSGVSGWKSVTPEMQSLLDGLPELAAKYPSVETLLNA
FT                   NVDFFFAGWDYGMRVGGDLTPQTLQPLGINVYELTESCAFVMKRPAATLDDTYNDLRNL
FT                   GKIFDVQDRANALIADMQSQVAEIRKDLPAEKPRVFLYDSGEDRAMTSGRLGMPQALID
FT                   AAGGRNVLDDVEASWTRVNWETVVERNPQVIVIVDYSEITAEQKIEFLLKNKALQSVDA
FT                   IKNQRFIVIPYVQATPGIDNVLAVETLAKGFHGE"
FT   sig_peptide     complement(684811..684873)
FT                   /locus_tag="Pfl01_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(684870..685658)
FT                   /locus_tag="Pfl01_0593"
FT   CDS_pept        complement(684870..685658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0593"
FT                   /product="putative iron ABC transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72337"
FT                   /db_xref="GOA:Q3KIR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR9"
FT                   /protein_id="ABA72337.1"
FT                   /translation="MSSLSLTDLAWTPLGHGHCHHQFQLRDASLQVAAGEFVGLIGPNG
FT                   SGKTSLLRCAYRFSQPEHGEVRLDHHNVWKQSSRWCAQRIAVVLQEFPDAFGLTVEEVV
FT                   AMGRTPHKGLFDGDTLEDRNLATQALKSVGLDGFEDHAFATLSGGEKQRVILARALTQQ
FT                   PQLLILDEPTNHLDPRYQLELLQLVKRLQIGTLASIHDLNLAAAFCDRLYVINHGRIVA
FT                   SGTPQEVLTVELLRDVFGVEALIDSHPLHGYPRITWITRP"
FT   gene            complement(685671..687797)
FT                   /locus_tag="Pfl01_0594"
FT   CDS_pept        complement(685671..687797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0594"
FT                   /product="putative TonB-dependent membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72338"
FT                   /db_xref="GOA:Q3KIR8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR8"
FT                   /protein_id="ABA72338.1"
FT                   /translation="MNKYLLSSLCLFALNHSAHADNAPLTLPTGTITALANDDQTVSLS
FT                   TPTSAGSRLNLSAMETPASVESLSGEQVRARGDRSVQDAVSRSTGISRTGTPGDGGTSL
FT                   QARGFTGQSSVMQLYDGNRLYTGMGTVTFPVDTWSVERVDVLRGPASVLYGEGATGAVV
FT                   NVIPKKPFEGEIENHVRVGYGSFDRQQQAFDSGGSLTDTLSYRLNLNRLRSNGWVDRGD
FT                   SSSDFISAALRWQATDDLSFTLAHDYGDQRPQNYFGTPLINGQLKDSLRNKNYNVRDDK
FT                   QHYNDQWTRLTSDWQINDAVSANNELYYLKAQRRWQNAENYNFDVDSQQLSRSGYFGIG
FT                   HQQEQVGDRQTFTFKHSLFGLDSQTVTGVDYNRIRFQLDSNSPFNDVLPNGQPLDRYHP
FT                   QTGYFESADPYRDQFDSTTKQMSVFAENRTQLSERWSLVTGVRRDYVHVDRNNLVDGSQ
FT                   SDKTLTGNNWKAGLVFALTQDTSFYGQVATSTDGIGGLISLSPSQQQYDLSTARQTEIG
FT                   LKQLFWDQRGEFTLAAYRIVKKKLLTDDPGNPTLKQQVGQQSSNGVEASLDLQLQNAWQ
FT                   LQANAAIVKAKYDDFEEVVGGVPVSRNGNRPVDVPRRTANLWLSKALTDDLKAGAGVRY
FT                   VDARYADMANCNELPSYTVVDATLSWKALRNTTLGLQVNNLFDRTYAQSQYNEGQQWIL
FT                   GEPRSFFVTADYTF"
FT   sig_peptide     complement(687735..687797)
FT                   /locus_tag="Pfl01_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(687960..689339)
FT                   /locus_tag="Pfl01_0595"
FT   CDS_pept        complement(687960..689339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0595"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72339"
FT                   /db_xref="GOA:Q3KIR7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR7"
FT                   /protein_id="ABA72339.1"
FT                   /translation="MKQPKPNFYNLAWRWHFYAGLFVAPFMVMLALTGIIYLFKPQLDS
FT                   LMYSSLLNVPAGHHTVPADDLLQKVKSAYPQGQVTQYLPPVNAERSAQFVVANAGHELN
FT                   VFVDPYHGDILGEQDAKQNLQAIARAIHGELMIGTVGDRLIEMAAGWGVVLVVSGVFLW
FT                   WPRGQAAGILWPRLSSRGRVLWRDLHAVTGFWGAALLLVMLLSGMTWTGFWGKQYAQVW
FT                   NVFPAAMWDNVPTSDVEAGSLNNAARQTVPWAMENTPMPMSGDHAEHMAHGGMQHGPAA
FT                   PTIRLQDVQNIAVERKVEPGYSITMPTTATGVFTIAVFADDPRNDATLHVDQYTGKVLA
FT                   DVRFEQYGAVARATEIGVMLHEGKMFGTFNQIIVLLICLMILLSAVSGVVIWWKRRPQG
FT                   KFGVPPLRHDLPKWKTGVAIMLVLAVVFPLVGASLVVVWLLDRLLLSRLARQTESASTS
FT                   S"
FT   gene            complement(689419..691551)
FT                   /locus_tag="Pfl01_0596"
FT   CDS_pept        complement(689419..691551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0596"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72340"
FT                   /db_xref="GOA:Q3KIR6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR6"
FT                   /protein_id="ABA72340.1"
FT                   /translation="MEIVMSRFSAVPRPASAPASFALNESRVRFRHATAVLCGVLLSPL
FT                   VHADEHAGHADELSPTVITAIAPSSPLTIVTNPKDPRQPVPASDGGDYLKTIPGFALVR
FT                   NGGTNGDPVLRGMFGSRLNILTNGSMMLGACPGRMDAPTSYISPETYDKLTVIKGPQTV
FT                   LYGPGASAGTILFDREPESFGELGTRVNASVLAGSHGRFDKVVDAAAGGSLGYVRVIGN
FT                   TAHSDDYRDGNNDIVASRYDKWNGDVALGWTPDADTLIELTAGKGDGEARYAGRGMDGS
FT                   QFLRESLGLRVEKSNITDVLEKLEAQIYYNYADHVMDNYTLRTPSGTGMMAGPMASNVD
FT                   RRTLGARIKATWRWADIQLITGLDAQTNEHRQRSGMGIDTYKDQPYTKDADFHNYGVFS
FT                   EMTWYAADRDRLITGARVDRASARDFRQTTGSGMMSRPNPTAGDTRADTLPSGFVRYEH
FT                   DLADSPTTLYAGLGHAQRFPDYWELFSPKSGPAGSVNAFDSIKPEKTTQLDFGVNYKDA
FT                   NLEAWASGYIGVVRDYILFDYTPTMMGMSTSRAENIDARIMGGELGAAYKLTDNWKADA
FT                   TLAYAWGKNSSDGKALPQMPPLDARFGLTYSEDNWSAGALWRVVAAQNRIDQNKGNVVG
FT                   KDYDKSSGFGVFSLNGAYRINKHWKVSTGVDNLFGKAYAEHLNLAGNAGFGYPANDPQA
FT                   INEPGRTLWTKVDMSF"
FT   gene            complement(691624..692070)
FT                   /locus_tag="Pfl01_0597"
FT   CDS_pept        complement(691624..692070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0597"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72341"
FT                   /db_xref="GOA:Q3KIR5"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR5"
FT                   /protein_id="ABA72341.1"
FT                   /translation="MRPLSARPSLQRRQTEHLTRGSWIALFAMLMIFIGPLISQSMPMD
FT                   QHASTSMPMSMDMSMDMPGMDHSAHEAKPSAEHCPPQSSHHVLWEKCGYCSLLFNCPAL
FT                   TGGGSFATFSIPHVNTFTPPSPRLGHARQTFFPGARTRAPPVAA"
FT   sig_peptide     complement(691951..692070)
FT                   /locus_tag="Pfl01_0597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.519 at
FT                   residue 40"
FT   gene            complement(692092..692571)
FT                   /locus_tag="Pfl01_0598"
FT   CDS_pept        complement(692092..692571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0598"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72342"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR4"
FT                   /protein_id="ABA72342.1"
FT                   /translation="MLNKFIVIAALLLPACFAHAHEYKAGELEIAHPWSQELPPNAPTV
FT                   AAYFIIHNGGKTADRLLSVDSPIAPTAELHEHVMQGDLMKMQQVPNVAIPAGGNVTFAP
FT                   MAYHVMLMNPTDRSLLTDGKRFPLTMHFEKAGDVTVEVAVQKKPPEATQAHAHAQ"
FT   sig_peptide     complement(692509..692571)
FT                   /locus_tag="Pfl01_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(692620..693021)
FT                   /locus_tag="Pfl01_0599"
FT   CDS_pept        complement(692620..693021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0599"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72343"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR3"
FT                   /protein_id="ABA72343.1"
FT                   /translation="MNRHRLAFAWIACFAVLFNMLAMPLTGAMAQAAQTPAEQLLWSSF
FT                   CTGSGTKMVAIDIGSLDQKAPQSGDHHSTMQHCWCCSGSAPVVALPGHSPQLYFARYES
FT                   NRSVAPVVLQTPTPRQQWPSLNPRASPLV"
FT   sig_peptide     complement(692923..693021)
FT                   /locus_tag="Pfl01_0599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.812 at
FT                   residue 33"
FT   gene            complement(693069..693482)
FT                   /locus_tag="Pfl01_0600"
FT   CDS_pept        complement(693069..693482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72344"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR2"
FT                   /protein_id="ABA72344.1"
FT                   /translation="MLGHCPQELKESLTICTSGPGLRLAFHRICEHVPMTGKFTRFDIK
FT                   DFLHTPAELVHYVKACSELDSGDGRFNRVALRDYKQTIRLRIQSDPDFAQALRIEAATL
FT                   FHNGETELASMLLAQLHVALRHQTARRFFTYRP"
FT   gene            complement(693509..694237)
FT                   /locus_tag="Pfl01_0601"
FT   CDS_pept        complement(693509..694237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0601"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72345"
FT                   /db_xref="GOA:Q3KIR1"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR1"
FT                   /protein_id="ABA72345.1"
FT                   /translation="MKRILLLGGVTEALAIARTLGPEHIYSLAGVGRVPTDLTCQVRVG
FT                   GYGGAEGLAQFIRAKGITLLLDATHPYAAQISQNAATAAQLTGIPCWALRRPAWQPQPG
FT                   DDWREVADWAELITALEPFRRPLFTLGREPLQHLDEIPAHQFWTLRALDVYPGNERCEV
FT                   IGARGPFLLEDERALFERRQIDVLISKNSGSTATEPKLEVARELGVPVMVLKRPELARV
FT                   DREFWTVADAIAALAAGVRP"
FT   gene            complement(694234..695331)
FT                   /locus_tag="Pfl01_0602"
FT   CDS_pept        complement(694234..695331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0602"
FT                   /product="putative cobalamin biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72346"
FT                   /db_xref="GOA:Q3KIR0"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIR0"
FT                   /protein_id="ABA72346.1"
FT                   /translation="MRDETAEQPAPLRSGLTTGSCATATSLAAARLLLGGVVADAVQIV
FT                   LPKGKQVQMRLEFCRLTKDGAEAGTIKDAGDDPDVTHGALLYSRVQLMAEPGIRFIAGK
FT                   GVGTVTRPGLVLPVGEPAINPVPRKMISDHLTLLAEETGYRGGFEVTVNVEGGEALALK
FT                   TMNPRLGILGGLSILGTSGIVRPFSCAAYIASIHQGIDVAKTNGFLHIAACTGNASEDT
FT                   MRRVYNLPEIALIEMGDFVGAVLKHLRKVPVDKLSLCGGFGKISKLAAGHMDLHSRHSS
FT                   IDLPQLAEWAAAIGADDTLQQAIRGANTSQQALAIASAAGVALGDEVCRHALEFARSVV
FT                   PAQVQVEVFAIDRQGGIVGHAGAFV"
FT   gene            complement(695324..696535)
FT                   /locus_tag="Pfl01_0603"
FT   CDS_pept        complement(695324..696535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0603"
FT                   /product="precorrin-6Y C(5,15)-methyltransferase,
FT                   decarboxylating"
FT                   /EC_number="2.1.1.132"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72347"
FT                   /db_xref="GOA:Q3KIQ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ9"
FT                   /protein_id="ABA72347.1"
FT                   /translation="MSPWLTVVGIGEDGFKGLGKNARRALMDASRIIGGQRQLDLLPVC
FT                   IRGERQLWPSPFSLAPVLERRGEAVCVLASGDPMFYGVGASLARQVPEAEMLVLPAPSS
FT                   CSLAAARLGWPLQDVSVLSLVARPLAALNAQLFGGVRLLLLSNDGQSPAAVATLLRERG
FT                   FGASRLSVLEHLGGSAERRIDGSANDWNDPLIADLNVIALECLADPQTPRLSRLAGLPD
FT                   SAFRHDGQLTKRDVRAITLARLAPTPGELLWDVGAGSGSIGIEWMRAHPSCRALAIEAD
FT                   DGRQQLIEHNRDALGVPGLQLIRGSAPQALAGLERPDAIFIGGGVTREGVLETCWAQLK
FT                   PGGRLVANAVTLQSEMTLMSWRERHGGELTRIHIAQAQPLGEFDTWRQALPITLLDLVK
FT                   PLDA"
FT   gene            696680..697978
FT                   /locus_tag="Pfl01_0604"
FT   CDS_pept        696680..697978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0604"
FT                   /product="putative cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72348"
FT                   /db_xref="GOA:Q3KIQ8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ8"
FT                   /protein_id="ABA72348.1"
FT                   /translation="MSNAIRPSACPGLLRIVQALDGGICRIKLDGGSITADQADAVANA
FT                   AERFAGGAIEATNRGNLQIRGIGDQSAALIDSLLAAGLGPRTAAGDDVRNLMLSPAAGI
FT                   DRQMRFDTRPLAGQILETLQSHPRFHELSAKFAVQLDGGEALAMLKHPHDLWLSAFESG
FT                   ENTLLAFGLAGCPTERPLAAVALVDGHALVVAVLELFLDLARPEQTRMRHLLDECPAPL
FT                   FLEKLGQRISLKAAGDWQRAAGPEGLHLGIHPQPSAGQVYVGAAPPLGRLGPDMLRGAA
FT                   QLAITFGDGSLRFTPWQSLLLPNVRETDAVQVLDELGKLNLLTHVEEPLTHLIACTGAN
FT                   GCGKGLADTKHDARLLATLLPHAVDVHLSGCPRSCAAAHRAAVTLLAVGPGHYDLYFRD
FT                   AALPGFGALHAHNLTIEAAATLLAARSRSPLDA"
FT   gene            697971..698597
FT                   /locus_tag="Pfl01_0605"
FT   CDS_pept        697971..698597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0605"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72349"
FT                   /db_xref="GOA:Q3KIQ7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ7"
FT                   /protein_id="ABA72349.1"
FT                   /translation="MLDYIRDGQEIYRNSFAIIRSEANLARIPADLEKLAVRVIHACGM
FT                   VEAIDGLQFSEGAGKAGRDALAAGAPILCDARMVSEGVTRARLPANNQVICTLRDDSVP
FT                   ELARELGNTRSAAALELWRPHLEGSVVVIGNAPTALFYLLEMLDAGAPKPALILGFPVG
FT                   FVGAAESKAELAANSRGVPFVIMQGRLGGSAMAAAAVNALATEIE"
FT   gene            698594..699328
FT                   /locus_tag="Pfl01_0606"
FT   CDS_pept        698594..699328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0606"
FT                   /product="cobalt-factor II C20-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72350"
FT                   /db_xref="GOA:Q3KIQ6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ6"
FT                   /protein_id="ABA72350.1"
FT                   /translation="MMQAQGRLIGLGVGPGDPELITVKALRLLRESPVVAYFVAKGKKG
FT                   NAFGIIEAHLQDAQNLLPLVYPVTTEVLPAPLSYEQVISDFYDDAAEEVAAHLDAGRDV
FT                   AVICEGDPFFYGSYMYLHDRLAGRYEAEVVPGVCSMLGGASVLGAPLVYRNQSLSVLSG
FT                   VLPHEELKRRLADADAAVIMKLGRNFPKVRDVLAELGLAERALYVERATMANQKIVSLD
FT                   EVEPMSSPYFSLIIVPGERWQG"
FT   gene            699328..701031
FT                   /locus_tag="Pfl01_0607"
FT   CDS_pept        699328..701031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0607"
FT                   /product="putative precorrin-3B C17-methyltransferase,
FT                   cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72351"
FT                   /db_xref="GOA:Q3KIQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ5"
FT                   /protein_id="ABA72351.1"
FT                   /translation="MTHSTPAIVILGQGALATARRLQQVYPAAKIHGLNGRVEGADLTY
FT                   SDFGATLRELYQQDTPIIALCAAGIVIRTLAPLLLEKGVEPPVLAVAEDGSAVVPLLGG
FT                   LGGVNVMAREIAAGLEVAAAITTSGELRFGTCLLNPPGGYALGDLEQGKRFVSDLLAGH
FT                   SVRIDGAAPWLEQAQLPEDPQAQRSIHVGSAARAANTSELLIYPRSVAVAVGSSVTDVP
FT                   GTLRDALQQAGVAIQSLACLVAADAQMASPALREAALELAVPLRFVAPANDIGELVRDA
FT                   VPGARIITTSRDIAIAVAEQPLDVSQIGRPRGRLAVIGLGPGAAELMVPAVKAELARAT
FT                   DVLGYETYVRMAGPFRDDQVQHCTDNREEMQRARHAFRLAAQGRSVIVVSSGDPGVFAM
FT                   AAAVLEALHESTDPAWHSVDLEILPGVSASLATAAQAGAPLGHDFCVMSLSDNLKPWSI
FT                   IEKRLDLAAEADLALAFYNPISRSRPWQLGRALEIVAQHRTSQTPVVLGRDIGRPGQTL
FT                   RVTTLGALTPDQVDMRTMVLIGSSTTCTFPRAEGGKWVYTPRWYGSKPAG"
FT   gene            701376..708518
FT                   /locus_tag="Pfl01_0608"
FT   CDS_pept        701376..708518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0608"
FT                   /product="putative toxin A"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72352"
FT                   /db_xref="GOA:Q3KIQ4"
FT                   /db_xref="InterPro:IPR024769"
FT                   /db_xref="InterPro:IPR024770"
FT                   /db_xref="InterPro:IPR024772"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ4"
FT                   /protein_id="ABA72352.1"
FT                   /translation="MQGAENSKVEKGFVKFVDLFKLADLERALLPHKGTEQYDAVIRYY
FT                   FACIGLLDSPRLLQPLTLFKQALGELGNHRVRREAENAPAPSPDSEAALSFAQVSDRVE
FT                   GFEARLRYGVELMKTPATQVPKILHFVWLGGGLGDIQRDYINVWKKVLAGQGYKINVWY
FT                   DNDALLAYRTNQLVVEAAKADAMQHGGVDSATERELGELYVARVIALKQQMYQYINDAV
FT                   AKGESADAARMQLLVRGYGQDAQELRRLKTTNRDSIQALVDGDVQVRDLAGAEKPLQLQ
FT                   ALYQREMRLRGNFAAASDVVRAEVLHLEGGSYTDVDNLPPLLKSVGGVDISGFSDDARL
FT                   GLLQLLLNENPEWMPGRQALKSRYVDRTDEIPEAHRQALQAFAKGKPLLAQVFQPPQDL
FT                   LVRPYALRAVAVRSTISNGYMMAHPGSAVLESVLKRLEFNLGLVDATARLAVQRGVKPE
FT                   DSEAMQSLALEELERTYGSINDLPDMESVFATYLADAAASYYNDGIRPQSEGTIYLTGP
FT                   VGIKDGTSDFEKARLTPRGAQVSREEMAIEPLLVVNRATEEELDHSWKDNETDFDKWVE
FT                   SEKQRWRDGQFKTRYAGNIDELLKHSTVEFELGWPLIEGRHVINTELLQRMADHLGEPF
FT                   TRAMMSGHDGPVTFADRIPLDFNDRQLIRNQDTRRRPPASRSHEVTRSLALDEILTGLG
FT                   TGAWQLAHLSPLQRLTLGALLGAESLDEQSFAALGGALDNLINSLSERGTSGRYAAIEQ
FT                   HLYQRRPAEFVAGLKSVADVLPTSSSNALSLKKTALSTAVTLHDWGRQVALIQYVATQE
FT                   HRQQVQERVEQVLNQFEAGTVKMVPQDLLLHGAGDTVAGRCFPLVLAMSAALTQGEAAS
FT                   RRLRERFFLAVLEPDQADSQAFLQAVEEMHGVKAGDVGTVLGRLDLETVAATLEASVGT
FT                   RTLMLNSDNHSMLVARTESGTNVTYHFYDPNFGVFEFDSSVSFKVALGKFFRLGMARHY
FT                   AAYGEADHPRFDLIDIKGQQVSEQMLSTGVKVAHLFTEDTLPNVPLRKVRQRLNSAHGR
FT                   ALMENPRLGRALFDADHHWWAEQIASATSRLQEGHDSVSPLVPLFSSLEFTHEGPYRLG
FT                   MLDPNTGELVATVTSIDGRLLRIRNYLSELFSTLGRKPVKAGATQQATEAAAVHTLNAG
FT                   FAVQALMNALRGREGDDRTMTTAVRWHAYVNYAQLAHGTLFDAAGLIALVKEALRDEKI
FT                   IARTSARVVGEALAPLTGKTIGAVAGHVANEGVGAVLGLANVGFDIYQLATAQNDLETV
FT                   TYATQLTFDATSLALTGAGMGAGLAGAGTAAAVLGGAGVIIGGLAVGVTALAQAYAIIA
FT                   EEAKAVGLFFNELEQAHRGQAYHYKPTQDVWLPRASLIVTDIDMDTGEVSLESTKLYPL
FT                   RDHFGVPEFEADYARAINLSKELGYPDRMRFVPPADQAIVLPCTPQACYRYEYQTLPFS
FT                   SQRHDTGFDIARRLEKRKPDGKWLFLHSFYSFPSHYIVNRLWPDYRATQISVKLDARER
FT                   KLVVPNIPPAWQDKLSYRLQGGASLCTLVLSPGANVELVSAGTQNNRWILVAPWASESD
FT                   IQFGKTGAFSVKDCQFKMSGTGPSEVFLVIDGGRLLKVEGSQQRRLVVVQEQAPKGIDG
FT                   QVLQDHLLALARDHRLALPYTRINNYPIPFEKAEAPRYTTGWYDAAEDRVLHIRNDYDL
FT                   SEEDLMLSAVAGEFAYFHEKDGFDILQVDASTGLLSHRYRLLVRKQGTGTIRSVEADGH
FT                   GVLHVVQEYVQPDATVERFNYLIHDGQMWLSSVNRGLELQFEALLDDRHALTDWVPVLG
FT                   DRFLFPPVLGEREYTTVDWQFAPYVSICWKMDETLRDMAWIRSRDNLIIRPVPRRHHLR
FT                   GWRDSVQNLNDLMLLTVAGDNDVFVIYDRLFQKLCRVERTVVQGENRWSHRWVQPDRLK
FT                   EVIAEQNSYLAKTEDGLVFEMGADGNAQFAGVGERWLKGRAQWWLALESLALQHEAEQF
FT                   SIVGIANVAADAGVHGWFVGNRLLLSEVGSADVRLLGLTPDNQSAWLFDPAAGAVWRQA
FT                   FVDPQRLGPAFGSGSQLRQADAVPKPEREWERQSFTDVWIEGAGLMGTTRDGVVFELHY
FT                   QEQPMIVAVAPDWVAAQGESVTESLHALLATEAHRPFISVASRDPIEQWYIVDSGRLVR
FT                   VAAADLPKDFQLLGTRRYADVLLHEPEARLVQGFPSKHRIGPLDYVRRVGEVLVIQGRM
FT                   DANDLMPLIPDDVLMLVVRMGRGSMKCHLTPALARKLDSLVVDCRFPLGGTPLVPGRLI
FT                   WSPDSPQKLEASLVGDHLIVVDPDSEHNLIWRNACASDTSLRGDAMLEVQGLRRCKVSS
FT                   LVRWLMERRGGSNSVKLKELLDEAKGKVTADSTL"
FT   gene            708839..716032
FT                   /locus_tag="Pfl01_0609"
FT   CDS_pept        708839..716032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0609"
FT                   /product="putative toxin A"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72353"
FT                   /db_xref="GOA:Q3KIQ3"
FT                   /db_xref="InterPro:IPR024769"
FT                   /db_xref="InterPro:IPR024770"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ3"
FT                   /protein_id="ABA72353.1"
FT                   /translation="MEYVPGDVAELSWFSSVSEFKAIKAAFAEYSASAEYSALERYFQS
FT                   VVATAPIAEKQLPVKLFLETFESLAGRMEGPASPVIERARVGIKSYASRLSATVSMLSG
FT                   VARPVPKIMHFVWVGGSEVGNIQRDYMNIWRALLGPEDYRFNLWYDSDALLAFEMNRVI
FT                   LDSARAHAMESGGDQVSKPSQLSQMIEDRARILKLQMSDYINQPQWAGRRDDARIQLMV
FT                   SAYGKDRTVLEAFRQKCLDSHLAMASDDLHLRDVGHEFAGHFLQDVYQREVGMRGNFAA
FT                   ASDVVRLQAGFLEGGRYSDMDYLPPFADGLGGVDISKFSADAKVGVLQLLLNEDAALMP
FT                   GRDRSRYTDRTDKIPAEHKDKLLAFAREKPGLSRIFVAPKDRSVPQDAVRLGVARGIAS
FT                   NNEMNAHFLAHPRSAMTMAYMQAIRLNYDCLYEVERRLDAAGIVATDDSRVISVIQNVV
FT                   NEKQAEGRFPGSKNHYSSASLIEAIATYYQDGIRIGARGTITLTGPGGAVAGVAKYIED
FT                   KLLPDHVDDVRNHLKLVSGYNVYTEEEMISGWTVNDDPEQWLTKEHNKWKDGKLLSRYG
FT                   ANLTELLNEHHMTFKQGWPVIEGKPVFLTDVLQKLMNDLGEPLINAMRDKLSGEIDVGR
FT                   RVDLGFDVRQQILAQPDSALPVSNGEQVAGNLNDFLTRLAHGSVALDQLSPLQRAVIGG
FT                   LFRAPNVDAQGFAEAWEKVQEVALGTADESFFKRYNAIEKVLHESKAPAFEAGLAHGGT
FT                   PGVETAGELKVRALAEPLTLYQWGQRIAQINSTARRDYQTKILESAARVRERFYNAGAI
FT                   SARQFPQDLLRLGTDDPGRRCFPLALLMAAALGLGDEAERALVGRIANASLDPTDAESR
FT                   AMFAALDDLSGVATTEIGRSNGVLGLDVIVRNLEMKTGSAVYLLDTGKHALLVARIHID
FT                   GKPAYRFFDPNFAIYGFSRADQLQQAIQGHLASDGDLAALYGLAGSTDSVFTVIELDTK
FT                   AIADKVLPSKLSVNDLLKSERVTVGRTVSVWDEQASARMRSLSENVRMGEGLAQLDARY
FT                   QAGEFEEATRRLRSDNKLGEHYLPLLETVKETSKTHYTLTLVDARNPQVSVEVSTVDSR
FT                   FIKLARHIKRLAKNLAGPARGPADSDGGSRLSFAFAIQAIINEMRSREYQRQGGQIPAL
FT                   TTALQVQAYVSYAQLSFGVATDALQMVSLVRQVAASERALAAGHASLSSRLLGRAASGV
FT                   GLGFSAVNIGFDIHGLTVATNDEQRSRFATQLAFNVAALGLDIAALAVGGTVGAAAAVL
FT                   SVPLLGIGIGAAAIASNLGQISDKARAVGRHLFLINEAYTESGHNIEEGVLRFEPEAVI
FT                   TALDLRRGSVEFDSQKFFPTIFQTVGLPSFDARDQEQHRAINIREALRLPSTLRIDRQN
FT                   KVNAVVLPCTPTCYYGYEYQLGSSGFAPDEDVSERLTAYQRFWDYGDYPLPVAQDSSRL
FT                   RTSYPNIIDGWKKRLEFDERGEQRFQFFSTAPFPHVLYKLHPFNKPTTVRISLNEHCRQ
FT                   LVVPQLPAEWNNLISYEITAHSGQVQLTLSPGVVSVVLNSPPLVDGPSVVAFSPRATAD
FT                   WVISAPWAGEEQVRFEDAVLIVDGIRIDGFEGFIRLKGGELFQVDRSKNNALLLVRMDL
FT                   ESDRVWQTSKSAVGITIDPPDVDRISDTVLARLRSLRRANRLASSHIPVSGFHVPLTVS
FT                   NRPVSTTGYYDAGRDRMLYPRNLPDAVNTGIVLGAVVAEHAWFYHPDHPTIWRVDALSG
FT                   TVNHRYRLMNPAQGSRIKGFEGTVGGDLRVVQEITGSGETDYSLEYLIRGQKLTFTHFH
FT                   ASSHSEDLLQRTLEYWKQPLSQFMRSRPYADDSSEMSASLSSWKSAPFIGLRCIDHGEF
FT                   AYSGWLRPHDNQFILNDFDVTQRTMLMWDRVDNQDAIIYDKEDETLIRVALSRIEDRET
FT                   LDDVIENDVVEMTSTAGRYIATKKDGRLFEVDRDGELRFIGVGQRWFELNPQWIDALAK
FT                   LAQAYKAAPFAVIGLTRTSSPGFLAAWCIAGQLLLVDGGSGGELTLLAMTPEGKAAWVF
FT                   DKEAGKLYRQAFVDFAAVRVAFAEGSKLLNREHLPKVEPVWDQWQVAEVEVHGQGLLAQ
FT                   TLDGVNLALIEGRPARILGVENRWSALDHSTDVQLRGRLQKLVSAFPHAAFMPVGEKDG
FT                   RYRYYVPESDQLFDVRKPSDGQWPAFLGIKSGSVPLTFDSADNVVFTQRFDPAPSISVW
FT                   MQDCLAKRDEEVMFIASRGDFPGSQAVVPQGVERLLLTFGSPQQVCRLNDEDWQRMDCI
FT                   VLECQPSPDIQPSKLPVLILEMSANEHLLLTVQDGQLVLIDPDNAHSLIVRDMYASEGG
FT                   PVIAMEIHVRTGTSDHRFSLERLLLTVMADQVDKGYVEMKALIATSESFTR"
FT   gene            complement(716093..716689)
FT                   /locus_tag="Pfl01_0610"
FT   CDS_pept        complement(716093..716689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0610"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72354"
FT                   /db_xref="GOA:Q3KIQ2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ2"
FT                   /protein_id="ABA72354.1"
FT                   /translation="MLHVLFSVYLKMLVLYSPFFVLSCFISLTRGYSRKEQRRLAWKVA
FT                   VATLVSSVLLYLFGRVIFDVFGITVDAFRIGAGSVLFISALGMAQGKSAVQTDNVQQDV
FT                   TIVPLTIPLTVGPGTIGALLVMGVSQPHWDDKLFAIMSIALASFTVGVVLYLSNRIERI
FT                   LGDQGLQIVSRLMGLFVCALAAQIIFTGVKGYLVP"
FT   gene            complement(716752..719529)
FT                   /locus_tag="Pfl01_0611"
FT   CDS_pept        complement(716752..719529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0611"
FT                   /product="putative sensor kinase/response regulator fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72355"
FT                   /db_xref="GOA:Q3KIQ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ1"
FT                   /protein_id="ABA72355.1"
FT                   /translation="MRWLRIAIGFTVTLLTLLCMLPAQAAQGSGWSVLLDDQGNLQLSD
FT                   IRSARYTNQFSPIELDRLTAAEPDGALWLRFRLAPGKHEQVLRIFAPDLSHLNLYVLDG
FT                   DRLIEQRDTGTAQPQAERPLPSSDFMLPLPQSDKPLDVYLRLVSDHQLRPYITLQAAVM
FT                   AAANHNQTLIYGLLFGCLAMLILHNLIRYAYTRSRSSLWLAVCEGLLSLSLLLLLNLAG
FT                   PWLPNWHAIQTPGAYLALLLTAPAGLMFAYRFFAPLGPHPLNKLLIGDILFIVICSLLL
FT                   LFVNTLPLNIITYALVALAGLSMLLVGFYHWQKGYRPARLFVAAMVVFNIGTLIILPAL
FT                   LGLTLVAPQGLIMTLMGFICISGLLMSIALGERQRSITESRFSISRDLAASNAEINAKA
FT                   EFLAKISHEIRTPMNGVLGMTELLLGTPLSVKQRDYVQTIHSAGNELLTLINEILDISR
FT                   LESGQIELDDVQFDLNALIDDCLSIYRAKAEQQNVELISFIQPQVPRVISGDPTRLRQT
FT                   LLSLLENALKKTEEGEVLVVVALDERSAGPRLRIAVQDSGQPMDQEERDALMHAELHSK
FT                   HFLSANRLGGNLGLVIARQLIRLMQGEFGIKSGASQGSTLWLTLPLDPDRLEHPTSDLD
FT                   SPLQGARVLVVDDNDTCRKVLVQQCSAWGLNVSAVPSGKEALALLRTKAHLRDYFDVVL
FT                   LDQNMPGMTGMQLAAKIKEDPSLNHDILLIMLTGISNAPSKIIARNSGIKRILAKPVAG
FT                   YTLKTTLADELNQRNRGQVVFQPQVASPAAPVKVPSDFRILVAEDNTISTKVIRGMLGK
FT                   LNLQPDTASNGEEALQAMKAQRYDLVLMDCEMPILDGFSATQQLRAWEVGNQRIRTPIV
FT                   ALTAHILAEHKERARQAGMDGHMAKPVELSQLRELIEHWVAQRDQQNRATTQPS"
FT   sig_peptide     complement(719452..719529)
FT                   /locus_tag="Pfl01_0611"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(719632..720924)
FT                   /locus_tag="Pfl01_0612"
FT   CDS_pept        complement(719632..720924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0612"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72356"
FT                   /db_xref="GOA:Q3KIQ0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ0"
FT                   /protein_id="ABA72356.1"
FT                   /translation="MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGSAIEAKCEN
FT                   VAIDVLALEQLADFAEKNVSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSK
FT                   AFTKDFLARHKIPTADYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEA
FT                   EDAVRDMLAGNAFGDAGSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDS
FT                   GPNTGGMGAYSPAPVVTADVHQRVMDQVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNP
FT                   KVIEFNCRFGDPETQPVMLRLQSSLVLLVEAALAQALDKVEAQWDPRPSVGIVLAAGGY
FT                   PGDYAKGAPINGLDAAAALEGKVFHAGTALKDGNVVTAGGRVLCATAMGASVGAAQEQA
FT                   YKLAKAIDWEGCFYRTDIGYRAIARERGESQ"
FT   gene            complement(721078..722697)
FT                   /locus_tag="Pfl01_0613"
FT   CDS_pept        complement(721078..722697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0613"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72357"
FT                   /db_xref="GOA:Q3KIP9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIP9"
FT                   /protein_id="ABA72357.1"
FT                   /translation="MEIEMTDQTTRLPIRRALISVSDKTGILEFARELEALGVEILSTG
FT                   GTFKLLQDNGVAAVEVADYTGFAEMMDGRVKTLHPKIHGGILGRRGIDDAIMNEHGIKP
FT                   IDLVAVNLYPFEATISKPGCDLPTAIENIDIGGPTMVRSAAKNHKDVAIVVNASDYADV
FT                   LENLKAGGLTYAQRFDLMLKAFEHTAAYDGMIANYMGTVNQAAETLSTEGRSEFPRTFN
FT                   SQFIKAQEMRYGENPHQSAAFYVEAKPAEVGIATATQLQGKELSYNNVADTDAALECVK
FT                   SFVKPACVIVKHANPCGVAVSPDAEGGIRQAYELAYATDTESAFGGIIAFNRELDAETA
FT                   KAIVERQFVEVIIAPSVSEEARAIVAAKANVRLLACGEWSADRVPAWDYKRVNGGLLVQ
FT                   SRDIGMIGADDLKVVTKRAPTEQEVHDLIFAWKVAKFVKSNAIVYAKNRQTIGVGAGQM
FT                   SRVNSARIAAIKAEHAGLQVAGSVMASDAFFPFRDGLDNAAKVGITAVIQPGGSMRDAE
FT                   VIAAADEAGIAMVFTGMRHFRH"
FT   gene            complement(722768..723088)
FT                   /locus_tag="Pfl01_0614"
FT   CDS_pept        complement(722768..723088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0614"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72358"
FT                   /db_xref="GOA:Q3KIP8"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIP8"
FT                   /protein_id="ABA72358.1"
FT                   /translation="MTMMTETLVSGTTPVSDNVNLKQHLNTPSEEGQTLRGSVEKALHN
FT                   YFAHLEGASVTDVYNLVLSEVEAPLLESVMNYVKGNQTKASELLGLNRGTLRKKLKQYD
FT                   LL"
FT   gene            complement(723085..724095)
FT                   /locus_tag="Pfl01_0615"
FT   CDS_pept        complement(723085..724095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0615"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72359"
FT                   /db_xref="GOA:Q3KIP7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIP7"
FT                   /protein_id="ABA72359.1"
FT                   /translation="MSAVRIGPYTLQNGLILAPMAGVTDQPFRQLCKRLGAGLVVSEMV
FT                   TSDMSLWNTRKSRMRMIHEGDPEPRSVQIAGGDAQMLADAARANVELGAQIIDINMGCP
FT                   AKKVCNKAAGSALLKDEALVTEILNAVVAAVDVPVTLKIRTGWDRDNKNGLTVAKIAEQ
FT                   AGITALAVHGRTRADLYTGEAEYDTIAAIKQAVSIPVFANGDIVSPEKARYVLDATGAD
FT                   GLLIGRAAQGRPWIFREIEHFLRTGEKLPAPELIEVERILLEHLAALHAFYGDVMGVRI
FT                   ARKHVGWYLATLPGAREFRAHFNRLDGTETQCANVREFFAERYKSLTGDGEGVAA"
FT   gene            complement(724281..725549)
FT                   /locus_tag="Pfl01_0616"
FT   CDS_pept        complement(724281..725549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72360"
FT                   /db_xref="GOA:Q3KIP6"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIP6"
FT                   /protein_id="ABA72360.1"
FT                   /translation="MTDSFVTQCPHCQTSFRVSHAQLSVARGVVRCGSCLQVFNAAKQL
FT                   LEQHAGKEAVTPVAPLISEPPPISEPAPAEPPAIVETPEPRAVSQKQWSATELDLDSLD
FT                   LDEELARLEQREIQPTTEFGRPREDALSARRDSHEPEDTKWPDSLFSEPADERAPEVEE
FT                   EPEAIEPEPIRSERTEPSLSLEPVDLDDEPPIPQLRLHDPIDPNARRERLSASDDVDDE
FT                   LPLIEPARKKRERVESSVRAEALQDLTDDPLQLDWQKRRSPWGRRLLWLLLIVLAAAGL
FT                   GGQYIAYHFDELARQDQYRPWFQQLCPQVGCTVPSKVDIAKIKSSNLVVRSHPEFSGAL
FT                   VVDAIIYNRAPFSQPFPLLELRFADLNGHLIASRRFKPGEYLNGDLEGMAEMPPQTPIH
FT                   IALDILDPGPKAVNYSLSFHSPE"
FT   gene            complement(725580..726458)
FT                   /locus_tag="Pfl01_0617"
FT   CDS_pept        complement(725580..726458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0617"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72361"
FT                   /db_xref="GOA:Q3KIP5"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIP5"
FT                   /protein_id="ABA72361.1"
FT                   /translation="MPWLQVRLAISPEQAETYEDAFLEVGAVSVTFMDAEDQPIFEPEL
FT                   NTTPLWAHTHLLALFEGGTEAAPLLAHLELLTGSPLPEHHSEVIEDQDWERSWMDGFQP
FT                   MRFGQRLWIVPSWHAAPEPDAVNLLLDPGLAFGTGTHPTTALCLEWLDGQDLKDCNVLD
FT                   FGCGSGILAIAALLLGAKEAVGTDIDVQALEASRDNAGRNNIADELFPLYLPEELPQVK
FT                   ADVLVANILAGPLVSLAPQLSGLVKSGGRLALSGILAEQGDEVAAAYAQDFDLDPIANR
FT                   DGWVRITGRRR"
FT   gene            complement(726625..727983)
FT                   /locus_tag="Pfl01_0618"
FT   CDS_pept        complement(726625..727983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0618"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72362"
FT                   /db_xref="GOA:Q3KIP4"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT