(data stored in SCRATCH3701 zone)

EMBL: CP000095

ID   CP000095; SV 2; circular; genomic DNA; STD; PRO; 1842899 BP.
XX
AC   CP000095;
XX
PR   Project:PRJNA13911;
XX
DT   12-AUG-2005 (Rel. 84, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 11)
XX
DE   Prochlorococcus marinus str. NATL2A, complete genome.
XX
KW   .
XX
OS   Prochlorococcus marinus str. NATL2A
OC   Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochlorococcus.
XX
RN   [1]
RP   1-1842899
RX   DOI; 10.1371/journal.pgen.0030231.
RX   PUBMED; 18159947.
RA   Kettler G.C., Martiny A.C., Huang K., Zucker J., Coleman M.L., Rodrigue S.,
RA   Chen F., Lapidus A., Ferriera S., Johnson J., Steglich C., Church G.M.,
RA   Richardson P., Chisholm S.W.;
RT   "Patterns and implications of gene gain and loss in the evolution of
RT   Prochlorococcus";
RL   PloS Genet. 3(12):E231-E231(2007).
XX
RN   [2]
RP   1-1842899
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Thiel J., Schmutz J., Larimer F.,
RA   Land M., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (08-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1842899
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Thiel J., Schmutz J., Larimer F.,
RA   Land M., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (09-AUG-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; eacac55bec722f75872d43a167310848.
DR   BioSample; SAMN00623057.
DR   EnsemblGenomes-Gn; EBG00001220167.
DR   EnsemblGenomes-Gn; EBG00001220168.
DR   EnsemblGenomes-Gn; EBG00001220169.
DR   EnsemblGenomes-Gn; EBG00001220170.
DR   EnsemblGenomes-Gn; EBG00001220171.
DR   EnsemblGenomes-Gn; EBG00001220172.
DR   EnsemblGenomes-Gn; EBG00001220173.
DR   EnsemblGenomes-Gn; EBG00001220174.
DR   EnsemblGenomes-Gn; EBG00001220175.
DR   EnsemblGenomes-Gn; EBG00001220176.
DR   EnsemblGenomes-Gn; EBG00001220177.
DR   EnsemblGenomes-Gn; EBG00001220178.
DR   EnsemblGenomes-Gn; EBG00001220179.
DR   EnsemblGenomes-Gn; EBG00001220180.
DR   EnsemblGenomes-Gn; EBG00001220181.
DR   EnsemblGenomes-Gn; EBG00001220182.
DR   EnsemblGenomes-Gn; EBG00001220183.
DR   EnsemblGenomes-Gn; EBG00001220184.
DR   EnsemblGenomes-Gn; EBG00001220185.
DR   EnsemblGenomes-Gn; EBG00001220186.
DR   EnsemblGenomes-Gn; EBG00001220187.
DR   EnsemblGenomes-Gn; EBG00001220188.
DR   EnsemblGenomes-Gn; EBG00001220189.
DR   EnsemblGenomes-Gn; EBG00001220190.
DR   EnsemblGenomes-Gn; EBG00001220191.
DR   EnsemblGenomes-Gn; EBG00001220192.
DR   EnsemblGenomes-Gn; EBG00001220193.
DR   EnsemblGenomes-Gn; EBG00001220194.
DR   EnsemblGenomes-Gn; EBG00001220195.
DR   EnsemblGenomes-Gn; EBG00001220196.
DR   EnsemblGenomes-Gn; EBG00001220197.
DR   EnsemblGenomes-Gn; EBG00001220200.
DR   EnsemblGenomes-Gn; EBG00001220201.
DR   EnsemblGenomes-Gn; EBG00001220202.
DR   EnsemblGenomes-Gn; EBG00001220203.
DR   EnsemblGenomes-Gn; EBG00001220204.
DR   EnsemblGenomes-Gn; EBG00001220205.
DR   EnsemblGenomes-Gn; EBG00001220206.
DR   EnsemblGenomes-Gn; EBG00001220207.
DR   EnsemblGenomes-Gn; EBG00001220209.
DR   EnsemblGenomes-Gn; EBG00001220210.
DR   EnsemblGenomes-Gn; EBG00001220211.
DR   EnsemblGenomes-Gn; EBG00001220212.
DR   EnsemblGenomes-Gn; EBG00001220213.
DR   EnsemblGenomes-Gn; EBG00001220214.
DR   EnsemblGenomes-Gn; EBG00001220215.
DR   EnsemblGenomes-Gn; EBG00001220216.
DR   EnsemblGenomes-Gn; EBG00001220217.
DR   EnsemblGenomes-Gn; EBG00001220218.
DR   EnsemblGenomes-Gn; EBG00001220219.
DR   EnsemblGenomes-Gn; EBG00001220220.
DR   EnsemblGenomes-Gn; EBG00001220221.
DR   EnsemblGenomes-Gn; EBG00001220222.
DR   EnsemblGenomes-Gn; EBG00001220223.
DR   EnsemblGenomes-Gn; EBG00001220224.
DR   EnsemblGenomes-Gn; PMN2A_R0001.
DR   EnsemblGenomes-Gn; PMN2A_R0002.
DR   EnsemblGenomes-Gn; PMN2A_R0003.
DR   EnsemblGenomes-Gn; PMN2A_R0004.
DR   EnsemblGenomes-Gn; PMN2A_R0005.
DR   EnsemblGenomes-Gn; PMN2A_R0006.
DR   EnsemblGenomes-Gn; PMN2A_R0007.
DR   EnsemblGenomes-Gn; PMN2A_R0008.
DR   EnsemblGenomes-Gn; PMN2A_R0009.
DR   EnsemblGenomes-Gn; PMN2A_R0010.
DR   EnsemblGenomes-Gn; PMN2A_R0011.
DR   EnsemblGenomes-Gn; PMN2A_R0012.
DR   EnsemblGenomes-Gn; PMN2A_R0013.
DR   EnsemblGenomes-Gn; PMN2A_R0014.
DR   EnsemblGenomes-Gn; PMN2A_R0015.
DR   EnsemblGenomes-Gn; PMN2A_R0017.
DR   EnsemblGenomes-Gn; PMN2A_R0018.
DR   EnsemblGenomes-Gn; PMN2A_R0019.
DR   EnsemblGenomes-Gn; PMN2A_R0020.
DR   EnsemblGenomes-Gn; PMN2A_R0021.
DR   EnsemblGenomes-Gn; PMN2A_R0022.
DR   EnsemblGenomes-Gn; PMN2A_R0023.
DR   EnsemblGenomes-Gn; PMN2A_R0024.
DR   EnsemblGenomes-Gn; PMN2A_R0026.
DR   EnsemblGenomes-Gn; PMN2A_R0027.
DR   EnsemblGenomes-Gn; PMN2A_R0028.
DR   EnsemblGenomes-Gn; PMN2A_R0029.
DR   EnsemblGenomes-Gn; PMN2A_R0030.
DR   EnsemblGenomes-Gn; PMN2A_R0031.
DR   EnsemblGenomes-Gn; PMN2A_R0032.
DR   EnsemblGenomes-Gn; PMN2A_R0033.
DR   EnsemblGenomes-Gn; PMN2A_R0034.
DR   EnsemblGenomes-Gn; PMN2A_R0035.
DR   EnsemblGenomes-Gn; PMN2A_R0036.
DR   EnsemblGenomes-Gn; PMN2A_R0037.
DR   EnsemblGenomes-Gn; PMN2A_R0038.
DR   EnsemblGenomes-Gn; PMN2A_R0039.
DR   EnsemblGenomes-Gn; PMN2A_R0040.
DR   EnsemblGenomes-Gn; PMN2A_R0041.
DR   EnsemblGenomes-Gn; PMN2A_R0042.
DR   EnsemblGenomes-Gn; PMN2A_R0043.
DR   EnsemblGenomes-Gn; PMN2A_R0044.
DR   EnsemblGenomes-Tr; EBT00001789066.
DR   EnsemblGenomes-Tr; EBT00001789068.
DR   EnsemblGenomes-Tr; EBT00001789069.
DR   EnsemblGenomes-Tr; EBT00001789070.
DR   EnsemblGenomes-Tr; EBT00001789071.
DR   EnsemblGenomes-Tr; EBT00001789072.
DR   EnsemblGenomes-Tr; EBT00001789073.
DR   EnsemblGenomes-Tr; EBT00001789075.
DR   EnsemblGenomes-Tr; EBT00001789076.
DR   EnsemblGenomes-Tr; EBT00001789077.
DR   EnsemblGenomes-Tr; EBT00001789078.
DR   EnsemblGenomes-Tr; EBT00001789079.
DR   EnsemblGenomes-Tr; EBT00001789080.
DR   EnsemblGenomes-Tr; EBT00001789081.
DR   EnsemblGenomes-Tr; EBT00001789082.
DR   EnsemblGenomes-Tr; EBT00001789083.
DR   EnsemblGenomes-Tr; EBT00001789084.
DR   EnsemblGenomes-Tr; EBT00001789085.
DR   EnsemblGenomes-Tr; EBT00001789086.
DR   EnsemblGenomes-Tr; EBT00001789088.
DR   EnsemblGenomes-Tr; EBT00001789089.
DR   EnsemblGenomes-Tr; EBT00001789090.
DR   EnsemblGenomes-Tr; EBT00001789091.
DR   EnsemblGenomes-Tr; EBT00001789092.
DR   EnsemblGenomes-Tr; EBT00001789093.
DR   EnsemblGenomes-Tr; EBT00001789094.
DR   EnsemblGenomes-Tr; EBT00001789095.
DR   EnsemblGenomes-Tr; EBT00001789096.
DR   EnsemblGenomes-Tr; EBT00001789097.
DR   EnsemblGenomes-Tr; EBT00001789098.
DR   EnsemblGenomes-Tr; EBT00001789099.
DR   EnsemblGenomes-Tr; EBT00001789100.
DR   EnsemblGenomes-Tr; EBT00001789101.
DR   EnsemblGenomes-Tr; EBT00001789102.
DR   EnsemblGenomes-Tr; EBT00001789103.
DR   EnsemblGenomes-Tr; EBT00001789105.
DR   EnsemblGenomes-Tr; EBT00001789107.
DR   EnsemblGenomes-Tr; EBT00001789108.
DR   EnsemblGenomes-Tr; EBT00001789109.
DR   EnsemblGenomes-Tr; EBT00001789110.
DR   EnsemblGenomes-Tr; EBT00001789111.
DR   EnsemblGenomes-Tr; EBT00001789112.
DR   EnsemblGenomes-Tr; EBT00001789113.
DR   EnsemblGenomes-Tr; EBT00001789114.
DR   EnsemblGenomes-Tr; EBT00001789115.
DR   EnsemblGenomes-Tr; EBT00001789116.
DR   EnsemblGenomes-Tr; EBT00001789117.
DR   EnsemblGenomes-Tr; EBT00001789118.
DR   EnsemblGenomes-Tr; EBT00001789120.
DR   EnsemblGenomes-Tr; EBT00001789121.
DR   EnsemblGenomes-Tr; EBT00001789122.
DR   EnsemblGenomes-Tr; EBT00001789123.
DR   EnsemblGenomes-Tr; EBT00001789124.
DR   EnsemblGenomes-Tr; EBT00001789125.
DR   EnsemblGenomes-Tr; EBT00001789126.
DR   EnsemblGenomes-Tr; PMN2A_R0001-1.
DR   EnsemblGenomes-Tr; PMN2A_R0002-1.
DR   EnsemblGenomes-Tr; PMN2A_R0003-1.
DR   EnsemblGenomes-Tr; PMN2A_R0004-1.
DR   EnsemblGenomes-Tr; PMN2A_R0005-1.
DR   EnsemblGenomes-Tr; PMN2A_R0006-1.
DR   EnsemblGenomes-Tr; PMN2A_R0007-1.
DR   EnsemblGenomes-Tr; PMN2A_R0008-1.
DR   EnsemblGenomes-Tr; PMN2A_R0009-1.
DR   EnsemblGenomes-Tr; PMN2A_R0010-1.
DR   EnsemblGenomes-Tr; PMN2A_R0011-1.
DR   EnsemblGenomes-Tr; PMN2A_R0012-1.
DR   EnsemblGenomes-Tr; PMN2A_R0013-1.
DR   EnsemblGenomes-Tr; PMN2A_R0014-1.
DR   EnsemblGenomes-Tr; PMN2A_R0015-1.
DR   EnsemblGenomes-Tr; PMN2A_R0017-1.
DR   EnsemblGenomes-Tr; PMN2A_R0018-1.
DR   EnsemblGenomes-Tr; PMN2A_R0019-1.
DR   EnsemblGenomes-Tr; PMN2A_R0020-1.
DR   EnsemblGenomes-Tr; PMN2A_R0021-1.
DR   EnsemblGenomes-Tr; PMN2A_R0022-1.
DR   EnsemblGenomes-Tr; PMN2A_R0023-1.
DR   EnsemblGenomes-Tr; PMN2A_R0024-1.
DR   EnsemblGenomes-Tr; PMN2A_R0026-1.
DR   EnsemblGenomes-Tr; PMN2A_R0027-1.
DR   EnsemblGenomes-Tr; PMN2A_R0028-1.
DR   EnsemblGenomes-Tr; PMN2A_R0029-1.
DR   EnsemblGenomes-Tr; PMN2A_R0030-1.
DR   EnsemblGenomes-Tr; PMN2A_R0031-1.
DR   EnsemblGenomes-Tr; PMN2A_R0032-1.
DR   EnsemblGenomes-Tr; PMN2A_R0033-1.
DR   EnsemblGenomes-Tr; PMN2A_R0034-1.
DR   EnsemblGenomes-Tr; PMN2A_R0035-1.
DR   EnsemblGenomes-Tr; PMN2A_R0036-1.
DR   EnsemblGenomes-Tr; PMN2A_R0037-1.
DR   EnsemblGenomes-Tr; PMN2A_R0038-1.
DR   EnsemblGenomes-Tr; PMN2A_R0039-1.
DR   EnsemblGenomes-Tr; PMN2A_R0040-1.
DR   EnsemblGenomes-Tr; PMN2A_R0041-1.
DR   EnsemblGenomes-Tr; PMN2A_R0042-1.
DR   EnsemblGenomes-Tr; PMN2A_R0043-1.
DR   EnsemblGenomes-Tr; PMN2A_R0044-1.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2518516; 18769676.
DR   EuropePMC; PMC3209181; 21926220.
DR   EuropePMC; PMC3390001; 22768379.
DR   EuropePMC; PMC5148202; 27258949.
DR   EuropePMC; PMC5974335; 29854954.
DR   EuropePMC; PMC6102989; 29915114.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000095.
DR   SILVA-SSU; CP000095.
XX
CC   On Aug 9, 2007 this sequence version replaced gi:72001690.
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Sallie Chisholm
CC   (chisholm@mit.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1842899
FT                   /organism="Prochlorococcus marinus str. NATL2A"
FT                   /strain="NATL2A"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:59920"
FT   gene            189..1349
FT                   /locus_tag="PMN2A_1328"
FT   CDS_pept        189..1349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1328"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Alternative locus ID: NATL2_00001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1328"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58817"
FT                   /db_xref="GOA:Q46I61"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I61"
FT                   /protein_id="AAZ58817.1"
FT                   /translation="MKLSCSQSELNNALQLVSRAVSNRPTHPVLANVLLAADEVTGKLR
FT                   LTGFDLSLGIQTSISASIDSSGAITLPAKLFGEIVSKLSNDSPLVLTSDETSQQVELTS
FT                   KSGTYQVRGMLSDDFPELPLVENGTSFKLNPLLLSNAIKSTLFASSTDDAKQLLTGVNL
FT                   TFDGYGIESAATDGHRLAVLNLNNILSDSKEIDSSIKFEKFSITLPSKSLREVEKFLST
FT                   CDISHPINFFIDKGQVVFISVEDIITIRALEGSYPNYSQLLPDTFENELEFDRKEFISS
FT                   LERIAVLADQHNNVIKVTTDGSANLIKISTDAQDIGTGYESLPVSYKGDSFQIAFNVRY
FT                   LLDGLKVIDSNLIKLSCNSPTTPAIFSPINSDVNFTYLVMPIQIRN"
FT   gene            1352..2122
FT                   /locus_tag="PMN2A_1329"
FT   CDS_pept        1352..2122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1329"
FT                   /product="RNA metabolism-related protein"
FT                   /note="Alternative locus ID: NATL2_00011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1329"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58818"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I60"
FT                   /protein_id="AAZ58818.1"
FT                   /translation="MTVPKKLLLSDLLKHNVRCENGIDHGPVITPWMHPPVHRILGFIS
FT                   RPSNLRLEREVWRLDQLKGINQQEVYVKGVCSVSDEQTLDRFPTLMNANVFNKSGQKIG
FT                   LIADFLFEPKKGNIQYYLVSRSNPLIPGTSRWLLSIDQIIDKQPGSISCDIETFEDLPI
FT                   QKASLKEEFLSKSRKWKAQFQDLTYNASDKLEGWIDDQISESDNDSYEMLNDDPSYDDW
FT                   IDNLDIDSSEEFNRMNKSKKNTNSTNERDLDPWI"
FT   gene            2126..4537
FT                   /locus_tag="PMN2A_1330"
FT   CDS_pept        2126..4537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1330"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="Alternative locus ID: NATL2_00021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1330"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58819"
FT                   /db_xref="GOA:Q46I59"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I59"
FT                   /protein_id="AAZ58819.1"
FT                   /translation="MTVSFENKDFNQFINSSKFLVEYDVTSALEQEGLKQSDYAEICRR
FT                   LNRAPNRNELGMFGVMWSEHCCYRNSRPLLKNFPTTGSRILVGPGENAGVVDIGFGQRL
FT                   VFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDDEKNISLLE
FT                   GVVAGISHYGNCVGVPTIGGEVGFDSSYSGNPLVNAMALGLMETEEIVCSGASGIGFPV
FT                   LYVGNTTGRDGMGGASFASSELSKTSIDDRPAVQVGDPFLEKGLIEACLEAFKTGYVIA
FT                   AQDMGAAGLTCSCSEMASKGEVGIELNLDLVPAREKGMTAYEFLLSESQERMLFVVKPG
FT                   SEEELRELFIRWGLYVEVVGKVLKEKVVRVIHKGEVVANLPASALADDTPIEEHLLINS
FT                   TPEYLQEHWKWTEDLLPKTLDDGIINIKNNLFISWNNVLLELLSIPSIASKNWIYKQYD
FT                   FQVQSNTVVSPGEADAAVIRIRSQNDFSTKPKKDRGIASVVDCNDRWVYLDPQRGSMSA
FT                   VAEAARNLSAVGAEPIAITNNLNFSSPDKAVGFWQLSMSCEGITKACLALNTPVTGGNV
FT                   SLYNDTKLPNNTVIPIHPTPVIGMVGLIEDINKICKKSWVKAEDQIWMIGLPLENNINQ
FT                   DERISLSASSFLEYIHGLKTGRPPEIDLNLEKQVHAFLREVIKQGIVNSAHDLGDGGLT
FT                   VAIADCCISSGYGANIILPPSQSRLDRLLFAEGGARVLVSCSTDQSVELKKYYKNISLQ
FT                   GSILFSISHLGNVNNQKKLLVSQSNNTIIDVNILDLKDTYKDAIHKKITK"
FT   gene            4599..6056
FT                   /locus_tag="PMN2A_1331"
FT   CDS_pept        4599..6056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1331"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="Alternative locus ID: NATL2_00031"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1331"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58820"
FT                   /db_xref="GOA:Q46I58"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I58"
FT                   /protein_id="AAZ58820.1"
FT                   /translation="MCGIVGVVSTDQCNQQIYDSLLLLQHRGQDSTGIATMDGSVFHIN
FT                   KSKGQVREAYRTRDMRALIGRSGLGHVRYATKGAAHREEEAQPFYVNAPYGIILVHNGN
FT                   LTNTRELEKELFKVDKRHTNTSSDTEMLLNVLATELNSEVKGKDVDPDDLFNAVKRLHS
FT                   RVEGSYASIALIAGHGLLAFRDPFGIRPLVIGKRVKENNKPEWVIASESLVIENNDYVI
FT                   VRDVEPGEAIFITSNGEFFSKQCSDNPQLFPCSFEYVYLARPDSIMNGISVYESRLRMG
FT                   DLLAETIKKQISLGDIDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPG
FT                   QSLRKRSVRQKLNAMSTEFKNKNVLIVDDSVVRGTTSQQIVQMARSAGANKVTFTSAAP
FT                   PIRYPHVYGINMPSRNELIAYNRDINQIENNLFIDKMIYQEVNDLTQAITQNSKIKELD
FT                   LSCFTGKYITGTVTDEYLTWVEETSLS"
FT   gene            complement(6053..8536)
FT                   /locus_tag="PMN2A_1332"
FT   CDS_pept        complement(6053..8536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1332"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Alternative locus ID: NATL2_00041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1332"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58821"
FT                   /db_xref="GOA:Q46I57"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I57"
FT                   /protein_id="AAZ58821.1"
FT                   /translation="MAKERLKPISLHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRR
FT                   ILFAMHELGLTPERPYRKCARVVGDVLGKYHPHGDQAVYDALVRQVQVFNSRYPILDGH
FT                   GNFGSIDDDPPAAMRYTETRLAPISNDAILSEIDQETVDFSPNFDGSQQEPDVLPAQLP
FT                   FLILNGSTGIAVGMATSIPPHNLNEVVEALIAIIKKPSLNEEKLLEIIPGPDFPTGGEI
FT                   LVSNGIKETYTKGRGSITMRGIARIEEINPGKGKHKRSGIIISELPYQLNKASWIEKLA
FT                   DLVNNGKISGIADIRDESDRDGMRILVEVKRDSDPKKILDFLYQKTSLQSNFGAILLAL
FT                   VNGQPVQLTLKKLLNNFLEFRENTILLRSNYLLKNIKNREEIVDALIQATNNVKKVIDL
FT                   IEKSKDTPEAKSNLIISLKINERQADGILGMPLKKITGLEKDSLKNELKDLKTKRAELE
FT                   LIINDKENLMKVMVKELKDLKKRFGSKRRTKLIEGGDALIAEKMANQRPNKELQRINAL
FT                   KELSKDSEIIIQSNNEIKIIPSLTIKKLKLKEINQERKDILPAKLIWPIKNEPKILAVS
FT                   QEGKIGLLKWEFAGQKPGPLKQFLPAGLENDKIINLIPLTEIRDISIGLISTDGKFKRI
FT                   SINEISDISNRSTTILKLKDSVKLKSCILCKENSYLYIVSDIGRIIKIKITENDFPFMG
FT                   KLAQGTNIIKLFPNENIVEALSFQEKKNKDLILITNKGFFVKHSTKEITISKKGALGTM
FT                   GIHFKDNKTIKERVIDCFINNKHVYVKTDKDRYQRLKTDQIDNSSYRKENKLNIDLKND
FT                   EFLKSTFSMKVPDKN"
FT   gene            complement(8620..9486)
FT                   /locus_tag="PMN2A_1333"
FT   CDS_pept        complement(8620..9486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1333"
FT                   /product="TPR repeat"
FT                   /note="Alternative locus ID: NATL2_00051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58822"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I56"
FT                   /protein_id="AAZ58822.1"
FT                   /translation="MKQTSKIFKYFLGLSLIKTFFVPNSSIAFFPRINEPNQQEFESTS
FT                   RQIGKTAIQLIQFGQYKEAIKILKLALKLNPTEETLWTTLADAQFKLKDSNNALLSLDK
FT                   VLAINPKNASIYFAKGSIYMNSKNLENAILMLNQGLLLDNKNETGYFQLGNAYIMLKEY
FT                   KKALLTYNKVTKLNPNFWQVINNKGLILYEINKKEEAVSKFKLAAKLSNNAEPRLALAI
FT                   SNYSMKGISIETLNIAKNALIDNPKYADIEYQSEQLWGRKLQHSAKLFFKTKEMKKVVR
FT                   EAREKTE"
FT   gene            complement(9492..10430)
FT                   /locus_tag="PMN2A_1334"
FT   CDS_pept        complement(9492..10430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1334"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1334"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58823"
FT                   /db_xref="GOA:Q46I55"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I55"
FT                   /protein_id="AAZ58823.1"
FT                   /translation="MRNSIDLTKKIKEKAFEEGFDAVGIAKVPGSSRIKLRTASLERWL
FT                   QAGHQATMEWMKSPRRKDIENMLQGVKSILAVGLNYYVDTERESKDISIARYGWGKDYH
FT                   KIIEEKLKKVAKFLETERPNAKWKICVDTSAFLDKAWAEEAGIGWIGKHSNVINSEIGS
FT                   WMFLGHLLSTEVLEADKPSKPICGECEKCIEACPTKAIEEPFIVNSYKCLAYHTLENRD
FT                   QELPENIINKMGNWIAGCDICQDVCPWNQKHIPSTTEPDLQPSEWILHTTKQDLLSWDD
FT                   AKWKESLKNSALKRIKPWMWRRNIDSISKKT"
FT   gene            10623..11345
FT                   /locus_tag="PMN2A_1335"
FT   CDS_pept        10623..11345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1335"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="Alternative locus ID: NATL2_00071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1335"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58824"
FT                   /db_xref="GOA:Q46I54"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I54"
FT                   /protein_id="AAZ58824.1"
FT                   /translation="MQSSPKEDLTLSSRLQQDLKNDLIAGLLVVIPLATTIWLSTIVSR
FT                   FVLAILTSIPKQLNPFITLNPLLQDLINLALGLTVPLLGILLIGLMARNFVGRWLLEFG
FT                   EGTLSRIPLAGSVYKTLKQLLETFLRDNSTRFRRVVLVEYPREGLFSVGFVTGIVGPSL
FT                   QTEPNQPLLSVFIPTAPNPTTGWYTLVPEDSVKDLDISVEDAFRTIISAGIVNPDDRSN
FT                   SSNTSFSSLFSQLRASSS"
FT   gene            11363..11989
FT                   /locus_tag="PMN2A_1336"
FT   CDS_pept        11363..11989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1336"
FT                   /product="antitermination protein NusB"
FT                   /note="Alternative locus ID: NATL2_00081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1336"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58825"
FT                   /db_xref="GOA:Q46I53"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I53"
FT                   /protein_id="AAZ58825.1"
FT                   /translation="MQLKSISRELALLLLGQIKKKDINKLNIESLLSKAIESLTQHWRE
FT                   QLDSCASQLEKANQELLDSEFQVDAGLLIKSQNHLKTCLIDSENILNCLSESIELPRLL
FT                   ALVDQKEIRELALRRVDLVIEKQDEIDHKLDSVMEGWRLKRLPRIDSDILRLAWVDLID
FT                   FNTPMAVTCNEAVNLANRYSDEQGRRMINGVLRKLQNSALILNLK"
FT   gene            11986..13281
FT                   /locus_tag="PMN2A_1337"
FT   CDS_pept        11986..13281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1337"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="Alternative locus ID: NATL2_00091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1337"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58826"
FT                   /db_xref="GOA:Q46I52"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I52"
FT                   /protein_id="AAZ58826.1"
FT                   /translation="MKDDFSQDEKNFSKMNQTENSSFVNDDSLDWAKQAYLQLKQKQKE
FT                   EKELCQKEIEEKEILKTKTNTNEDSKSNITVENSLQVSQETEVEDQPELGDFDDTFTWS
FT                   AEVLAAQGKKIDQFSLDDIDWLSRLKQGLEKTRKGFVTDLLEKLGDDPLTPEVLDDLET
FT                   LLLRADAGVSATDQILESLRTKLNEEVVEASEGLRFLKEQLVNVLEKPIKDSGADLLSP
FT                   QKGCLNIWMLVGVNGVGKTTTLGKLASVAKRSGFSAMIAAADTFRAAAVQQVKVWGDRT
FT                   GVEVIANESKNADPASIVFDAIGASKSKNIDLLLVDTAGRLQTKNNLMEELKKIRKIID
FT                   KLAPKANVESLLVLDSSQGQNGLRQALAFADSAELTGVILTKLDGSSKGGVAMAVASEA
FT                   KLPVRFIGAGEKIRDLRPFNSFEFIEALLTVR"
FT   gene            13340..14737
FT                   /locus_tag="PMN2A_1338"
FT   CDS_pept        13340..14737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1338"
FT                   /product="serine phosphatase"
FT                   /note="Alternative locus ID: NATL2_00101"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1338"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58827"
FT                   /db_xref="GOA:Q46I51"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I51"
FT                   /protein_id="AAZ58827.1"
FT                   /translation="MKENSPISEQQNQHPTNIFSSAASKSLSDLVHSLSQEQVVNQDLL
FT                   LSLSFALRSFTNLQRFLELIPLLVTQLVGVKGSLLIPFQDNGSLWREQLQMVPIDEDQE
FT                   LFRKLFLLEKGKKTGFGMEGKNIEMLDCLVQRHLDSSNVIATSIVSRGRQRGRLYAFDK
FT                   KEIVFGSNVHRKHIQIVADLAGVAIENDAIFQVIRNHEKVDRQISIGAEIQSQLLPDQC
FT                   PVIEGVELAACCRPAFQVGGDYYDFMPTRSDLNETAKASGRWALVIGDVMGKGVPAGLL
FT                   MTMLRGMLRAEVLTGLPPDSILHDLNQLALEDLTQSHRFVTLFYSDYDAKSRKLRFANA
FT                   AHNPPLLWSSKTKSINRLDTPGLLIGLQPEAEYGCGEIFLQPGDVLLYYTDGVTEAPGI
FT                   SGERFDENRLITFLDKFAKEGLGAKQILNKLFERLDGFVGVSDHHLEDDASMVVLKVKE
FT                   STVPELT"
FT   gene            14786..16177
FT                   /locus_tag="PMN2A_1339"
FT   CDS_pept        14786..16177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1339"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="Alternative locus ID: NATL2_00111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1339"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58828"
FT                   /db_xref="GOA:Q46I50"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I50"
FT                   /protein_id="AAZ58828.1"
FT                   /translation="MEKALSKTWSERFDKGLNPFIEKFNASIEFDICLLEEDLDGSIAH
FT                   ARMLGIQGIITKEEALRLENGLQQIRKEASDGLFHPVISDEDVHFAVEKKLIDLIGPVG
FT                   KKLHTGRSRNDQVGTDLRLWLRKRIDEIDMDLVRLQKSLFLLAEENLYTLIPGYTHLQR
FT                   AQPLSLAHHLLAYIEMAQRDRNRLKDVRKRVNISPLGAAALAGTSISISRKITSSELHF
FT                   QGIYSNSLDAVSDRDFVVEFLGASSLIMAHLSRLSEEVILWASEEFAFIQLTDRCATGS
FT                   SLMPQKKNPDVPELVRGKSGRVFGHLQAMLTMIKGLPLAYNKDFQEDKEAIFDSVKTVK
FT                   NSLIAISILFEEGLIFRKERLNQAVSSDFSNATDVADYLVAKDIPFREAYQLVGRIVKT
FT                   SLEEGILLKDIPLERWKTFHKFFEKDIYEKLLPSSVVESRLSAGGTGFERVQEQLLSWR
FT                   EKLFN"
FT   gene            16304..17056
FT                   /locus_tag="PMN2A_1340"
FT   CDS_pept        16304..17056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1340"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /note="Alternative locus ID: NATL2_00121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1340"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58829"
FT                   /db_xref="GOA:Q46I49"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I49"
FT                   /protein_id="AAZ58829.1"
FT                   /translation="MSIFVGNLPFRAEQEDVMELFSPFGEVSNCSLPLERDTGRKRGFA
FT                   FVEMADEAVEASAIESLQGAELMGRPLRINKAEPRGSAPRRGGGGYGGGGQGGYGGGGQ
FT                   GGYGGGQGGYGGGQGGYGGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQG
FT                   GYGGGGQGGYGGGGQGGYGGGGQGGYGGQADQSAQDRPSGAKGWEDRSHGNASQDVNDF
FT                   DQGRSRRRRGASPEGGADSTADYGGAES"
FT   gene            complement(17075..18082)
FT                   /locus_tag="PMN2A_1341"
FT   CDS_pept        complement(17075..18082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1341"
FT                   /product="tRNA-U16,U17-dihydrouridine synthase"
FT                   /note="Alternative locus ID: NATL2_00131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1341"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58830"
FT                   /db_xref="GOA:Q46I48"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I48"
FT                   /protein_id="AAZ58830.1"
FT                   /translation="MISNSLKTNEIANYRLSIAPMMDCTDRHFRVLMRQITKKSLLYTE
FT                   MIVAQALHYSKNRNKLLDFDEIEHPISIQLGGDNPKLLAEAAQMAEDWGYDEINLNIGC
FT                   PSPKVKSGNFGACLMGKPNIVASCIEKMKKTCNIPITVKHRLGIDNLDSDDYLLKFVDT
FT                   CSLAGADRFIVHARKAWLNGLNPKENRSIPPLQYERVQNLKNNRPELIIELNGGINTIN
FT                   DSIEALKVFDGAMVGRAAYSHPFLWTKIDSLIFGQKEKYLSRSKIIKKLIPFAQKHLEN
FT                   GGRLWQISRHILNLIENIPNAKILRQELSEKCQTQKADISILKKIAQQLEDAGQ"
FT   gene            18172..18639
FT                   /locus_tag="PMN2A_1342"
FT   CDS_pept        18172..18639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1342"
FT                   /product="methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.11"
FT                   /note="Alternative locus ID: NATL2_00141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1342"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58831"
FT                   /db_xref="GOA:Q46I47"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I47"
FT                   /protein_id="AAZ58831.1"
FT                   /translation="MFGLLNTLFGFTIKPKSAFASSKSMENYKTLTDTDWENRLPKDAF
FT                   YVLRKEGTERPFSSPLNDEKRKGVFRCAGCGLALFSSTTKFDSGTGWPSFFDHLPDAIE
FT                   TKTDFKLIVPRTEYHCRRCGGHQGHVFNDGPRPTGKRYCNNGVALAFEVDS"
FT   gene            18734..19513
FT                   /locus_tag="PMN2A_1343"
FT   CDS_pept        18734..19513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1343"
FT                   /product="molecular chaperone GrpE, heat shock protein"
FT                   /note="Alternative locus ID: NATL2_00151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1343"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58832"
FT                   /db_xref="GOA:Q46I46"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I46"
FT                   /protein_id="AAZ58832.1"
FT                   /translation="MNSDVSSSEHELSQDGSSQNNPSENSVSSPNSNESVNQVELSDNP
FT                   EVEPQVKNDSVDTANEQSSTSCESNIKGSDTEARLQQLEKEHETLNSQYMRIAADFDNF
FT                   RKRQTRDQDDLKIQLTCTTLSEILPIVDNFERARQQLNPEGEEAQALHRSYQGLYKQLV
FT                   EVLKNLGVAPMRVVDQAFDPSLHEAVMREPSDEKAEDIVIEELQRGYHLNGRVLRHALV
FT                   KVSMGPGPKVINEEIPDQSASNQELSESVDGSTKDEN"
FT   gene            19558..20688
FT                   /locus_tag="PMN2A_1344"
FT   CDS_pept        19558..20688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1344"
FT                   /product="Heat shock protein DnaJ"
FT                   /note="Alternative locus ID: NATL2_00161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1344"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58833"
FT                   /db_xref="GOA:Q46I45"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I45"
FT                   /protein_id="AAZ58833.1"
FT                   /translation="MADFYDLLGVSRDADADTLKRAYRQQARKYHPDVNKEAGAEDKFK
FT                   EIGKAYEVLSDSQKRARYDQFGEAGIGGAAGMPDMGDMGGFADLFDTFFNGFGGASSAG
FT                   GSRPQRRGPQQGDDLRYDLTIDFDKAIFGQEKEITVPHLETCDVCRGTGAKKGTGPVTC
FT                   STCSGAGQVRRATRTPFGSFTQVAECPTCGGTGQVIKDPCNACGGKGVKQVRKKLKINI
FT                   PAGVDSGTRLRVSGEGNAGLKGGPSGDLYVFLKVKNHPNLKRDGLIILSEVNISYLQAI
FT                   LGDTIEIETVDGPTKLQIPAGTQPNSILNLENKGVPKLGNPVARGNHQVSVKIKLPTKL
FT                   SDSERNLLEELAGHYSARGPQHHYHKSGLFSKLFGK"
FT   gene            20691..20930
FT                   /locus_tag="PMN2A_1345"
FT   CDS_pept        20691..20930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1345"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1345"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58834"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I44"
FT                   /protein_id="AAZ58834.1"
FT                   /translation="MEKNIFIDHYLNLSGLACPVNFVKCCLVLENLSSNQVLKVDLDIG
FT                   EAETSVIDGLQEKGYKVKILNKDSKIVTLIVSSE"
FT   gene            20923..21861
FT                   /locus_tag="PMN2A_1346"
FT   CDS_pept        20923..21861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1346"
FT                   /product="GTPase EngC"
FT                   /note="Alternative locus ID: NATL2_00181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1346"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58835"
FT                   /db_xref="GOA:Q46I43"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I43"
FT                   /protein_id="AAZ58835.1"
FT                   /translation="MNKNKSNKLKGIVVALKANFLIVEIDHKNFKDHSFDQFYGKIRLL
FT                   CIRRSKLNYQGLFIDVGDIVCVESIDYKNKRAVVSDVEPRQSFLKRPAVANVTLVSICI
FT                   SADEPLFDMEQTSRFLLTAECANIEPLIILTKIDLITKNDLILYINKFKSWGYDCIPVS
FT                   IHNSQGIDSLIERLRKTKLTVLAGPSGVGKTSLINHLIPTVSLPTSSVSKKLKRGTHTT
FT                   RHVELFAIGNGSLLADTPGFNRPEIVCEPSDFAFLFPEFRTQLSNSQCKFRNCLHRDEP
FT                   GCVIDKDLERYPFYRQNLEEMINSPLPYQAG"
FT   gene            complement(21830..22177)
FT                   /locus_tag="PMN2A_1347"
FT   CDS_pept        complement(21830..22177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1347"
FT                   /product="Conserved hypothetical protein 103"
FT                   /note="Alternative locus ID: NATL2_00191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1347"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58836"
FT                   /db_xref="GOA:Q46I42"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I42"
FT                   /protein_id="AAZ58836.1"
FT                   /translation="MAGFGLPNFGQLTEAFKKAQQIQQNAQKLQEELEVMEIEGTNDDN
FT                   RAKIWMSGNQKPLRVEIDPSLLSEGKAIIEEAILDAMKSAHEVSTSTMKERMEDLTGGF
FT                   KLNLPGMGEEN"
FT   gene            complement(22215..23090)
FT                   /locus_tag="PMN2A_1348"
FT   CDS_pept        complement(22215..23090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1348"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="Alternative locus ID: NATL2_00201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1348"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58837"
FT                   /db_xref="GOA:Q46I41"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I41"
FT                   /protein_id="AAZ58837.1"
FT                   /translation="MNSIKLEKNISLSNFTTWGIGGPAEWIAQPKNIEELKYVINWTNK
FT                   KKIPCSVIGAGSNLLINDKGIKGLSLCMRNFKGIEIDKNNGIIEVLSGEMLPTLARKAA
FT                   ASGLHGFEWAVGIPGTIGGAVVMNAGAQEHCISSYLESITTLSLTGEYQRIKGKDLNFG
FT                   YRQSLLQNEKLIVVSARLKLASGHAKEIRQVTNENLNHRLKTQPYQAQTCGSVFRNPEP
FT                   LKAAKLIEELGLKGFRFGGAEISKIHSNFIINANQASSNDVRELIKYVKKRVFDSYGIL
FT                   LETEVKQCGF"
FT   gene            complement(23094..24578)
FT                   /locus_tag="PMN2A_1349"
FT   CDS_pept        complement(23094..24578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1349"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Alternative locus ID: NATL2_00211"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58838"
FT                   /db_xref="GOA:Q46I40"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I40"
FT                   /protein_id="AAZ58838.1"
FT                   /translation="MKSYLSNDTEAKLKKTKDLPPHIHFIGIGGIGMSALAMILAQKGY
FT                   SISGSDQKKNLTLKKLEENKVHIFPTQVESNIDEILKVHGKNILVVKSSAIHQDNFELC
FT                   KAKKYNLKIKHRSEILAFLIEQKKSIIVSGSHGKTTTSTYITTLFSYANKSPTAIIGGI
FT                   VPLYKSNYSCGNSEFLIAEADESDGSLVKFNPNIGLITNLELEHVDHYLDLEDLIETMK
FT                   QFAQKCECLITNFDCDNLRDNIHGSKWFSIQKIINIDFALIPKESNGCEIIAEYYEKEK
FT                   FIDVIKIPVPGIHNLSNAAAAIAACRVAGILFKDIKKGIEKLKLPSRRFEFKGLWRNRL
FT                   IVEDYAHHPSEIDAAISIASTIIETKHKLSKILPRRIVTIFQPHRYSRTKKFQKEFAKS
FT                   LSKSDLVFITPIYSAGEDKIEGINNKSIGHELKKINPNLEIYTPDNNQNLIKLIKEQTI
FT                   ENDLILIMGAGDINLISENLFLELINNKLISNDIAA"
FT   gene            24728..25750
FT                   /locus_tag="PMN2A_1350"
FT   CDS_pept        24728..25750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1350"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.13"
FT                   /note="Alternative locus ID: NATL2_00221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1350"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58839"
FT                   /db_xref="GOA:Q46I39"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I39"
FT                   /protein_id="AAZ58839.1"
FT                   /translation="MTLRVAINGFGRIGRNFMRCWLSRGANTNIEVVGINVTSDPKTCA
FT                   HLLKYDSILGAIKDAEISHTDDTFQINGKTIKCYSDRNPLNLPWKEWGIDLVIESTGVF
FT                   NTDVGASKHLQVGAKKVILTAPGKGDGVGTYVVGVNADSYSHEDFDILSNASCTTNCLA
FT                   PIVKVLDQKLGINKGLMTTIHSYTGDQRILDNAHRDLRRARAAAMNLVPTSTGAAKAVA
FT                   LVYPQMKGKLTGIAMRVPTPNVSAVDLVFESGRKTSAEEVNSLLKTASQGEMKGIIKYG
FT                   DLPLVSTDYAGTNESTIVDEALTMCIDDNMVKVLAWYDNEWGYSQRVVDLAEIVAQKWK
FT                   "
FT   gene            complement(25766..26749)
FT                   /locus_tag="PMN2A_1351"
FT   CDS_pept        complement(25766..26749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1351"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="Alternative locus ID: NATL2_00231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1351"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58840"
FT                   /db_xref="GOA:Q46I38"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I38"
FT                   /protein_id="AAZ58840.1"
FT                   /translation="MTTTIKDLGEIELLNRLKKYMSCGQIDDDVAEINTKNKSLLINTD
FT                   LLVEKIHFSDEISNAKDIGWKCITTNISDLICSGSENITSFTVGLVLPPNTHWKWVENL
FT                   YEGMLEAMQEFGGEIIGGDCSSGETKMISITAIGEMNLPRLHRGNALPGDYIVSTGFHG
FT                   LSRLGLALLTSQKLPSEAQLSPELINRAINAHKRPYPALEALKALIACKPESISWRAAG
FT                   TDSSDGLIESIRGICQASNCQAVLSKTSILKDTDWPKDDIWDEWLLNGGEDYELILSLP
FT                   KEWAKSLSNKLKSAKIIGFIKEGKPNIFWDNLEKTKIGQSSLFRHF"
FT   gene            complement(26762..27838)
FT                   /locus_tag="PMN2A_1352"
FT   CDS_pept        complement(26762..27838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1352"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="Alternative locus ID: NATL2_00241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1352"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58841"
FT                   /db_xref="GOA:Q46I37"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I37"
FT                   /protein_id="AAZ58841.1"
FT                   /translation="MAKKICILALITILFSLGSPWVNPAFASLPNGNRLKDPYAILRNS
FT                   LPIEQKELRELQNKLEDTSQDLRGSRWSAISKATSRSQFLVSNKKNQILDSMPAENKEN
FT                   ASKLISNLKEELDELGQIANEKNKVSFLDVRRQSLKTIDEIESLLITKDFPYQIPSEYN
FT                   NLPRLLGRANVEIKTSKGSMNAIIDGYNAPLTAGAFIDLSMKGFYDGLPINRAEEFFIL
FT                   QTGDPKGETIGYIDPDNNELRRVPLEIRTSSLEDTLYGETFEDVGLYTETPVLPFATLG
FT                   TLGWAHSDTDLNDGSSQFFFFLYEAELNPAGRNLIDGRNAAFGYVIEGAEILNKLGVDD
FT                   KIISITVLNGSENLKLKA"
FT   sig_peptide     complement(27755..27838)
FT                   /locus_tag="PMN2A_1352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            27902..28465
FT                   /locus_tag="PMN2A_1353"
FT   CDS_pept        27902..28465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1353"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="Alternative locus ID: NATL2_00251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1353"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58842"
FT                   /db_xref="GOA:Q46I36"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I36"
FT                   /protein_id="AAZ58842.1"
FT                   /translation="MISSNDFRTGTTIELDGAVWRVIEFLHVKPGKGSAFVRTKLKAVV
FT                   SGNVVEKTFRAGEMVPQALLEKSKLQHTYMDGDDFVFMDMTSYEETRLTAKQIGESRKY
FT                   LKEGMEVNVVSWNEKPLEVELPNSVVLEIKETDPGVKGDTASGGTKPAILETGAQVMVP
FT                   LFISIGEKIRVDTRNDSYLGRETQ"
FT   gene            28462..28959
FT                   /locus_tag="PMN2A_1354"
FT   CDS_pept        28462..28959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1354"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="Alternative locus ID: NATL2_00261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1354"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58843"
FT                   /db_xref="GOA:Q46I35"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I35"
FT                   /protein_id="AAZ58843.1"
FT                   /translation="MTMNLDHEELHRLLATLAESDIQEFRLEGEDFCLEVKRNLETSSD
FT                   SIASNKKITSDDIESPPPQSKIDTLPVPSTPPPSVPGSRSDLVEVTAPMVGTFYRAPGP
FT                   EEPPFVEIGSRINVGQAVCILEAMKLMNELESEVSGEVIEILVENGTPVEFGQVLMRLK
FT                   PV"
FT   gene            complement(28970..29995)
FT                   /locus_tag="PMN2A_1355"
FT   CDS_pept        complement(28970..29995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1355"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="Alternative locus ID: NATL2_00271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1355"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58844"
FT                   /db_xref="GOA:Q46I34"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I34"
FT                   /protein_id="AAZ58844.1"
FT                   /translation="MQKSQLTKENRTTLIISLGDPAGIGTEITLKALGSKSLNKNIKPL
FT                   LVGCKNNIHETYSKLIKYGIDNIPDPNKLHIIDIPLENKVIPGIVDEYTGSASFKWLVN
FT                   ATNILLKGKANALVTAPISKIAWHKAGHKFAGQTELLGKLTNKKTSMLFTAISPNNGWR
FT                   FNTLLATTHIPLNKINDTLTKELIRHKLDTLLNFCRKFKEKPSIQIAGLNPHAGEEGKI
FT                   GMEEQNLIIPILDEWKLDNPDIKIIGPIPPDTCWISSVNAWNGASIKNNAPDGILALYH
FT                   DQGLIPVKLIAFDEAVNTTLGLPFARTSPDHGTALDIAGMFKAREKSMVAALNNAWLLS
FT                   Q"
FT   gene            complement(30181..31077)
FT                   /locus_tag="PMN2A_1356"
FT   CDS_pept        complement(30181..31077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1356"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /note="Alternative locus ID: NATL2_00281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1356"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58845"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I33"
FT                   /protein_id="AAZ58845.1"
FT                   /translation="MIQEIVKRSRPLPPKSKLIIFGGGFSGQRIASVGRHLGVKVLCSR
FT                   RREGSKGADFIFNTDQELSNEILEGATHILSCIPPLLSGEDPVLLKLKTQLLNSKKIKW
FT                   VGYLSTTGVYGDSKGNWVNENTPPNPQQDRSIRRLSCEKQWLDTKLPIQILRLPGIYGP
FT                   GRSVFESLLNGTTKMIDKPGQVFSRIHVDDIAGSVLFLINLYFQGKTPSIVNVADNLPA
FT                   NNLDVINFAAKIAKKSLPSRVPFEIAQKTMSPMAISFWQENRKVDNKLLCKKLGYSLIY
FT                   PDFKSGLKNCFLQLKIN"
FT   gene            31086..31334
FT                   /locus_tag="PMN2A_1357"
FT   CDS_pept        31086..31334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1357"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1357"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58846"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I32"
FT                   /protein_id="AAZ58846.1"
FT                   /translation="MYYVDYLAMVASYFKPSLNSINGARKLRKDKKISLQEKNQNLIKP
FT                   LLASICFLFCIILVPEKSSNLASICEKYNSSVACQVW"
FT   gene            complement(31338..31748)
FT                   /locus_tag="PMN2A_1358"
FT   CDS_pept        complement(31338..31748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1358"
FT                   /product="HNH nuclease"
FT                   /note="Alternative locus ID: NATL2_00301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1358"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58847"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I31"
FT                   /protein_id="AAZ58847.1"
FT                   /translation="MHNRDAVFLEDLCPKLRNRRWRKSLHEFTGNSCIYCGKTSESIDH
FT                   VLPRSRGGLSITENCVPACLSCNGSKTDNDAFEWYRKQRFYDPRRSMAIKAWTEGDILL
FT                   ALRLLKWAQPKPIESFKKSKSKFNVDYHWQAA"
FT   gene            complement(31900..32322)
FT                   /locus_tag="PMN2A_1359"
FT   CDS_pept        complement(31900..32322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1359"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1359"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58848"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I30"
FT                   /protein_id="AAZ58848.1"
FT                   /translation="MSFGIKRNLLPISIICLVCGSTLGLRINAAVTNGADIYCFMRNGG
FT                   NTHEPSWEAAYQFIKNKKQGLFKTSPKQAASLIVEEVVQNPTKYEDCINYLGDLYTGES
FT                   SSIGGNNDKDLTSEVTSSSHSAEKTPKGKYVDRYSY"
FT   sig_peptide     complement(32233..32322)
FT                   /locus_tag="PMN2A_1359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.876 at
FT                   residue 30"
FT   gene            32520..32726
FT                   /locus_tag="PMN2A_1360"
FT   CDS_pept        32520..32726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1360"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1360"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58849"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I29"
FT                   /protein_id="AAZ58849.1"
FT                   /translation="MFTKIIMNTVQVKKQAFLKEACFFFKNASVYAEEGDLQSCAGLIL
FT                   KALDKERRAGGVGPQVLHLIKTI"
FT   gene            complement(32750..33904)
FT                   /locus_tag="PMN2A_1361"
FT   CDS_pept        complement(32750..33904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1361"
FT                   /product="serine-pyruvate/aspartate aminotransferase
FT                   related enzyme"
FT                   /note="Alternative locus ID: NATL2_00331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1361"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58850"
FT                   /db_xref="GOA:Q46I28"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I28"
FT                   /protein_id="AAZ58850.1"
FT                   /translation="MQDKLNLMIPGPTPVPENVLSSMSKHPIGHRSGDFQKIVQKTTEQ
FT                   LKWLHQTTADVLTITGSGTAAMEAGIINTLSKGDQVICGDNGKFGERWVKVARAYGLDV
FT                   KVVKADWGTPLDPNQFKRILEEDTNEKIKAVILTHSETSTGVINDLKSINNEVKNHSKA
FT                   ITIADCVTSLGACNIPMDEWGIDVIASGSQKGYMIPPGLSFVAMSKRAWEANNQSNLPK
FT                   FYLDLKQYLKTVNQNSNPFTPAINLYFALEASLTMMQKEGLNNIFARHARHQKATQEGI
FT                   KAMGLNLFTKENFGSPAITAVKPENIDAESIRKAIKNDFDILLAGGQDHLKGKIFRIGH
FT                   LGFVNNRDIISVISALESTLDKMGKLNVPTGQGIAKTISVLNNE"
FT   gene            33984..35129
FT                   /locus_tag="PMN2A_1362"
FT   CDS_pept        33984..35129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1362"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_00341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58851"
FT                   /db_xref="GOA:Q46I27"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I27"
FT                   /protein_id="AAZ58851.1"
FT                   /translation="MNQFTLPVWVVAAAKSATNILIGNKFRDKERIDLPNNEKSISVPI
FT                   SSSALLDNGKRSLAVSHCQSGLPLDITRGVEIWAYIQLSKGGFQSKGKVRNGFPDWLDF
FT                   HAGYGVGKFQSSGQPCISQFARDLLCINLYPLLPKGSSIKVEIILPEGKDRASKTSNEA
FT                   FGVVDGLSLIGTQAEVQISASPDQLKNTKELLHHKCSEAKFDGCLTFVIGENGMDLAMK
FT                   YGLPANQIIKTGNWLGPLLVAAAENGVKKLLLFGYHGKLIKLSGGVFHTHHHLADGRIE
FT                   ILTSIAFREGISFDLIELISKSTSVENALLTLEVSNPEAVSLIWSRMAKEIEIKSRSYV
FT                   NRYLSSSMEIGSVLFDRKRQMRWAGLEGLKQINSLGLILKR"
FT   gene            35196..36782
FT                   /locus_tag="PMN2A_1363"
FT   CDS_pept        35196..36782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1363"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="Alternative locus ID: NATL2_00351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1363"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58852"
FT                   /db_xref="GOA:Q46I26"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I26"
FT                   /protein_id="AAZ58852.1"
FT                   /translation="MASMISAEKRNPAIVILDFGSQYSELIARRIRETEVYSLVMSYTT
FT                   SADQLRSLKPKGIILSGGPGSVYEEGAPYCDPEIFNLGIPVLGVCYGMQLMVHELGGSV
FT                   KPAAGKAEYGKAPLEVDDPTALLTNVISGSTMWMSHGDSVQKLPKGFVRLAHTSNTLEA
FT                   AIALHDKSFYGVQFHPEVVHSTHGMVVIRNFVYDICSCEPDWTTNLFIDEAVSQVQQHV
FT                   GDKKVLLALSGGVDSSTLAFLLNKAIGPQLTCMFIDQGFMRKGEPEFLMSFFDEKFKIN
FT                   VEYINARERFISQLKGVTDPEQKRKIIGREFIRVFEEESLRLGPFDYLAQGTLYPDVIE
FT                   SSGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGKSLGLPDE
FT                   IVRRHPFPGPGLAIRILGEVTHEKLNCLRDADLIVREEINNAGLYNKIWQAFAVLLPVY
FT                   SVGVMGDQRTYAWPIVVRCVSSEDGMTADWSRLPYAVLEKISNRIVNEVEGVNRVVLDI
FT                   TSKPPGTIEWE"
FT   gene            complement(37169..38911)
FT                   /locus_tag="PMN2A_1364"
FT   CDS_pept        complement(37169..38911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1364"
FT                   /product="SAM (and some other nucleotide) binding motif:TPR
FT                   repeat"
FT                   /note="Alternative locus ID: NATL2_00361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1364"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58853"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I25"
FT                   /protein_id="AAZ58853.1"
FT                   /translation="MDRPNPKEERKKKVYEVITFPVPFTLEVIKENITINTNTASKPFK
FT                   EQRIHKAFDSYLKAIQTNPTNSKNYILITRLLRDSDLSHLSKSNLKNILNILLERNDVP
FT                   HKELANVFNFLYSGEIISILQKLDSDFSKIKLLLNDKVIINAFKKIIFCNLELEKLLTK
FT                   VRRNMCDYISRNIETINYLELQFITALGEQCFLNDYVYSSTEEENMCLNTIIERCRDGQ
FT                   LSEINISILSCYFPLYKLLDQIPSLKFINSSNKSFKELIELQIKEPIQEIELSNDIKKL
FT                   GTINDNISQKVKVQYEENPFPRWRYANYSKSLKISFTSQINNDIKPNYINQTLQDGQLK
FT                   VLIAGCGTGKQILEAQKYENSKITAIDISLSSISYAKRKMNELGINNVELIQMDILKVN
FT                   LLEEEFDIILCSGVLHHMDNPSEGLRMLFKVLKNNGFLKLGLYSELGRKDIVKARNYFI
FT                   NKKIQSNEENIRNFRQEVIGSKLNYLNSLKTISDFYSLSEFRDLCVHTQEHRFTINQLQ
FT                   ETLTSNKLNFLGFLLPKPIKSKYEDYFPEDRKQTNLQNWAKFEEKHPTTFLSMYQFWVS
FT                   KTEN"
FT   gene            39261..40111
FT                   /pseudo
FT                   /locus_tag="PMN2A_1365"
FT   gene            complement(40568..41776)
FT                   /locus_tag="PMN2A_1366"
FT   CDS_pept        complement(40568..41776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1366"
FT                   /product="TPR repeat"
FT                   /note="Alternative locus ID: NATL2_00381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58854"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I24"
FT                   /protein_id="AAZ58854.1"
FT                   /translation="MDGSSQEGEKKKKVYEVKTFPISFALGENQENITITTQTPSKPSK
FT                   EKKFHKARMLHKQGKIAEAKKYYQQLINEGFNDHRVFSNYGVILAQLGKLKEAEISTRK
FT                   AIEMQPNYAEAHSNLGIILNDLGKLEEAEICQRKAIKIKPNLTGAAWNLYGLANTIKEA
FT                   EERVNQVLKIDENHVEAQLHLSALKLHQGDQSLFDNLTKSTHKDHAITRSIKWVANLPK
FT                   LPELFFYRWALFDSMTKKSKKDRPFYEFGVWRGASFRYLINTFKKGYGFDTFEGLPEDW
FT                   HHEAQGTYSAEGIIPNIEGGEFIAGKFEDTLPTFYSKPRPMASIINFDADLYSSTLCAL
FT                   NCSKPVIDKDTILIFDEFIISENWEQDEYKALNEFCSKNNLTYEVLAVSYFEKQVAVKL
FT                   IGV"
FT   gene            complement(42062..42239)
FT                   /pseudo
FT                   /locus_tag="PMN2A_1896"
FT                   /note="frameshift; similar to NATL1_00451"
FT   gene            42305..43033
FT                   /locus_tag="PMN2A_1367"
FT   CDS_pept        42305..43033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1367"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1367"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58855"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I23"
FT                   /protein_id="AAZ58855.1"
FT                   /translation="MSFEVTYNGDIQYIKVFYSTEKTRAGKYYGEFYKKMDALASDLKR
FT                   LKQELDEDCEKAAKIAKDAANKALSERFGSLRYIIDEHLWDQDIVISKILDDRKEEMLA
FT                   LAQKTFNNEVLLEEDGAEEYKIHLDEGGIEVDGKSVETSIMEFFDSDDYHESNEAKLEK
FT                   LEKLDWFIIWSRTEAGEFRTEGGQHEGNYSSKELNMEDCLLTYRDLPLVNPSNGTDIFS
FT                   NELEIHFVDETRASLEISES"
FT   gene            43387..44181
FT                   /locus_tag="PMN2A_1368"
FT   CDS_pept        43387..44181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1368"
FT                   /product="kef-type K+ transport system predicted
FT                   NAD-binding component"
FT                   /note="Alternative locus ID: NATL2_00401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1368"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58856"
FT                   /db_xref="GOA:Q46I22"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I22"
FT                   /protein_id="AAZ58856.1"
FT                   /translation="MNELRLRIYKQLKNDSPEGRTSVFNKICGVTIFISIFFAVMVTEN
FT                   SIDYQFGDQIDLLDWIIGGWFCVEYLCRLWVAPLEKKYGQGWKGVFRYVISPMSIIDVI
FT                   AIVPSFFGVRAELKILRIIRLLRILKIGRSEKFKQSIFHFNYALRSKSQELQISTFYTV
FT                   LLLLISSTFMYLAESSIQPGLLGSIPRCLWWSITTVSAVGYGDSIPVTALGKIIASITS
FT                   LMGIAAIAIPTGILASGFSESIGAQAKNQNVSNGIQGPSNTG"
FT   gene            complement(44444..44680)
FT                   /locus_tag="PMN2A_1369"
FT   CDS_pept        complement(44444..44680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1369"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58857"
FT                   /db_xref="GOA:Q46I21"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I21"
FT                   /protein_id="AAZ58857.1"
FT                   /translation="MTEENKTDKKKCSRKGKAMFAYGIIQLGSSVVSALALTAIALSFC
FT                   SLKQESKVFNECVEEIQATGKSSSDAVRFCNGG"
FT   sig_peptide     complement(44534..44680)
FT                   /locus_tag="PMN2A_1369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.734) with cleavage site probability 0.335 at
FT                   residue 49"
FT   gene            complement(45152..45469)
FT                   /locus_tag="PMN2A_1370"
FT   CDS_pept        complement(45152..45469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1370"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58858"
FT                   /db_xref="GOA:Q46I20"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I20"
FT                   /protein_id="AAZ58858.1"
FT                   /translation="MLRKQEKNAVTRGVILAIGWGWGLDRFYEGDKKGGILSIIGWGIV
FT                   FTSFLYLKCSGIEYVDGVKDYSSYSPNPLIVLPLIAGLYGIYLILRKGFRLAKQFENAE
FT                   E"
FT   gene            45778..46389
FT                   /locus_tag="PMN2A_1371"
FT   CDS_pept        45778..46389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1371"
FT                   /product="membrane protein"
FT                   /note="Alternative locus ID: NATL2_00431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1371"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58859"
FT                   /db_xref="GOA:Q46I19"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I19"
FT                   /protein_id="AAZ58859.1"
FT                   /translation="MTVAHQTDSHLSRRLQKDSITISGKVIYINPFLYWRRFDNNTDRW
FT                   LREPGQLTEEQINLNRARFYPEVEWTFLRDEERVIKDAAVEMFLKTLELISTFHPHLTA
FT                   GQLLEVERKMAVTKKKSFERWVEKSFRKKINQASKERNRFARERLIRGWKEWLTLETTH
FT                   QAFLPFAAIIVMSIFAGWSIGISNNSCTPYFPTTETGILK"
FT   gene            46406..46780
FT                   /locus_tag="PMN2A_1372"
FT   CDS_pept        46406..46780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1372"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1372"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58860"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I18"
FT                   /protein_id="AAZ58860.1"
FT                   /translation="MAKDQLRDFHLFAMESALPFGMGIIKNVKTGGFQKIMDVIKLKDP
FT                   FSEFQADGETSAKKVRDKIDQLIPGLGYPVVSVDVTVEENYPDYESNDNDSLVSTLNRI
FT                   DSDLDQLRRMISNDSLNIHD"
FT   gene            46803..48632
FT                   /locus_tag="PMN2A_1373"
FT   CDS_pept        46803..48632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1373"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="Alternative locus ID: NATL2_00451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1373"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58861"
FT                   /db_xref="GOA:Q46I17"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I17"
FT                   /protein_id="AAZ58861.1"
FT                   /translation="MKKKEKLHLSSKKHVGAFNQPLIFFLFICLIFSVTVGRLFWIQII
FT                   RGSYYKKLSEENRVKLIANPPIRGRLLDRNGVVLADNKLFYSLAIQPRLLTKSEWIDLR
FT                   NSLSDLLNVSTDQLEIAFNRSNYDTPYKKVLLTDLSVEQVIRFKEQENNLYGAQIDIGL
FT                   IRNYPYKSLAAHALGYTQLITQDEFSKLSDRGYKLSDRIGRKGIEAAFESQLRGAWGGE
FT                   MLEIDSIGTVQRSLGLKLPKAGRDIKLTLDLELQLTAEKVLSDKIAGAIVAIDPYTGAI
FT                   RAIASQPTFDLNFFSQPFTNKQYNDLFLSSNLPLLSRAFNAYDPGSTWKPITAIAGMES
FT                   GKFPANKKLNTVPCITYGSHCFPEYNKRGFGWIGYEDAFRVSSNTFFYQVGVGSGSKAL
FT                   YDAATKLGFDNYTGIETFIDENKGLVGNKKWAAEGRGWGNPGETPWIVEDMASASIGQS
FT                   VVLVTPLQLARAYAVFANGGYLITPHLVDANINWRSEKYLRKVDIEDKTLETIRRGLRK
FT                   VVTSGTGMGINLDHSILPPVAGKTGTAEDSSGGSDHAWFAGFAPYDSGEIVIVAFAQNT
FT                   PGGGSVHALPMAREVLRAWYEQKSKNELIRSKD"
FT   gene            complement(48641..49165)
FT                   /locus_tag="PMN2A_1374"
FT   CDS_pept        complement(48641..49165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1374"
FT                   /product="flavoprotein"
FT                   /note="Alternative locus ID: NATL2_00461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1374"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58862"
FT                   /db_xref="GOA:Q46I16"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I16"
FT                   /protein_id="AAZ58862.1"
FT                   /translation="MSNKKLLVIAASNGENLKLAKRFLVAGKELNYSCELLDLTDSKND
FT                   LPIFNPRNNSKDKAPENLKLINTEMESHSHWVICAPEYNGSIPPILTNAIAWLSVQGTD
FT                   FRSLFNERPIAIASFSGGGCMELLLSMRIQLTHLGALVLGRQLATNKSKVAEDKSINAI
FT                   LNQLLQLNHPN"
FT   gene            complement(49216..51066)
FT                   /locus_tag="PMN2A_1375"
FT   CDS_pept        complement(49216..51066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1375"
FT                   /product="flavodoxin:flavin reductase-like domain"
FT                   /note="Alternative locus ID: NATL2_00471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1375"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58863"
FT                   /db_xref="GOA:Q46I15"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I15"
FT                   /protein_id="AAZ58863.1"
FT                   /translation="MTIEQNSSTNLNTLIKKTIQIPIEDNFICLRSLNPKRTRFEVEYS
FT                   LEKGSCTNSFLFNSSQDEYSESHDYILIHPPGLTFEKEFLDEFETLISSDSSAIKLVMG
FT                   HINPNKVAFVKRMNVKYKNLTVICSNPGAKLFKEIWNLRKPSQNTNPKEALEKVEVLPN
FT                   IQIIKQLETHTLNSNFEVTFIPAPTARWPGGLIVFEKQTGLLMSDKLFGAHVYEEKWAE
FT                   LNSSSTEEERRHYFDCLMAPMSTQVNSIIEKFEDFEIDTIVPGHGPAISGSWRSLLNNY
FT                   QSWGESQKYSNLRVALLFASAYGNTAAIADAIARGISKTGVKVKIINCEFTASDSLVTE
FT                   IRKADGYLIGSPTLGGHAPTPIVSALGSLLAEGDRGKPAGVFGSYGWSGEALDLLEKKL
FT                   KDGGFKFGFEPIKIKFSPDPLMIKKLEETGIQFGKQLINAKLRQQRKANVGLNTSKSDP
FT                   TINALGRVVGSLCILTAQKGDEDNLISGAMVASWVSQASFSPPGITIAVAKERAVENLL
FT                   HTGDNFALNILEQNNHQSLLKQFLQSFKPGDNRFTDLEIKLSPSNQPLLNEALAWLEGT
FT                   VSQRMECGDHWLIYAEIKYGKVIKKDGVTAVHHRKTGANY"
FT   gene            complement(51069..52844)
FT                   /locus_tag="PMN2A_1376"
FT   CDS_pept        complement(51069..52844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1376"
FT                   /product="metallo-beta-lactamase superfamily:flavin
FT                   reductase-like domain"
FT                   /note="Alternative locus ID: NATL2_00481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1376"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58864"
FT                   /db_xref="GOA:Q46I14"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I14"
FT                   /protein_id="AAZ58864.1"
FT                   /translation="MIFTKSTALENQKSDIPKLSLQYEQIAIDTHTLRSLDWDRSRFDI
FT                   EFGLRNGTTYNSFLIRGKKTALIDTSHLKFKDIWFEKLRQEINPTEIDYLIVSHTEPDH
FT                   SGLIKYLIELNPNIEIVASKVAIKFLKDQIHQPFKSRAVKSGEEINLESTSISGIEHRI
FT                   EFISAPNLHWPDTIFSFDHGTQVLYTCDAFGLHYCSEKLYDENPSLLNEDFRFYYDCLM
FT                   GPNARSVVQALKKIDSLPTIQTIGVGHGPILNFNTQLWLNHYREWSTQRSTGENYAVVC
FT                   YLSQYGYCDRLSQAIAHGIGKANAQVQLVDLIASDTQELSALISEASAVVVPTWPIKTD
FT                   SELQSNIGTLLASLKQKQWVATYDSYGGNEEPIDFITNQLRKLGQKEAFKPLRVRDEPN
FT                   KSVYQQFEEAGTDLGQILTRKKNIAATKSLDGDLNKALGCLSGGLYVVTAKDNEGADSR
FT                   DGAMVASWVSQASFDPPGITVAVAKDRAIESLLQVNDRFVLNILQENNYLHLFRHFLKR
FT                   FPPGANRFEGVELMNDLAAGGPVLSDALAFLSCKVIQRMETTDHWIIYSSVEKGNLSNT
FT                   QSKTAVHHRRLGSNY"
FT   gene            53139..55799
FT                   /locus_tag="PMN2A_1377"
FT   CDS_pept        53139..55799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1377"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="Alternative locus ID: NATL2_00491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58865"
FT                   /db_xref="GOA:Q46I13"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I13"
FT                   /protein_id="AAZ58865.1"
FT                   /translation="MEKSSSSLIDPPSLSGDEIRDAFINFFVQHNHKKLASSSLIPDDP
FT                   TVLLTIAGMLPFKPIFLGLKESSTPRATSSQKCIRTNDIENVGRTARHHTFFEMLGNFS
FT                   FGDYFKKEAIQWAWELSTEVFRLNPQNIVISVFKEDLEAEQIWKEVVGVDANRIIRMGA
FT                   ADNFWSSGATGPCGPCSELYFDFKPELGSDEIDLEDDSRFIEFYNLVFMQYNRDLKGNL
FT                   EPLANCHIDTGMGLERMAQILQKKSNNYETDLIFPLINAAALLAQIKYETTNKKNKTSL
FT                   KIIGDHCRAVTHLICDGVSASNLGRGYILRRLIRRMIRHGRLVGIIQPFLPQLAEIAIE
FT                   LMKNAYPQLLEKKKIILNELKIEESRFLETLERGEKLLAEITSHECDLISGAQAFELYD
FT                   TYGFPLELTEEIANEKGISVDINGFENEMAKQRKRAKEASVSIDLTEEGSIEREISLFD
FT                   DTRFEGYEKLETTSTVIGIFKNNESVKQAVQGDLVKIIVNRTPFYAESGGQIGDKGLIT
FT                   SQDLEVSVENVRKKKNIFIHSGIVNTGVLEINSSVQMNVTPSFRQRTTSNHTATHLLQS
FT                   ALKLSIDSSVSQRGSLVSNHRLRFDFNAPKPLTIKELEDMEARINQWINEDHLIQIKTM
FT                   PIKEAMAAGALAMFGEKYGDVVRVVDVPGISMELCGGTHVTRTSQLGTFKIINETGIAS
FT                   GIRRIEAIAGPSVLDYFNERDLVVKELSKSFKVQSYEIVERVSSLQLELKDKTKELIKV
FT                   KNELALAKALGLATYAKSVGKSKLLIRRLDGVDGSGLQSAASSLIDHLGKYSAVIFGGI
FT                   PNQEIDNKLVFVAAFSPDLVSDGLHAGKFISGVAKMCGGGGGGRPNLAQAGGSQPQSLD
FT                   LALEKANENLTQQLS"
FT   gene            complement(55801..57744)
FT                   /locus_tag="PMN2A_1378"
FT   CDS_pept        complement(55801..57744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1378"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="Alternative locus ID: NATL2_00501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1378"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58866"
FT                   /db_xref="GOA:Q46I12"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I12"
FT                   /protein_id="AAZ58866.1"
FT                   /translation="MAVKITNQSLSWTIQNSSELYGIDRWGKGYFTINEKGNISICPNG
FT                   SNNKSHDLMELLDELESRKLKFPLLIRFDDILEDCLKNLHKAFEKAINDYQYQGKYQGV
FT                   FPIKCNQQRHVVEELITCGSKWNFGLEAGSKPELLIALSILEDPKALLICNGYKDQRYI
FT                   ETAILARQLGRQPIVVIEQANDVELIIKSSNLLGASPLIGIRAKLSSQSSGRWSSSIGD
FT                   KSKFGLSIPEILKAIKRLKEANLLNELKLLHFHLGSQINDIGVLKDALQEAGQIYAELI
FT                   NLGAPMGYLDVGGGLGIDYDGSQTASIASTNYSLQNYANDVVATIKECCESKKIPLPTL
FT                   ITESGRAIASHFSILIFNILGKNSLPSDIPKENEKECLSVRNLRETLVHINSLELKQEK
FT                   DLAKLQEAWNDSLKFKADALAAFRLGYIDLVERAKAEQLTWACAKTIVNQLPKNILLPK
FT                   ELKKLSESLAVTYYANLSVFRSAPDTWAIDQVFPIMPIHRLSKEPKKLGHFADLTCDSD
FT                   GKLDQFIDNGKIKNLLPLHEFNQNEKYLIGLFLGGAYQEVMGNLHNLFGSTNAVHIRFT
FT                   ENGNYKVEHVIRGNTKSNVLEYLEHDPEILLERLRKSSELAIQGGHLKIHDAQKLIEHV
FT                   EASLRQSTYLQS"
FT   gene            57887..58342
FT                   /locus_tag="PMN2A_1379"
FT   CDS_pept        57887..58342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1379"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="Alternative locus ID: NATL2_00511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1379"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58867"
FT                   /db_xref="GOA:Q46I11"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I11"
FT                   /protein_id="AAZ58867.1"
FT                   /translation="MTLERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKE
FT                   LAEKHYGVHKDRPFFSGLVDFITSGPVIAMVWEGEGVIASARKLIGATKPLEAEPGTIR
FT                   GDLAVNIGRNVIHGSDGSDTAVFEINLWFQENELVDWNPSDQAWRVE"
FT   gene            complement(58377..59480)
FT                   /locus_tag="PMN2A_1380"
FT   CDS_pept        complement(58377..59480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1380"
FT                   /product="glycine/D-amino acid oxidase family enzyme"
FT                   /note="Alternative locus ID: NATL2_00521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1380"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58868"
FT                   /db_xref="GOA:Q46I10"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I10"
FT                   /protein_id="AAZ58868.1"
FT                   /translation="MGVVNEKPLLILGGGLMGLAIAHELAKRGKQVEVLSRSRREAAGF
FT                   VAAGMLAPHAEGLQGNLLNLGQSSLQRHSTWIENIETNSKMSCGLKTCGIVVPFESHKD
FT                   CESYPTYKFGKKLNRNELLQEVPGLSEKWKLGLLFKQDGQIDNRRLLMRALEKACFELG
FT                   VHFQEGVEVVEIMKDLNKFNGVKIKDINGNINHLKSEEAVLCCGAWSKQIFKTLPIFPV
FT                   KGQMLSIQGPKQILKRIVFGPGIYLVPRDDGLIIVGATSEPEAGFQTGLTPNGQSELQK
FT                   GIQSLIPELNQLPHMERWWGFRPCTPDEGPLLGMSSINGLWLATGHHRNGVLLSAITSE
FT                   LIGKSICSTPLSNEEDSLLSHFRWDRF"
FT   sig_peptide     complement(59412..59480)
FT                   /locus_tag="PMN2A_1380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.867) with cleavage site probability 0.865 at
FT                   residue 23"
FT   gene            59580..61055
FT                   /locus_tag="PMN2A_1381"
FT   CDS_pept        59580..61055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1381"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="Alternative locus ID: NATL2_00531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1381"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58869"
FT                   /db_xref="GOA:Q46I09"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I09"
FT                   /protein_id="AAZ58869.1"
FT                   /translation="MSESNVSWEVVIGLETHVQLGTKSKIFTSASTTFGDDPNTHIDPV
FT                   VCGLPGTLPVLNKKVLEYAVKAAMALNLNIASHSKFDRKQYFYPDLPKNYQISQFDEPI
FT                   AEDGWIEVEVAEKGKETYVKKIGIERLHMEEDAGKLVHAGSDQLSGSTHSLVDYNRAGV
FT                   ALAEIVSKPDLRTGREAAEYAAEVRRIMRYLGVSDGNMQEGSLRCDVNISVRPTINDPF
FT                   GTKVEIKNMNSFSAIQKACEYEIKRQIKAYESGEEVKQETRLWDEGKQLTKSMRSKEGS
FT                   SDYRYFPDPDLGPIEVSNELKEKWRSELPELPAAKRNRYSTELGLSIYDARVLTDESSM
FT                   ATYFEKVVNEGGAAKSSANWITGDLAAYIKSNRLTFDQLHFQPSELAEMLKMIDTGEIS
FT                   GKIAKEILPELLSKGGSPKQLVQERGLGMIGDPKVIEEIIDQLILKHPNEVESFRSGKK
FT                   KLLGFFVGQLMKETKGKADPKLANQILNKKLQA"
FT   gene            complement(61052..61696)
FT                   /locus_tag="PMN2A_1382"
FT   CDS_pept        complement(61052..61696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1382"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="Alternative locus ID: NATL2_00541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1382"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58870"
FT                   /db_xref="GOA:Q46I08"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I08"
FT                   /protein_id="AAZ58870.1"
FT                   /translation="MIDQKQTNNLCLRWKGKQRRIGITGGIASGKTIIGDFLFQAKQWP
FT                   ILDADLYAHEALSAESEIVKKVWLRYGSKIIKNSSKNDQIINRKALAKIVFQNELEKKW
FT                   LEGIIHPFVNKRIEEELEKSKSNSIVILIIPLLFEKNYTGLCSEICYIDCPRSMQLKRL
FT                   QSRDNLSIKEANQRIDAQWANSLKKQFADHIINNSNDDETWKLQLKKLYKF"
FT   gene            61712..62974
FT                   /locus_tag="PMN2A_1383"
FT   CDS_pept        61712..62974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1383"
FT                   /product="N-acetylglutamate synthase / glutamate
FT                   N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="Alternative locus ID: NATL2_00551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1383"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58871"
FT                   /db_xref="GOA:Q46I07"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I07"
FT                   /protein_id="AAZ58871.1"
FT                   /translation="MKNALLNLSLLTSSVWSPISGGITAPDGFLAAGISAGLKPSGKKD
FT                   LALLYAPDGACCSGTFTQSVTRAYCVDLCIDRIKASEGKIRAVVINSGHANACTGSRGK
FT                   IDSEMITHKLAQLLRLSSEEVLICSTGVIGEAIPVEKVNSHLDQLINSLDKEAYLDAAN
FT                   AILTTDLQVKQIAYQAVLGGRRISIGGMAKGSGMIHPSMATMLSYLTCDVGVDHVLWSD
FT                   MIKRVAESSFNSITVDGDTSTNDTFLAFASGAELDPRYLSILEEGLHLTAQHLAKSIAR
FT                   DGEGANCLLEIKVEGASSDLDARAIARTIASSSLVKTAVHGSDPNWGRIIAALGRAGTS
FT                   FNLNDVKLWIGPYEIFSNGTPLDFDRQIVSNFMKARLTGKYLIDDLISIRLRIGIGTGS
FT                   ATAWGCDLSDQYVRINADYTT"
FT   sig_peptide     61712..61780
FT                   /locus_tag="PMN2A_1383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.762) with cleavage site probability 0.503 at
FT                   residue 23"
FT   gene            complement(63185..64642)
FT                   /locus_tag="PMN2A_1384"
FT   CDS_pept        complement(63185..64642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1384"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1384"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58872"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I06"
FT                   /protein_id="AAZ58872.1"
FT                   /translation="MTEAIYSSGALTTTTALGPFTKSVEVYGIKIAGLKEAGGNAAVGD
FT                   EFIRKVAQTTKLLLDPNGANVNSTKQQQAIEHLKKINTLQRIGVEEMDSYSPPLINKNY
FT                   SGWDSTNDKHNATDFIWQHNLPGDAIKTSNEQITEVLEHLLHTLVRFALPGAYPDQFIF
FT                   IEDRTAYQNFDEEDNEFQWSGLLYEAAQEAIKTGVFDATDYEHVGKNSFDYWKMVTVEY
FT                   QYALTFAEWGFNPKYSGSMDPEWSDSHLTPESIKKDNPLGHQLYEDYISKVLTKPSSEK
FT                   LESMFQINNQGLSGYQPDILTTKDYSGAFHEYTFINQGNNKYGIKLDSSSTIDSLTGLS
FT                   TVKFSDTSIDINKDVIGTFNQVTGLNTDSGEMFRLYNAAFARFPDADGLKYWIDQFSSG
FT                   KNTRRVVAQSFLGSAEFTEKYGSNVSDETYVNNLYKNVLGRDADAEGLNYWVGNLSSGI
FT                   ETRYEALLGFAESAENKALFTELTGFG"
FT   gene            complement(64723..66117)
FT                   /locus_tag="PMN2A_1385"
FT   CDS_pept        complement(64723..66117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1385"
FT                   /product="putative Poly(3-hydroxybutyrate) depolymerase"
FT                   /note="Alternative locus ID: NATL2_00571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58873"
FT                   /db_xref="GOA:Q46I05"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I05"
FT                   /protein_id="AAZ58873.1"
FT                   /translation="MEGFKIGELSTNSFVHKELSRKYLIYIPKSYEGKKEVPLLLNFHP
FT                   FGTSAEYQLGISDFRQLSEDKEFILVYPEGAELASGEPHWNPLKKDPTNKSNSDDINFI
FT                   NDLIDLISNNLNINSQKVYAVGYSNGADMAYGLATYLSSKISAIAAVSGSMYELMSTGD
FT                   QPSHSTSVLNMTGTSDSIRPYEGIDGSLLAVDEALSYWKEINAIKSSPIIISETSNSED
FT                   VIISSYTTDNQILTVANYKIINGGHNWFNLNISGKDTNNIIWDFFENTRTSLKYPISNN
FT                   SKSYSGAFNEYTFVNQGNNKYGIKLDSSSTIDSLTGLSTVKFSDTSIDINKDVIGTFNQ
FT                   VTGLNTDSGEMFRLYNAAFARFPDADGLKYWIDQFSSGKNTRRVVAQSFLGSAEFTEKY
FT                   GSNVSDETYVNNLYKNVLGRDADAEGLNYWVGNLSSGIETRYEALLGFAESAENKALFT
FT                   ELTGFN"
FT   gene            complement(66300..66575)
FT                   /locus_tag="PMN2A_1386"
FT   CDS_pept        complement(66300..66575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1386"
FT                   /product="enzyme of the cupin superfamily"
FT                   /note="Alternative locus ID: NATL2_00581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1386"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58874"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I04"
FT                   /protein_id="AAZ58874.1"
FT                   /translation="MSISVTSPCPESTFDELGIKNWPIWTCDASSFDWTYDDKETCLLL
FT                   EGEVTVTPNGGESVKFGAGDLVVFPAGIDCRWDVHKAVRKHYRFGD"
FT   gene            66749..66955
FT                   /locus_tag="PMN2A_1897"
FT   CDS_pept        66749..66955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1897"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1897"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23835"
FT                   /db_xref="UniProtKB/TrEMBL:A7MD97"
FT                   /protein_id="ABU23835.1"
FT                   /translation="MDSANQIQALVDEVEKNPEYKISEQEAKGFLSEIKRLTKEDKTNM
FT                   PPLVVIIMAYINMLFPELDEVKV"
FT   gene            67047..67379
FT                   /locus_tag="PMN2A_1387"
FT   CDS_pept        67047..67379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1387"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58875"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I03"
FT                   /protein_id="AAZ58875.1"
FT                   /translation="MPVLIIGLKIYDRLPEDEQKEFALVERYRTDYFYECYEYENAKGN
FT                   KNYEWSDRCFKNQEELLEFFGYEMIEDLNLDAVYARRVEMFTDEDEKELMKFCDDGNQI
FT                   KVMGAN"
FT   gene            67493..68083
FT                   /locus_tag="PMN2A_1388"
FT   CDS_pept        67493..68083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1388"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1388"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58876"
FT                   /db_xref="GOA:Q46I02"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I02"
FT                   /protein_id="AAZ58876.1"
FT                   /translation="MSLGITELELTDASTISIPTDAILILFLLIVFALIGYYFHNILDN
FT                   QTNQFVEKVDDSLHLELVKEKLEDQLTLESATVNHEKTEKPNIKKLNFIPPSKFWGIGS
FT                   LAVVAIGGSSLLRIQSIQNSYKGVNTSQVNIKTENQSTKSLLSMAQIKSSNQSQTKIKK
FT                   ISYVDPLLSTNNSSKNNNFLQVQRRRTEDFFSF"
FT   gene            complement(68786..70480)
FT                   /locus_tag="PMN2A_1389"
FT   CDS_pept        complement(68786..70480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1389"
FT                   /product="C-type lectin"
FT                   /note="Alternative locus ID: NATL2_00621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1389"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58877"
FT                   /db_xref="GOA:Q46I01"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="InterPro:IPR034007"
FT                   /db_xref="UniProtKB/TrEMBL:Q46I01"
FT                   /protein_id="AAZ58877.1"
FT                   /translation="MIFNSLIVQKVVKSWIIDGLVFEEDIVYGLGTPQSNKVFESSDTD
FT                   KVYTVADVKFELSNNSIIQSQNTEYISSDESIQDANRQIFLGTFGYDQNGLFNSGKISS
FT                   KSAWDWEKTTYQQTGLVKESEDMYGYLSNNAISIENAGTEIGWFTAQSLIGNPGGSIEH
FT                   LVANVKTTNGVYSEISTHKMEDFNQYRVSTYYEDNWYLNPISKSIINNPTIGADLTWNF
FT                   GSSRYHLFKTSKTWSEAQTAAESLGGKLVEVETKAENDQLFSKVSGQITTAEFANTSGS
FT                   DGGGAAYIWLGGSDGDTTSTQTSSEWNWKWSNSNVEISKSREEWGTGWGGTEPDDSQGF
FT                   QHRLALGLEDWSRSNPGKYGSAGQWNDVSADNKLFYVVEVPTTNKSYAFKSSDYTFYDL
FT                   GDDRYGIKTATGIDELTGVSSLSFADKDLSVLDDLKGTFDQVTGKDDVTGKTFRLYNAA
FT                   FARFPDASGLEYWIRQRSSGANSERVVAQSFLGSAEFIELYGEDVSHANYVNNLYKNVL
FT                   GREADTAGLNYWVGNLTNGIEERHEALLGFSESAENKGLFSEMTGLY"
FT   gene            71080..71235
FT                   /locus_tag="PMN2A_1898"
FT   CDS_pept        71080..71235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1898"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1898"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23836"
FT                   /db_xref="UniProtKB/TrEMBL:A7MD98"
FT                   /protein_id="ABU23836.1"
FT                   /translation="MSDSSSEMTPQEKIIQDRVNQSRSFLRLNGFNQSLGDLWKKIKED
FT                   SKYDLL"
FT   gene            71461..71904
FT                   /locus_tag="PMN2A_1390"
FT   CDS_pept        71461..71904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1390"
FT                   /product="cyanase"
FT                   /EC_number="4.2.1.104"
FT                   /note="Alternative locus ID: NATL2_00641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58878"
FT                   /db_xref="GOA:Q46I00"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46I00"
FT                   /protein_id="AAZ58878.1"
FT                   /translation="MSFPESTQLLLKAKKEKGLTFADIGILLGLDEVWVASLFYGQSTA
FT                   SDEEADKLLTTLGLGAELKEILTTPPVKGSLDPVIPTDPLIYRFYEIMQVYGMPMKDVI
FT                   QEKFGDGIMSAIDFTINVDKVEDPKGDRVKVAMCGKFLPYKKW"
FT   gene            72418..74097
FT                   /locus_tag="PMN2A_1391"
FT   CDS_pept        72418..74097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1391"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00651"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1391"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58879"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ9"
FT                   /protein_id="AAZ58879.1"
FT                   /translation="MSNSSIDFLLNNSNQRDYIKTIIENKLINYSLSANHSNIESNWFQ
FT                   KTFKHITNLSGIEFILTDQTSSDIHYTLEIVSENEWDKTDDLSKRIIGTDNKKFNYQTT
FT                   HKTDSYGGVRAQCEVTRVILKSLGLSFPNGDSLDENYTFNDSIMSGNLVGQLKAGRVIS
FT                   TTVNDQLAIQSILGTNKARLETEKYHNTKLNEDLLIGENGRKDYFILNRKGCYTGADAA
FT                   HTFEESSDGQGTIFKNFDYLNASVANFNPEEGDKIFLSRKLFSPYGDGYPTNEEIALTS
FT                   AWVNNDGKDVVIDLIQASEDLGPFETEDELHMNSSSNLIFNEAGKLILNVNGTEQYVGP
FT                   WGGAVPSYVNGHLAAFIDIQDTHYKKLPLNCFEIVDYDWKAISNSYDNNFYKLADNRFG
FT                   FGPTKDTVDEITGLSTIQFNDKSLHVTNDIKGTFDQVTGLNTDSGEMFRLYNAAFARFP
FT                   DADGLKYWIDQFSSGRNTRRVVAQSFLGSAEFTEKYGSNVSDETYVNNLYKNVLGRDAD
FT                   AEGLNYWVGNLSSGLETRYEALLGFAESAENKTLFSEMTGLV"
FT   gene            74542..74715
FT                   /locus_tag="PMN2A_1392"
FT   CDS_pept        74542..74715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1392"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00661"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1392"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58880"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ8"
FT                   /protein_id="AAZ58880.1"
FT                   /translation="MIYKIIRQDKESDDITVQSFSCYDEAYDLLEEIYSDVCCSDADYG
FT                   DRPYYEIIEVEE"
FT   gene            74874..75059
FT                   /locus_tag="PMN2A_1393"
FT   CDS_pept        74874..75059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1393"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00671"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1393"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58881"
FT                   /db_xref="GOA:Q46HZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ7"
FT                   /protein_id="AAZ58881.1"
FT                   /translation="MEYLSSPEGINKIIVGIILVGAINAIFITYSVRRTYGAAKKEREQ
FT                   QKIQQAKIDKLSPKKE"
FT   gene            75280..75444
FT                   /locus_tag="PMN2A_1899"
FT   CDS_pept        75280..75444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1899"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00681"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1899"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23837"
FT                   /db_xref="UniProtKB/TrEMBL:A7MD99"
FT                   /protein_id="ABU23837.1"
FT                   /translation="MKFIFLIVIVCGLTFPSFRITLAALLEASSDYLYESARREKSFIP
FT                   YWLMKVRND"
FT   gene            75868..76044
FT                   /locus_tag="PMN2A_1900"
FT   CDS_pept        75868..76044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1900"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00691"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1900"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23838"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA0"
FT                   /protein_id="ABU23838.1"
FT                   /translation="MSNISDIEELIADSMTGLMIRAERLNEFDQLAISEEFREWLNEGV
FT                   RVEDVLKLVTIKE"
FT   gene            complement(76066..76293)
FT                   /locus_tag="PMN2A_1901"
FT   CDS_pept        complement(76066..76293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1901"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00701"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1901"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23839"
FT                   /db_xref="GOA:A7MDA1"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA1"
FT                   /protein_id="ABU23839.1"
FT                   /translation="MSELIKMLVEFYILVIPFCVIPVFLVSLDYLNKSAELKRSSYNVI
FT                   DFDKFLKRKEEGDDVDIDIARLLDIDKIAA"
FT   gene            complement(76470..76616)
FT                   /locus_tag="PMN2A_1902"
FT   CDS_pept        complement(76470..76616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1902"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00711"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1902"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23840"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA2"
FT                   /protein_id="ABU23840.1"
FT                   /translation="MKNLDSSRIELTESQLLTIKDRIKSWSTKDQVIDIMRYRYGRLED
FT                   KAA"
FT   gene            complement(76871..77206)
FT                   /locus_tag="PMN2A_1394"
FT   CDS_pept        complement(76871..77206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1394"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00721"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1394"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58882"
FT                   /db_xref="GOA:Q46HZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ6"
FT                   /protein_id="AAZ58882.1"
FT                   /translation="MTPDLPIIPSSKIKNKKLEKTRIHKWTLFSLCFITTLVVVSLIKA
FT                   YLPLLVSAIAMLFVWSQMTKPIAEIETKSTNDDTNQLDLFHRQYKIGRKYSKIKRELNE
FT                   KEDSKVA"
FT   sig_peptide     complement(77069..77206)
FT                   /locus_tag="PMN2A_1394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.764) with cleavage site probability 0.386 at
FT                   residue 46"
FT   gene            complement(77823..78368)
FT                   /locus_tag="PMN2A_1395"
FT   CDS_pept        complement(77823..78368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00731"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1395"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58883"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ5"
FT                   /protein_id="AAZ58883.1"
FT                   /translation="MFDYSMQLKSLDGCRLAIGKYPSFRYNAYGGGGEAILLPNKKSNL
FT                   LHISFSSKTFSIPPLTSKTTKFLSLPLPPGFKIEMYMEQLEGTIDKNSGETVLKFESKF
FT                   LFSIGTILMFPKLIVKTLLTSGKVKGKFHEGEGHVLQGNGAIKLVGISIIPKTGNKILD
FT                   IFLGLPNEALAELKCEIK"
FT   gene            78618..78935
FT                   /locus_tag="PMN2A_1396"
FT   CDS_pept        78618..78935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1396"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00741"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1396"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58884"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ4"
FT                   /protein_id="AAZ58884.1"
FT                   /translation="MVLVTDSLTPDWSSEFEHYKKLSRDVVTNEDIINFFNKHQKAFYL
FT                   DNFSSSWAKMMEAYEVEESLSSDQLNKLEEMQWQEMPDSLKLFAYNFCIKNGFCFTGTS
FT                   N"
FT   gene            complement(79037..79249)
FT                   /locus_tag="PMN2A_1903"
FT   CDS_pept        complement(79037..79249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1903"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00751"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1903"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23841"
FT                   /db_xref="GOA:A7MDA3"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA3"
FT                   /protein_id="ABU23841.1"
FT                   /translation="MNINTVFLLLLVIAAYLNLYLTFNKKRQKKKTKLPISSQEWREKV
FT                   EDKNFKSWLSKRERLKDKRKEYIDH"
FT   gene            complement(79401..79715)
FT                   /locus_tag="PMN2A_1397"
FT   CDS_pept        complement(79401..79715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1397"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00761"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1397"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58885"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ3"
FT                   /protein_id="AAZ58885.1"
FT                   /translation="MHYLTKIYNASFKRLPDPDRLRYWISNFSSGKDDERAVASSFLAS
FT                   AEFKERYGEDVSNESYVNTLYINVLGRGPDEPSLIYWLCQLNTGSETRYEVLLGFSESS
FT                   "
FT   gene            80030..80425
FT                   /locus_tag="PMN2A_1398"
FT   CDS_pept        80030..80425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1398"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00771"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1398"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58886"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ2"
FT                   /protein_id="AAZ58886.1"
FT                   /translation="MKKIQKEHFIVIILGFLVIFLLQTPILQALEFDLTAAQNAVGKRF
FT                   ASKFCEAKEKGFSSESSSEFALNNTYLKFVAFPEDERFIEDLWEFTRAIIRTDCGQYVN
FT                   EEEEIILRDFFKEEGEIASNRDLYLPN"
FT   sig_peptide     80030..80119
FT                   /locus_tag="PMN2A_1398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.936 at
FT                   residue 30"
FT   gene            80425..81534
FT                   /locus_tag="PMN2A_1399"
FT   CDS_pept        80425..81534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1399"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00781"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1399"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58887"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ1"
FT                   /protein_id="AAZ58887.1"
FT                   /translation="MTNIYDYIVIGAGISACTFASTLNKKSSDISILLVEHGRRIGGRA
FT                   TTRKSRKNNILEFDHGLPSINFSKHISEDILELISPLINSKKLLDISNDTLLINEFGVL
FT                   SHGFTNDVIYRSTPFMANFCEEIINQSMNPKKINFLFQTLTKSIKRIQDLWEIEVNHGR
FT                   LIKSKNLILSSSLIAHPRCLNILKINSLPLRDAFIPGKDKLVDVLIRETKKLTYINRKI
FT                   YIFHVSNLSLSRKFNHQYLQIVFSNVIKEYSNFERIIFQRQSDGSIIIALHCIFINHLY
FT                   ELNNITKSLISLFANYQIFLDLFCEASLIDKMDWRASQPLNNLLSKEFQWSDSSKIGFC
FT                   GDWFDLNGCVGVEAAMNSSFRLVKLLNRN"
FT   gene            81686..81958
FT                   /locus_tag="PMN2A_1400"
FT   CDS_pept        81686..81958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1400"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00791"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1400"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58888"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HZ0"
FT                   /protein_id="AAZ58888.1"
FT                   /translation="MITVVFLLALGLAGWTVSTLMSKGKHQDDITKELGNIFESLKLLT
FT                   SSITALVKLLMKDSIASAKDEDFQPISSNVIDLLKVEKKDDKEVA"
FT   sig_peptide     81686..81754
FT                   /locus_tag="PMN2A_1400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.905) with cleavage site probability 0.822 at
FT                   residue 23"
FT   gene            complement(82021..82323)
FT                   /locus_tag="PMN2A_1401"
FT   CDS_pept        complement(82021..82323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1401"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00801"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1401"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58889"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY9"
FT                   /protein_id="AAZ58889.1"
FT                   /translation="MLTTTSRLRIQEILTRLSMGKKVTLEERIYINKYARNNQNVSSWL
FT                   RKASRIQRQTKITNQIDELLEGLDLSTDEPHVTYNPDHDDLGEWFSGAPSWIRRS"
FT   gene            complement(82575..82934)
FT                   /locus_tag="PMN2A_1402"
FT   CDS_pept        complement(82575..82934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1402"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00811"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1402"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58890"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY8"
FT                   /protein_id="AAZ58890.1"
FT                   /translation="MSPKNVLGTELKSCSCSPMTGWYRDGSCRTDISDQGMHTVCAVIT
FT                   EQFLSYSKAQGNDLSTPQIGFPGLKKGDHWCLCAPRWKEAFEDGMAPLIDLEATDESTL
FT                   KLIDMDVLKKFSHNR"
FT   gene            83006..84793
FT                   /locus_tag="PMN2A_1403"
FT   CDS_pept        83006..84793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1403"
FT                   /product="putative Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /note="Alternative locus ID: NATL2_00821"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58891"
FT                   /db_xref="GOA:Q46HY7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY7"
FT                   /protein_id="AAZ58891.1"
FT                   /translation="MTAPLIQGASGIEGEKLTYASTNENNKEIYTFTANEPVTWSISGG
FT                   EKGLFSIEQDTGKLSFQDVPDYETIKNLNGTTLEFHTNFSSQNVGAKFFVEVYNDQNQT
FT                   NQTTPITTNNFIEYIIDGSYKNTLIHRLVPDFVIQGGGYTWPTLASNESGGYPLRVKSK
FT                   GEIINEPFNSNLMGTIAMAKVSGQPDSATSEWFINLSDNKSLDSQNEGFSVFGHLLGDS
FT                   IENPLLLNSQSKYNVNYNEVGLNIPELPLNNVEGNVINNTNYFAIHSISTISQRPSEIK
FT                   NVFNVIVTANDTNGNQSNQYVIVNVKDIQGEVLNGIDGQDALNGGLGNDTFQGNGGNDT
FT                   IDGGNDFDIAIYTGNFSDYTFTIANKILTISDNRSLINDGIDTLTNIEKLTFADKNALI
FT                   TSKEIKPIDALGFQAERVYSGKSDSYKFYDLGSDNYGVGTSTGIDELTGESILKFDDKK
FT                   MNLKNDIKATFDQVTGLDTDSGKMFRLYNASFKRLPDPDGLRYWISNFSSGKDDERAVA
FT                   SSFLASAEFKERYGEDVSNESYVNTLYINVLGRDYDQSGYDYWLSNLNNGVETKYELLL
FT                   GFSESLENKGLFSEMTGFY"
FT   gene            85097..85222
FT                   /locus_tag="PMN2A_1404"
FT   CDS_pept        85097..85222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1404"
FT                   /product="possible high light inducible protein"
FT                   /note="Alternative locus ID: NATL2_00831"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58892"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY6"
FT                   /protein_id="AAZ58892.1"
FT                   /translation="MFLFIVMNSGAERFNGLMAMLGVVAGIGAYATTGQFIPGIF"
FT   sig_peptide     85097..85192
FT                   /locus_tag="PMN2A_1404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.785) with cleavage site probability 0.758 at
FT                   residue 32"
FT   gene            complement(85313..85483)
FT                   /locus_tag="PMN2A_1405"
FT   CDS_pept        complement(85313..85483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1405"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00841"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1405"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58893"
FT                   /db_xref="GOA:Q46HY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY5"
FT                   /protein_id="AAZ58893.1"
FT                   /translation="MSHLILGGLLSTPAPTAPIVGIAFIVLFAIVGVMVGPDYDGMNAP
FT                   ALDNSKKADPN"
FT   gene            85929..86174
FT                   /locus_tag="PMN2A_1406"
FT   CDS_pept        85929..86174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1406"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00851"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58894"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY4"
FT                   /protein_id="AAZ58894.1"
FT                   /translation="MCKHIILSSGLKYILNRLGLNHISHYLISMSNEERIEVAEQRIIE
FT                   LKTLINHWKTSNISSRRATVDFVDAILSDRDGTQAA"
FT   gene            86327..86866
FT                   /locus_tag="PMN2A_1407"
FT   CDS_pept        86327..86866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1407"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00861"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1407"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58895"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY3"
FT                   /protein_id="AAZ58895.1"
FT                   /translation="MIKKMNISRNLNLKEYIWNSIHKLTNSFSILTVNNLGNGYIKCIW
FT                   EISRIDNLRIELSNSCFCAIRLFDISNNRNKNNSTCIMKEIEISKFQSSITFPIPINKG
FT                   VYYVEFGYRKKDGEWRKLAYQKLNLGYRIKKLLQNFDNDSWFDSKITIRRNEVSLHEEA
FT                   YQLSLNSLIGGSENIS"
FT   gene            87482..88156
FT                   /locus_tag="PMN2A_1408"
FT   CDS_pept        87482..88156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1408"
FT                   /product="short-chain dehydrogenase/reductase family
FT                   enzyme"
FT                   /note="Alternative locus ID: NATL2_00871"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1408"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58896"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY2"
FT                   /protein_id="AAZ58896.1"
FT                   /translation="MFVLTTYLITGSNRGIGLELVRQLKDRGDDVIATCRSASPELNSL
FT                   SVRVETNIDITSGDSVVKLRDNLKDNSVDVLIQNAGIAEFNSLSNLDPQSIVHQFEVNA
FT                   LSPLCCVHTLLSKLSKSAKIALISSRMGSIEDNNSGGSYGYRMSKVALCMAGKSLSVDL
FT                   MPRGISVGILHPGLVSTRMTGFTSNGIQPKESVKGLIQRIDELTLENTGNFWHSNGEIL
FT                   PW"
FT   gene            complement(88233..88532)
FT                   /locus_tag="PMN2A_1409"
FT   CDS_pept        complement(88233..88532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1409"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00881"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1409"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58897"
FT                   /db_xref="GOA:Q46HY1"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY1"
FT                   /protein_id="AAZ58897.1"
FT                   /translation="MHINNMISKKMLINKILLNTKRNLFNVLSIFNKQKGELSDRCENL
FT                   TSIPGIGAKNCNNFYEAGYMTPESIISASDEELLTIPGVGISFVKKLRKTLGRI"
FT   gene            88751..89422
FT                   /locus_tag="PMN2A_1410"
FT   CDS_pept        88751..89422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1410"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00891"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1410"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58898"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HY0"
FT                   /protein_id="AAZ58898.1"
FT                   /translation="MFITVCGQKGGVAKTCTSIHLASVWSSEGKNVCLVDADRNRSALA
FT                   YGLRGNLKFNIVPVEAAAKATRFSEIVITDGQASTDEEELKHLAAGSDLVLLPTAPKAR
FT                   SVELTVELASLLKQLNIPHAVLLVKVDFRQRRIANEAREALEKFDLTVLEGDIPLLSAF
FT                   DKAENQGSAVIDAVDDKGRSDPRRMSGWSAYCSIAQQIQCQISKHLSDINKRVEDLPLS
FT                   A"
FT   gene            complement(89621..91456)
FT                   /locus_tag="PMN2A_1411"
FT   CDS_pept        complement(89621..91456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1411"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_00901"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58899"
FT                   /db_xref="GOA:Q46HX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX9"
FT                   /protein_id="AAZ58899.1"
FT                   /translation="MIGTSKTYHLLMRLLKALPVRRRSSLLKLIPLAAFTGLVDVIVVG
FT                   IVSRLFTVFIGQPNQPPLPFQHFIPEDPKTKVISLVVIYIAMNWLASFSKLFLKAAQER
FT                   LRVAVWKDLSELAQKKLLSQSYEFFLNKKKSDLSSKVLINISRVSEFLVKPILQISSGL
FT                   CVITFICIAVLFIAKSIALYLIISLLIFYIFISSFVTPFIRYSSRKRIKLEKETNNILT
FT                   ESMRTIIDVHLTSSEPYFEKRYKLASKSSFPFMWKAEVLPELPRSLIEPFGITLIFAIG
FT                   LFPYITGENDSILIEIVPFLATIAVAALKLTPPLQDSFRALTSMRASIPDLEEILKLIE
FT                   LPSTRLTKRSVGVPTKEGIEPRNNIKLEKLSYKYPNSNEYTLKGINLTIPIGSRIAFVG
FT                   ETGSGKTTTANQLLCLLRPTDGHLLLDGVAVTDTEVPAWQDCCSYVPQSITLLNSNIIQ
FT                   NIAYGLDENIIDHGRVWDALRAAQLADLVSEMPMGLHSSVGDNGIRLSGGQRQRLAIAR
FT                   AFYRQSKLLVLDEATSALDNRTEAEVMNAIEIIGRRCTIVTIAHRLSTIERSDCIYEFK
FT                   DGKIVSFGNYQQLLKQSKTFFNMVEIAKRTYGSNL"
FT   gene            complement(91647..92156)
FT                   /locus_tag="PMN2A_1412"
FT   CDS_pept        complement(91647..92156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1412"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00911"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1412"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58900"
FT                   /db_xref="GOA:Q46HX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX8"
FT                   /protein_id="AAZ58900.1"
FT                   /translation="MLRANFFKFFKYKKNSNHEIVQYNSNKNFSIQDQIKTNIIEIDQK
FT                   ILEISKSLVQAQIVKLRSTFSKSNNFLEQIGKNVYKTKVEDSINWHQKQLKELYFRRRE
FT                   LEIKLEKLKGIFWLNRIKRLLRIILIGFFIFLTLFIFLSGFMIIIYLMPLIILILLGYF
FT                   LSTKRY"
FT   gene            92204..93268
FT                   /locus_tag="PMN2A_1413"
FT   CDS_pept        92204..93268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1413"
FT                   /product="mannosyltransferase"
FT                   /note="Alternative locus ID: NATL2_00921"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1413"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58901"
FT                   /db_xref="GOA:Q46HX7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX7"
FT                   /protein_id="AAZ58901.1"
FT                   /translation="MTSIVFNGSYITKKNTGVGVVSKDLLYSLSANKITTLIPKDLDIK
FT                   GDIYIPNNLSPGTGLKSHFRRLYWLQNSVPKLMNNLNAEYFLSPLLEAPLFSNIKSIVL
FT                   AHDLIPIRYPSVSFLTLYYLIYIPLILKQSKLILCNSVSTANDLHRFYKVPMHKLFPIK
FT                   LGFNNKKYYPIKKIRKKFFLIIGRHNPHKNLRRVIKAFAYSKINDYKLIFVGPFDKRHT
FT                   PSLLKLIDKHNIRHLCVWKGWIDDDEKLSLLNECHALIIASLWEGFGLPALEAMACGTP
FT                   VIASDRGALREVMGNYGYFINPFNIQSIACAMNAVINDKKCFENALQEGPSRAESFNWL
FT                   DTARTIEKIIQEID"
FT   gene            93434..93637
FT                   /locus_tag="PMN2A_1904"
FT   CDS_pept        93434..93637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1904"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00931"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1904"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23842"
FT                   /db_xref="GOA:A7MDA4"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA4"
FT                   /protein_id="ABU23842.1"
FT                   /translation="MLSYLSNSIFNMPRQKSKKKLTSKTIQANEEKKTTPRTAKIVLFV
FT                   FGVGPLILMCLFLSSNGFFNSP"
FT   gene            93803..94120
FT                   /locus_tag="PMN2A_1414"
FT   CDS_pept        93803..94120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1414"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00941"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1414"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58902"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX6"
FT                   /protein_id="AAZ58902.1"
FT                   /translation="MQLYLVDCQFTDTDNQIAAYKQFVEFWENGEMSKQDKFDGFEMLF
FT                   RVHAPGEGRVVILCNANGDKELFQHFAPWRAQFGLDMEITPVISCQNVVDYHKDLFAKM
FT                   S"
FT   gene            complement(94198..94374)
FT                   /locus_tag="PMN2A_1905"
FT   CDS_pept        complement(94198..94374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1905"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00951"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1905"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23843"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA5"
FT                   /protein_id="ABU23843.1"
FT                   /translation="MHLSIFALASSEWGISRFTTDSFALIGLGVLISLPIQLLKDKVGF
FT                   KNIWTSGNALSKR"
FT   gene            complement(94539..94724)
FT                   /locus_tag="PMN2A_1906"
FT   CDS_pept        complement(94539..94724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1906"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00961"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1906"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23844"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA6"
FT                   /protein_id="ABU23844.1"
FT                   /translation="MGSGHPYYPIDPWSLEGLLFNCSCISSTINFFNTSIHNNKTRKNE
FT                   MDKEYKLSIHKSRNSN"
FT   gene            complement(94688..94917)
FT                   /locus_tag="PMN2A_R0028"
FT   tmRNA           complement(94688..94917)
FT                   /locus_tag="PMN2A_R0028"
FT   gene            95016..96140
FT                   /locus_tag="PMN2A_1415"
FT   CDS_pept        95016..96140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1415"
FT                   /product="putative RNA methylase family UPF0020"
FT                   /note="Alternative locus ID: NATL2_00971"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1415"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58903"
FT                   /db_xref="GOA:Q46HX5"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX5"
FT                   /protein_id="AAZ58903.1"
FT                   /translation="MKIVASISQGLEKEGAKELIELGAKSVKASRRHISFEADMACLYR
FT                   IHLRARLSFRFLREIVTFTCHGPNELYDGVQRLIDWENWLQPRQSFRVDVTGFGERLSH
FT                   THFTALQVKNAIIDLQRERWGSRSSIDLNNPDICFHLHLSNYQAVLSVAGSNSSLHKRG
FT                   YRPAVGMAPIKETLAAGLMRMTEWDGTKNLVDPLCGSGTFLIEAVSMLLGIASGIDRQF
FT                   LFKNWPDFDISFWDKELKMAKKIKPLNKKLSKIIGCEVDEMIAHSASENVRKAGLKDYI
FT                   EIINCPFQEFQLPPGLGFLICNPPYGKRIGDENELPNLYKQLGGYCKTQASGWDLWLLN
FT                   GNPKLSKYLGMKASRRFQVNNGSIDCRWLNYKIK"
FT   gene            complement(96142..96528)
FT                   /locus_tag="PMN2A_1416"
FT   CDS_pept        complement(96142..96528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1416"
FT                   /product="membrane protein"
FT                   /note="Alternative locus ID: NATL2_00981"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58904"
FT                   /db_xref="GOA:Q46HX4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX4"
FT                   /protein_id="AAZ58904.1"
FT                   /translation="MANSERKKGIGAAARVTALASSVMDLHVRIALQEMDREKRRLISG
FT                   VIFLATGGVLMLFALVGSELILGYWLRDLLEIDNKSTILILVFLNLVLAGMSLRIGGYL
FT                   AKGPYLPETLEGIAKTTKAVLGKN"
FT   gene            complement(96528..96983)
FT                   /locus_tag="PMN2A_1417"
FT   CDS_pept        complement(96528..96983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1417"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_00991"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1417"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58905"
FT                   /db_xref="GOA:Q46HX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX3"
FT                   /protein_id="AAZ58905.1"
FT                   /translation="MNSSPTSPSNTVEAEEAIAEKSPEQWFNDHFDNLLPKIQERWPDL
FT                   AKQTLEATKGSLEDLINVISLHSGKNSFGVQEQLEEIFHSATDTTRGLAESLEPLEKQL
FT                   EDILDELNSTLRPRIEKPVRKRPLLAIGIAAGIGVLFGILLGGGRRN"
FT   gene            97211..97348
FT                   /locus_tag="PMN2A_1418"
FT   CDS_pept        97211..97348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1418"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1418"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58906"
FT                   /db_xref="GOA:Q46HX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX2"
FT                   /protein_id="AAZ58906.1"
FT                   /translation="MGVGISSMVFASNTIPTDFGLVLAAIAGAGSLLLIALRFVPEAKS
FT                   "
FT   gene            97442..97831
FT                   /locus_tag="PMN2A_1419"
FT   CDS_pept        97442..97831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1419"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1419"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58907"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX1"
FT                   /protein_id="AAZ58907.1"
FT                   /translation="MSNLGEKKVYRWVLLKHIGSPDDIKGIHFDLLLEDKELCRTWRLT
FT                   DIPLLDGPYVDFVFIAPHNFYWLDMEEKVVSGNRGVATRIKKGIFLESLPPIENGFLNL
FT                   SLEWEGVESHLVMDEYGCRIFRKRY"
FT   gene            97962..101513
FT                   /locus_tag="PMN2A_1420"
FT   CDS_pept        97962..101513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1420"
FT                   /product="condensin subunit Smc"
FT                   /note="Alternative locus ID: NATL2_01021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1420"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58908"
FT                   /db_xref="GOA:Q46HX0"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HX0"
FT                   /protein_id="AAZ58908.1"
FT                   /translation="MSIPLEDGFTVVTGPNGSGKSNILDGVLFCLGLANSRGMRADRLP
FT                   DLVNSGVLKAGKSSETKVTVKFDLTDWKPDEAEEGIEPTEEGPWIKHDQKEWTVSRRLK
FT                   VMPGGSYASTYSADGETCNLQQLQTQLRRLRIDPEGSNVVMQGDVTRIVSMSNKDRRGL
FT                   IDELAGVALFDTRIDQTRAKLDDVYERQERCRIVEQELILSKQRLQKDCEKASLYKDLK
FT                   NQLLIGRQQELVLSYEKAKKGLEKLDIDHQELLKKEKIDSEKLLNHENDLSKCIEKLNI
FT                   LQKNVKELGEDQLLEVQGKLAGIESQHRELERQGLNHKNEGEKLQESRNNLLQKKKDYQ
FT                   TDLQSKLNEINPEELEEADLRCKEAEAWVESSRRKLSDVAGRSGAWIEKHQKARDELNK
FT                   IRLELDPKRLEKQNIEESLLQLNVILKELETDQKADQSSNEKVHIEISNLNKKWDSILD
FT                   LLSVKKEEFQVLVSEKDIQERTKYRLEKEQVKLQNDIARLESRKEMISESRGTNAITLL
FT                   LESGLEGIHGPVANLGEVEDRYRIALEVAAGARLGQVVVDSDQIAAKSIDLLKRKRAGR
FT                   LTFLPLNKILKNSQSRSDVFQRSVHTNFNKSTGLIGKAIDLIQYDSIYKNVFLYVFGET
FT                   IVFSDLSSARDQIGIKRAVTLEGELLEKSGAMTGGSLNNRALGLSFGRVKDNDDCDLLK
FT                   NRLLEIGETLTNCQKNENQLINKLDNLRSQLSKLEQEKAALDAERVTSKRSNSPLLERQ
FT                   SHRSKRISDLQKSKKEKLCQLESINLIIKPLEVILLEIEKEEKTIDKSSDSSVWSKLQN
FT                   DLEEADKNLLSFRNKRDEISNKQSQNKLAIDRLNDQETALISEEKRLKDSIDTLASSHI
FT                   AWREQSKLLNTNRQDLINQQKDLETRFGEQRRERDCVEADVAKKRLNLQEMQWSLQRLM
FT                   EDQKNMKEEIRMETIRCTELERKLPNPRPLISDEIRDNGLDDLLSKLEDLQKRMEELEP
FT                   VNMLALEELAKLEERLNELENRLQVLTDERSELLLRIETVATLREEAFMEAFKAVDVHF
FT                   REIFASLSEGDGHLQLENPEEPLEGGLTLVAHPKGKPVRRLAAMSGGEKSLTALSFLFA
FT                   LQRFRPSPFYALDEVDSFLDGVNVERLAALIAQQAEQAQFLVVSHRRPMIGASMRTIGV
FT                   TQARGNHTQVVGLPIAA"
FT   gene            101572..102612
FT                   /locus_tag="PMN2A_1421"
FT   CDS_pept        101572..102612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1421"
FT                   /product="protein implicated in RNA metabolism (PRC-barrel
FT                   domain)"
FT                   /note="Alternative locus ID: NATL2_01031"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1421"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58909"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW9"
FT                   /protein_id="AAZ58909.1"
FT                   /translation="MTNTQAPQESTSAVPSDRLWLRSELMGTQVITRDTGRRLGLVGEV
FT                   VVDIDRREVVALGLRDNPLTRFLPGLPRWLPLDQIRQVGDVILVDTIDSLSENFVPERF
FT                   NKVINCQVITESGDQLGRVLGFSFDIETGELLTLVMGALGVPLLGEGVLSTWEMPVDEI
FT                   VSSGPDRIIVYEGAEEKLKQLNSGFLEKLGVGNSGWEESERERYRVNLVPVENQLTSGE
FT                   SVNDDQRLLEQSQEIFEEEEMEYVELQDSEEQQYNKELRYLDEPNQSSIYSEIDEDVVN
FT                   YSESNFKKRTDDFQAKFSSKNTKNKSKIIRDEEPMDVEPLEDLTINNSQDMISNDNQLI
FT                   DIEDPW"
FT   gene            complement(102613..103890)
FT                   /locus_tag="PMN2A_1422"
FT   CDS_pept        complement(102613..103890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1422"
FT                   /product="cyanobacteria-specific protein related to lipid A
FT                   disaccharide synthetase"
FT                   /note="Alternative locus ID: NATL2_01041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1422"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58910"
FT                   /db_xref="GOA:Q46HW8"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW8"
FT                   /protein_id="AAZ58910.1"
FT                   /translation="MSHNHLAIIFVSNGPGELATWVNPLAKELHKQIKLKPRVHNSSKS
FT                   LNLVLVPCPNATGNEIIAAKKWFQFEKIIKAKNFWKLLLNPKKFGSWPSNGLVIFLGGD
FT                   QFWSVLLSARLGYLHMTYAEWIARWPFWNNRIVAMSERIVDKLPKRIQPRCSVIGDLTA
FT                   DLTETAKIDNPLPSGKWIALLPGSKSAKLKIGIPFFLEVADKISKSMPDCQFLIPLAPT
FT                   TNINELKHFSSSKNPISKQYKSGIKSITKANKKEGRGVLITNNSTVILIQEKHPAYSDL
FT                   SQCDIALTTVGANTAELGSLNIPMIVVLPTQHISVMEAWDGFIGLIARLPILKWCIGLL
FT                   ISFIKLKKRGYMAWPNIYAKKMIVPERVGHITPAQIAEETIDWLNSPTRLSGQREDLQL
FT                   LRGSKGAVKKFCYQIINLLEEKKLLN"
FT   gene            complement(103918..103999)
FT                   /locus_tag="PMN2A_R0029"
FT   tRNA            complement(103918..103999)
FT                   /locus_tag="PMN2A_R0029"
FT                   /product="tRNA-Leu"
FT   gene            104126..105469
FT                   /locus_tag="PMN2A_1423"
FT   CDS_pept        104126..105469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1423"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="Alternative locus ID: NATL2_01051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1423"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58911"
FT                   /db_xref="GOA:Q46HW7"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW7"
FT                   /protein_id="AAZ58911.1"
FT                   /translation="MPIGKLLIANRGEIALRILRSCREMGIATVAVYSTIDKNALHVQL
FT                   ADEAVCVGDSPSSKSYLNVPNILAAATSRGVDAIHPGYGFLAENDRFAEICGDHGLIFV
FT                   GPSPHAIRSMGDKSTAKSTMQKVGVPTVPGSEGLLDSVSDASKLASEMGYPVMIKATAG
FT                   GGGRGMRLVNHSDELENLFKAAQGEAEAAFGNPGLYMEKFIDRPRHVEVQILADRFGNV
FT                   VHLGERDCSIQRRHQKLLEESPSPALDDHLRIRMGEAAVAAAKSINYEGAGTVEFLLDR
FT                   NGSFYFMEMNTRIQVEHPVTELVTGMDLISEQLRIAGGEKLQYTQAEIKLEGHAIECRI
FT                   NAEDPSHNFRPSPGKITGWLPPGGPGVRVDSHVYTGYDIPPFYDSLIGKLIVWGKDREA
FT                   ALKRMERALSECAVTGITTTIDFHLKLLKRKEFIEGDVHTKFVEQEML"
FT   gene            complement(105483..105782)
FT                   /locus_tag="PMN2A_1424"
FT   CDS_pept        complement(105483..105782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1424"
FT                   /product="YGGT family, conserved hypothetical protein
FT                   integral membrane protein"
FT                   /note="Alternative locus ID: NATL2_01061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1424"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58912"
FT                   /db_xref="GOA:Q46HW6"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW6"
FT                   /protein_id="AAZ58912.1"
FT                   /translation="MPLLVKSLPTLHFFMSFSIGALTLAFLLRIILTWYPKIDLRTGFW
FT                   PIIFLPTEPILVLTRKIVAPIGGVDVTPIIWVGLLSLFRELFLGQQGLLTQIIF"
FT   gene            105870..106040
FT                   /locus_tag="PMN2A_1425"
FT   CDS_pept        105870..106040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1425"
FT                   /product="photosystem II protein X PsbX"
FT                   /note="Alternative locus ID: NATL2_01071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1425"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58913"
FT                   /db_xref="GOA:Q46HW5"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HW5"
FT                   /protein_id="AAZ58913.1"
FT                   /translation="MAFHLLNLFLSAGTSSEAATSSAVGMIGSFLAAGALIVAPAAAAL
FT                   IWVSQKDALSR"
FT   sig_peptide     105870..106001
FT                   /locus_tag="PMN2A_1425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.521 at
FT                   residue 44"
FT   gene            106124..107086
FT                   /locus_tag="PMN2A_1426"
FT   CDS_pept        106124..107086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1426"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1426"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58914"
FT                   /db_xref="GOA:Q46HW4"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW4"
FT                   /protein_id="AAZ58914.1"
FT                   /translation="MVNASLNWASIVGIVLAVCGAGLYFLRSFKPALARDYDVFFAAIG
FT                   LLCGGILFFQGWRLDPILQFGQFLLAGTTVFFAYESVRLRGIATDQARRSSYFDDEPEL
FT                   PRSSRRGLSDADSDRNYDRFEESQPINRRFAGREDYQEEYSDDENYGRRPSRAAIPEQA
FT                   VSRRPRNISSSEINSRGTERDRRMERFNSESSSDRASSFGDRRTSRQETRQGTRPSASG
FT                   QTSSRRRNGAPPTQSSSSRLNSDNSTRASTGSKRPSKTNNNIEDAAFSSSEKGVRRASR
FT                   RSPKNPGANPANQRPSSKSSYSSSTRKSRPRDNSSRFDD"
FT   gene            complement(107098..107337)
FT                   /locus_tag="PMN2A_1427"
FT   CDS_pept        complement(107098..107337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1427"
FT                   /product="high light inducible protein hli5"
FT                   /note="Alternative locus ID: NATL2_01091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1427"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58915"
FT                   /db_xref="GOA:Q46HW3"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW3"
FT                   /protein_id="AAZ58915.1"
FT                   /translation="MNSNTEKAQESESTEPETTDSEIKNLSPSATTNDIPEFGWSGYAE
FT                   RINGRFAMIGLLAVLLVEALSKISFLEWAGIISQ"
FT   gene            complement(107347..109335)
FT                   /locus_tag="PMN2A_1428"
FT   CDS_pept        complement(107347..109335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1428"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_01101"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1428"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58916"
FT                   /db_xref="GOA:Q46HW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW2"
FT                   /protein_id="AAZ58916.1"
FT                   /translation="MTSSISKAQKGLVSQLIKLRKLTQPYFLPYTKNNGWLFVYLLIAL
FT                   LFCVGGTVLFLLTGLMSLLTNLAPDVTNQFLGGVQNSLKVIWNGPSGIIISSLFALGIF
FT                   SFITVRGQLRQRRWLPWLLLGVIILMLLSVNGINAGITFLVRDITNALIQKDESESYKN
FT                   LWILGICFIAALPIRSFQFYFSAKLQLLWREWLSKSLITDYLDDRTYYILNPNDESETN
FT                   VDNPDQRITEDARDFTAQTIDLSLNIFDSLLVFSLNIFILLSISKELTLALIVYATLVS
FT                   SLLLFASRKLFKLNYDQLRFEADFRYGLVHVRNNAESIAFYSGENQEEKEVSRRLKSVV
FT                   DNFNLLIIWEALLRVLQRSGIYGSVFIPFIILAGPILSGQMDYGSFQQANLNYNLLEGS
FT                   LFFIIYKIEALARFSASIGRLEGFQSNMNEIRNNQFEDFKVEIKNNDSIILKNVSIKTP
FT                   GKDNYLINNLNLSLETGQSLLVVGPSGCGKTSLLRAISGLWAIQSGEIETPSNGELLFI
FT                   PQKPYMTLGSLREQLCYPLDKNRFSDDHLKAVLEEVKLPQIIQRYPDLDIKQDWQRLLS
FT                   LGEQQRLAFARLLLNSPKYVVLDEATSALDVNTEKHLYELLNKREMACISVGHRPTLKN
FT                   YHENVLEITENKGWRLLPAASYQFTEN"
FT   gene            complement(109458..109739)
FT                   /locus_tag="PMN2A_1429"
FT   CDS_pept        complement(109458..109739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1429"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1429"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58917"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW1"
FT                   /protein_id="AAZ58917.1"
FT                   /translation="MDSQTAKDKNGIISKANINLQDLWSNLSEKQQSILKKIWSILTYK
FT                   WQWQIILNAPFLVIWALDQTIPAVHTFDMQLISSLPIPTIIKTYLGFS"
FT   gene            complement(109845..110180)
FT                   /locus_tag="PMN2A_1430"
FT   CDS_pept        complement(109845..110180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1430"
FT                   /product="HIT family hydrolase"
FT                   /note="Alternative locus ID: NATL2_01121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1430"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58918"
FT                   /db_xref="GOA:Q46HW0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HW0"
FT                   /protein_id="AAZ58918.1"
FT                   /translation="MTTIFDKILSGEIPCDEVFSDNKCLAFKDITPQAPTHILIIPRKP
FT                   IPSLQDIKKEDQELLGHLLLKGTEIANAAGLESWRTIINTGEEAGQTVFHLHIHIIGGR
FT                   KLSWPPG"
FT   gene            complement(110250..110858)
FT                   /locus_tag="PMN2A_1431"
FT   CDS_pept        complement(110250..110858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1431"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Alternative locus ID: NATL2_01131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1431"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58919"
FT                   /db_xref="GOA:Q46HV9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HV9"
FT                   /protein_id="AAZ58919.1"
FT                   /translation="MAGSFAQLAKNAEKKKPSISVSKEPVENPPLKVYQLGDEALRTPA
FT                   NRIVKVDDAIRKLAKDMLITMYSSKGIGLAAPQVGIQKRLLVIDLKFEDPNSPPMVFIN
FT                   PEIISSSATLDTYEEGCLSIPGVYLNVLRPSSIKLSYRDEMGRPKKMNADGLMARCIQH
FT                   EIDHLNGVCFVDKVTDEEELKKQLNENNFKRSDVIKETN"
FT   gene            110939..112873
FT                   /locus_tag="PMN2A_1432"
FT   CDS_pept        110939..112873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1432"
FT                   /product="dienelactone hydrolase"
FT                   /note="Alternative locus ID: NATL2_01141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1432"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58920"
FT                   /db_xref="GOA:Q46HV8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV8"
FT                   /protein_id="AAZ58920.1"
FT                   /translation="MKNKTMRILDAEKVYGEAPIFKEPRIIGDWILWLEQRPNEKGRTT
FT                   ALIRPWGQKDVLPQELTPYPSDLRTKIHGYGGAPLTATLDGSDLILTWVDNKDNRLWMR
FT                   TWFYEEEKEKSFSFKFIPKIESICLTKKHNYFLAGGVIDLEKNIWIGLMEDEEGDHIVS
FT                   YSLKKSEQYPRIIYSSQGLLGYLALNSKDRKLAWVEWKNTSMPWDLNELKLAKLGEQEN
FT                   IINIVTLNNEYLKCTEKISFFNPIWSDTGDLFVAEDSSGWWNITQIKTDLNNNSITIFQ
FT                   NQWSIKAEIAFPQWVLGMSSFSCVGDNVVGAFAQEGIWTLALFQKDGSIKTFDQTFIEF
FT                   SGIHSHQNRLVAIASSAEITEGIFEIDLLNQSWEHTPASSFSLDSKEISIGESFWFIGS
FT                   NEEKVHAWYYPPLNKQILLPPLLVKSHSGPTGMARCGLDLEVQFWTSRGWAVVDVNYGG
FT                   SSGFGREYRDRLRGNWGVIDVMDCTKAAQSLIASGKADKDRIAIMGSSASGFTALGCLI
FT                   SADIFNIGACKYAVTDLIGMANSTHRFEEFYLDYLIGNIETDYEKYLKRSPIENVNCMN
FT                   MPLILFHGLKDKVIPSDQSIAIKEELLKREIPVQINLFENEGHGFKDGKIKVDVLNKTE
FT                   AFFRQYLNI"
FT   gene            complement(112870..114120)
FT                   /locus_tag="PMN2A_1433"
FT   CDS_pept        complement(112870..114120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1433"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="Alternative locus ID: NATL2_01151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1433"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58921"
FT                   /db_xref="GOA:Q46HV7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV7"
FT                   /protein_id="AAZ58921.1"
FT                   /translation="MNNLVKNIAEKSRNDFPLFNGDINKNLIYLDHAATSQKPKQVIDS
FT                   LKKYYSFQNANVHRGAHQLSALATEKFENSRKLTANFINSKNEKEIIFTRNATEAINLV
FT                   AYTWGNYELQENDEILISLMEHHSNIVPWQLIAKAKKCKLIYINIDKNGELDFDDFKKK
FT                   LSDKTKIVSLVHVSNTLGCCNPIEEISSLAHQKGSLVLLDACQSLAHKQVDIKKLGIDF
FT                   LAGSSHKLCGPTGIGFLWGREEILKKIPPFLGGGEMINEVFKDNSTWAELPHKFEAGTP
FT                   AIGEAIGMGTALQYLQSIGLNEIHNYEKELTKYLFEKLEEIDDLKILGPSPLIQPDRGP
FT                   LATFYIKGIHSNDVAELLDNSNIYIRSGHHCCQPLHRFYGIKSTARASLSFTSTPSEID
FT                   SLAEELKSVISFLKKNS"
FT   gene            complement(114117..115355)
FT                   /locus_tag="PMN2A_1434"
FT   CDS_pept        complement(114117..115355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1434"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly permease component"
FT                   /note="Alternative locus ID: NATL2_01161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1434"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58922"
FT                   /db_xref="GOA:Q46HV6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV6"
FT                   /protein_id="AAZ58922.1"
FT                   /translation="MKSSSICQEWLDSLPLTEGYLKNEQSIGREFLLEKGMPSKKDEAW
FT                   RLSNFNKLNSFLSLPTIIDSKGIKSVFPEKDKNRERIIINPNENPILNINLPNGIEELN
FT                   KKEIEENLGEIIKSTNIKNDISVCLNQASSLDILALKVKRNHNHSLEIVIPSIEEKSIS
FT                   TRIFFLIEEGAKLDLLQIFLGKNNSAQNHLIEIKLEAEAEFTHGFISLGEEKESSSICT
FT                   LAVDQSEKSKYSLHSIHHGWDYARFEPRIIQSEGEASTIIKGLQVTKSKEQIATHSLIR
FT                   FEGPNGKLDQLQKAVASEYSHCIFNGSIEVPQKAQKTEAAQLSRNLLLSKRARIDTKPE
FT                   LEIVADDVRCTHGATVSQLQDEELFYLLSRGIDKQCANSLLLQGYYDEVISHFPKSAGK
FT                   WNFIEKLIQDIKK"
FT   gene            complement(115352..116143)
FT                   /locus_tag="PMN2A_1435"
FT   CDS_pept        complement(115352..116143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1435"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="Alternative locus ID: NATL2_01171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1435"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58923"
FT                   /db_xref="GOA:Q46HV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV5"
FT                   /protein_id="AAZ58923.1"
FT                   /translation="MISSTSETILSIKDLHASVEDQEILHGVNLLVKEGEIHAIMGRNG
FT                   SGKSTLSKVIAGHPSYKVLSGSIQFKGKNILELEPEERARIGIFLGFQYPVEIPGVSNL
FT                   EFLRVATNSRRKELLKSELDTFQFEDLVKQRLKIVEMNPAFLERSVNEGFSGGEKKRNE
FT                   ILQMALLEPVISILDETDSGLDIDALRIVASGINRLSQPNSATILITHYQRLLNEITPD
FT                   FVHIMADGKIIKTGNKELAIDLEKSGYDCIDKNTKEKEIAK"
FT   gene            complement(116194..117636)
FT                   /locus_tag="PMN2A_1436"
FT   CDS_pept        complement(116194..117636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1436"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /note="Alternative locus ID: NATL2_01181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1436"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58924"
FT                   /db_xref="GOA:Q46HV4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV4"
FT                   /protein_id="AAZ58924.1"
FT                   /translation="MTQSNTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISAKKN
FT                   EPEFLLKFRLRAYEQWLKMKEPDWSGLTYSKVDYQDLVYYSAPKQDIKKKSLDEVDPKL
FT                   LETFEKLGIPLSEQKRLSNVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAISEYPDL
FT                   IEKYMGTVVPINDNFFAALNSAVFSDGSFVYIPKGVECPMELSSYFRINSGDTGQFERT
FT                   LIIAEESSSVSYLEGCTAPMFDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGG
FT                   IYNFVTKRGECRGKKSKISWSQVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKA
FT                   DTGTKMIHIGKNTKSKIVSKGISAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKA
FT                   SANTYPYIQSKQPQSNIEHEASTCRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNE
FT                   LPMEFASEADKLLALKLEGSVG"
FT   gene            118114..118476
FT                   /locus_tag="PMN2A_1437"
FT   CDS_pept        118114..118476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1437"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1437"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58925"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV3"
FT                   /protein_id="AAZ58925.1"
FT                   /translation="MMESTFNDNSKNSPLSKEDINLIGLTNLSANEKHHLRMLAHCLQC
FT                   FKSMSKDNPKGLIPVKEEWLEWCLKNPIMMKDDEFVQVIFEQFSGAAIQLERLSNDLKV
FT                   APLDLTLRNLIDAYEG"
FT   gene            118762..119844
FT                   /locus_tag="PMN2A_1438"
FT   CDS_pept        118762..119844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1438"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1438"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58926"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV2"
FT                   /protein_id="AAZ58926.1"
FT                   /translation="MTFDQESLSRLTLRQLRIKASELGIPLYSRKSKADLVKGVLLYEE
FT                   KKELEKQLINNKVQPSSETTYQSSSETKVVFLPRDPEWAYVFWEISDSDRSNAQKEGAI
FT                   RLCLRLADVTNKNNGETNPGTLQEIVVDSHSTEWYLPIPLAGRDYKVELGYRIGHKWMS
FT                   LAHSSSAKVPSLHPSEQILDQFVPFSLEAPVTTTSDSKIESFASEQPDSGLHERLYQSA
FT                   TTKFRTRRVGSEEFQEGFPGDLNSNNESGSGLWASGLNESGIGGVPQARSFWLVADAEL
FT                   IVYGATDPSAKLFIEDEEVPLGNDGTFRLQVPFRDGIQNYSIKAIDKDGVDSRNITMKF
FT                   ERVTPVDNTNPNSKAESEWF"
FT   gene            119864..120034
FT                   /locus_tag="PMN2A_1439"
FT   CDS_pept        119864..120034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1439"
FT                   /product="membrane protein"
FT                   /note="Alternative locus ID: NATL2_01211"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1439"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58927"
FT                   /db_xref="GOA:Q46HV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV1"
FT                   /protein_id="AAZ58927.1"
FT                   /translation="MVRLIVAFTPLVGAIAFPLLIPTTIERLGLGPGVLSALILSTLWF
FT                   IAMLRTSEMPH"
FT   gene            120098..121747
FT                   /locus_tag="PMN2A_1440"
FT   CDS_pept        120098..121747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1440"
FT                   /product="phosphoglucomutase"
FT                   /note="Alternative locus ID: NATL2_01221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1440"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58928"
FT                   /db_xref="GOA:Q46HV0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HV0"
FT                   /protein_id="AAZ58928.1"
FT                   /translation="MFSTEFTQLTVKLNSPFTDQKPGTSGLRKSTLQFEETHYLESFIE
FT                   SILCSLPGVRGGVLVVGGDGRYGNKRAIDIIIRMAAAHGIQKVITTVDGILSTPAASNL
FT                   IRINKAIGGIILSASHNPGGLEGDFGVKLNGSNGGPASESLTDEIYNYSKNLKEYKIIK
FT                   CQSNNSFSLGKYKLASMIVEIIDGIDDYLDLMKRIFDFDLISSYINNDFPIVFDALNAV
FT                   TGPYAKRLFVDHLGATAETVRNGIPLEDFGGLHPDPNLTYAKDLADLLLKGNLFSFGAA
FT                   CDGDGDRNMILGRGCFVNPSDSLAILAANYDCVPGYAKGLSGVARSMPTSSAVDVVAKH
FT                   LGINCFETPTGWKFFGNLLDANQITLCGEESFGTGSDHVREKDGLWAVLFWLQILASKK
FT                   KSVSEIMKNHWLFFGRHYYSRHDYESIPTEVANSLYSRLSNMLPTLIDESFAGRTIKNA
FT                   DDFSYTDPVDSSITLNQGLRILLDDGSRVLVRLSGTGTQGATLRVYFESFVPSDGDITQ
FT                   DPQLALDPLIKSIDSLAEISKRTGMSAPTVIT"
FT   gene            121835..124039
FT                   /locus_tag="PMN2A_1441"
FT   CDS_pept        121835..124039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1441"
FT                   /product="Recombination protein MgsA"
FT                   /note="Alternative locus ID: NATL2_01231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1441"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58929"
FT                   /db_xref="GOA:Q46HU9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU9"
FT                   /protein_id="AAZ58929.1"
FT                   /translation="MSKDLFAFNGEQLIQNNAPLADRLRPQTLDEFVGQDHILAQGRLL
FT                   RRSIVADKVGNLLLYGPPGVGKTTLARIIALNTLSHFSVVNAALAGIKDLRSEIESAID
FT                   RLNKFGKRTILFIDEVHRFNTAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSR
FT                   LFRLNSLNSKALHQLLQRALNDKKRGYGLKLINLASEAEDHLVDVCNGDARVLLNALEL
FT                   AVESTIANQDTSINIDLKIAEDSIQERAVLYDKKGDAHFDTISAFIKSLRGSDPDAALF
FT                   WLARMLEAGESPRFIFRRMLIAAGEDIGLADPNAIVIVESCAAAFDRIGLPEGVYPLAQ
FT                   ATLYLASTEKSNSVKAIFKAVQKVKDSQKQNVPSHLKDPNRDQESFGDGMGYRYPHSFS
FT                   KNWVPQQYLPDTLLNEIFWEPTEHGWEGQRRSLLNERRSQQLASLIEVEQQNPLTITSG
FT                   KVDNDLDKWLSRQVLQEGERLKHLMTKLWSGITWKKNHRVLVLAPSSLLWSLKPLREAS
FT                   EGGVVLAVSEDNHPKLLAELEVLAPMERPVLIDSKVESIKKLEDNLKFELIGGRIPWKV
FT                   FSATNFFELWPILTEKCTENTELSLIISNPCYGPAFSLKKRLELYSNKKNTDFSFLSDL
FT                   ICKEEKWLNKQEHKKKFILQLEKLGWNISFEEWTEFIYQKVDNTIIKRWLNQGSEYREI
FT                   ILENCEEETLIRLQELFKRLDGQTIKQKLIHTKFLAKNSN"
FT   gene            complement(124036..124638)
FT                   /locus_tag="PMN2A_1442"
FT   CDS_pept        complement(124036..124638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1442"
FT                   /product="possible 4'-phosphopantetheinyl transferase
FT                   family protein"
FT                   /note="Alternative locus ID: NATL2_01241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1442"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58930"
FT                   /db_xref="GOA:Q46HU8"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU8"
FT                   /protein_id="AAZ58930.1"
FT                   /translation="MPSKLLPISSEEKKWVQKLAPSRGLIYHFSRGCLRHVMSNITGLG
FT                   PLDIPLKADPGEPPLLAEGWGNISMSHCSDALLIGWSSGKIGVDIERKDREIQAYKLSK
FT                   RFFTQYENYEIENLSPCQAKELVLKRWVIKEAAVKWQRGKIANNINQWIWKNKSSFAHH
FT                   KKLGHKVKVYEQNYDQWTYAIALDEDSITCKPIICVD"
FT   gene            124691..125158
FT                   /locus_tag="PMN2A_1443"
FT   CDS_pept        124691..125158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1443"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_01251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58931"
FT                   /db_xref="GOA:Q46HU7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU7"
FT                   /protein_id="AAZ58931.1"
FT                   /translation="MTLCIGDSAPDFTLPNQDGVNISLSSFQGSRVVIYFYPKDDTPGC
FT                   TKEACSFRDNWELFKSNNIQVLGISKDASKSHIKFIDKHKLPFTLLTDSDPCPVAASYE
FT                   SYGLKKFMGREYYGMMRHTFVVNKDGKIELIYLKVKSDNMANQILNDLKLN"
FT   gene            complement(125145..125846)
FT                   /locus_tag="PMN2A_1444"
FT   CDS_pept        complement(125145..125846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1444"
FT                   /product="bordetella pertussis Bvg accessory factor"
FT                   /note="Alternative locus ID: NATL2_01261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1444"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58932"
FT                   /db_xref="GOA:Q46HU6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU6"
FT                   /protein_id="AAZ58932.1"
FT                   /translation="MYSEENFLMIGNTRWHWANKVKKDWKYFHTSPNPIEFKDKDYSQL
FT                   TWASVGPIPEDIKLCPSKEITLDNVPLNNLPTNLGIDRALSSWSAFKKQSFLKSKEQDL
FT                   IVIDAGTILSVTKVSNKGEFIGGQLISGFSLQLSSMSNRAMNLETPIVKKIPTETFQYE
FT                   THNAMIRGSMNALIGLILTLFEETKLPIWMCGGDAPIILNELKNTNIDINHSPNLVLEG
FT                   MIDVYKKINSI"
FT   gene            complement(125864..126631)
FT                   /locus_tag="PMN2A_1445"
FT   CDS_pept        complement(125864..126631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1445"
FT                   /product="phosphoadenylylsulfate reductase (thioredoxin)"
FT                   /EC_number="1.8.4.8"
FT                   /note="Alternative locus ID: NATL2_01271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1445"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58933"
FT                   /db_xref="GOA:Q46HU5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU5"
FT                   /protein_id="AAZ58933.1"
FT                   /translation="MKKESKDNYINDLRNAAQLPQPALMKSINETSKDLEKLSPQDQLQ
FT                   WAFEEFDESFVVTTSFGIQSAVLLHMTKELKSSQKPKVIWVDTGYLPKETYDYAEKLTT
FT                   LFELNLVIAQSPVSPARMEALNGRLWETGVQKDLDKYHQIRKVAPLEKAFSDLNVLCWA
FT                   SGVRKGQTQNRQSMSNIDCIRERLTLRPLLTWSKKDIFYYMEKNKLPQHPLFEQGYSTV
FT                   GDWHSSGAENTNTKGRSTRFGGLSEECGIHLNT"
FT   gene            126703..127875
FT                   /locus_tag="PMN2A_1446"
FT   CDS_pept        126703..127875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1446"
FT                   /product="NADH dehydrogenase, FAD-containing subunit"
FT                   /note="Alternative locus ID: NATL2_01281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1446"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58934"
FT                   /db_xref="GOA:Q46HU4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU4"
FT                   /protein_id="AAZ58934.1"
FT                   /translation="MDLNNLKSDPIVVVGGGFGGLSTVQALLARSNGIPIILIDQSPRF
FT                   LFKPLLYELLSGELQLWEVAPKYSALASELGFIFLEECVVEVDGLERKLITSSGTEVTY
FT                   SQLVISTGVTTDFSLLRNLKEYAYGFSSLNDLVRIQELIISINNSSNHSDPLIIAGAGP
FT                   TGVELACKLSDLVNNRVDIYLVDKGNKILSKSKSFNREKAIDAIAERNIKIYLEHYIQS
FT                   INENIIELSTVETERNNSLKINYSGLLWTAGLSPCRLQFIDHLLDENKKIKVNKFLQIK
FT                   EYQNIFFVGDIVFCEDDPFPSSAQVAMQQGFLTAQNIISLRKGNKLKSFQFEDLGEMLS
FT                   LGIGNASITGYGVTLAGSLAFKIRHFAYLMRMPGFSLSLKSAGSRLLSKK"
FT   gene            127975..129792
FT                   /locus_tag="PMN2A_1447"
FT   CDS_pept        127975..129792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1447"
FT                   /product="di/tricarboxylate transporter"
FT                   /note="Alternative locus ID: NATL2_01291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1447"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58935"
FT                   /db_xref="GOA:Q46HU3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU3"
FT                   /protein_id="AAZ58935.1"
FT                   /translation="MNEIFTVLENPKAVITLAVLIIAVFLFVSSALAPELTGLLSVALL
FT                   MATGVLSPQKALAGFGSPALITLMGLFAVSAALFKSGALDRLRELIASDSIRTPRRLIA
FT                   LLGLVVAPVSGVVPNTPVVASLLPVIEAWCVKRKLSPSRVLLPLSFATVLGGTLTLLGS
FT                   SVNLLVSDISDQLGYGPFDLFTFTAIGVPIWLFGTAYMLLAPQSLLPDRGRISSEYGGS
FT                   SDQTGYFTEVTIPSDSELVGHSLRNSRLQRRFDVDVLEIQRENEILLPPLADRIIQSGD
FT                   RLLIRITRSDLLRLKQEHTVQLNKNLSIEKKFFLSNIDESQQTVEVLLPAGSTLAGASL
FT                   RELRFRQRHNATVLALRRGQQTVQERLGQAILREGDVLLLQAPRDSIRGLQDSNDLLVL
FT                   DQFENDLPTVTRKPIAIGIAIAMLIIPSITDLPLVASVLMAVIAMVWGGCLRPAEVQRS
FT                   IRLDVILLLGSLSSFSVAMQTTGLADAFANILILILEDLSTYSALLVIFLSTTIFTQFV
FT                   SNAASVALLAPIAVQLAPSMGLPPLALLITVLFGASQSFLTPMGYQTNLMVFGPGRYQF
FT                   LDVTRYGAGLTILMTLLVPGLILLKYGIS"
FT   sig_peptide     127975..128070
FT                   /locus_tag="PMN2A_1447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.821) with cleavage site probability 0.602 at
FT                   residue 32"
FT   gene            129795..129899
FT                   /locus_tag="PMN2A_1907"
FT   CDS_pept        129795..129899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1907"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1907"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23845"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA7"
FT                   /protein_id="ABU23845.1"
FT                   /translation="MLDMIINLGKNLKLPFDFDYLIFSELVSIYFQKK"
FT   gene            129896..131281
FT                   /locus_tag="PMN2A_1448"
FT   CDS_pept        129896..131281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1448"
FT                   /product="trk-type K+ transport system, membrane component"
FT                   /note="Alternative locus ID: NATL2_01311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1448"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58936"
FT                   /db_xref="GOA:Q46HU2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU2"
FT                   /protein_id="AAZ58936.1"
FT                   /translation="MSIRQETYRRLTVPQFTVVTGLLVIAFGTLLLATPFCSNANVGLW
FT                   EALFTATSAVTVTGLSIIDIGIDLTFFGQVILAIMLLTGGLGLMAITTFLQGFIVSGTE
FT                   LKTRLDRGKTLDEFGVGGVGTTFKGIAITASILIFLGSITLYFFGFKNITSSSERIWAS
FT                   IFHSISAYNNAGFSLWSSSLQDYRGNWVVNFVLITLIILGGFGWRVTNDIWINRRSLKL
FT                   RNLSLHTRLVIRSSFILIALGFFGLIFTESLARGSFFSLINFDDRILTALFTSVSSRTA
FT                   GFTNLPISIESVSDSGLLLIMFLMFIGASPGGTGGGIKTTTIAALMAATRATLRGQNEI
FT                   IIRNRQISDKVILKAVGITVGSFLFVLIMALLLSLSNGFNSGENFSFLEMLFTCISAFA
FT                   TVGFDLGVTSKLGHVGQLILIIGMFVGRLGILLFLSAVWQALNKSKIQHRNRIGYPKED
FT                   LYV"
FT   sig_peptide     129896..130018
FT                   /locus_tag="PMN2A_1448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.888 at
FT                   residue 41"
FT   gene            131294..131998
FT                   /locus_tag="PMN2A_1449"
FT   CDS_pept        131294..131998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1449"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /note="Alternative locus ID: NATL2_01321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1449"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58937"
FT                   /db_xref="GOA:Q46HU1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HU1"
FT                   /protein_id="AAZ58937.1"
FT                   /translation="MSDWWQWSPIKANQKLGFAVVGIGRFGSAVCRELLRNGADVLAVD
FT                   FSEKAIEELRQLEPTIEARVVDSTDEESMKEAGVLEMGTVVVGISEPIEASITTTLIAK
FT                   DTEGSLVKQVIARATSDLHEKMLKRVGADRVVFPSRMQGERLGLELVRPNLIERLELDD
FT                   KTGIDEIKVPEVFVGRSLRDLNLRKNYFVNVLAAGPAQLLTVNPPAKYILEKDHVLVVM
FT                   GSMEDLQKLPQT"
FT   gene            132002..133138
FT                   /locus_tag="PMN2A_1450"
FT   CDS_pept        132002..133138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1450"
FT                   /product="conserved hypothetical protein, transport
FT                   associated"
FT                   /note="Alternative locus ID: NATL2_01331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1450"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58938"
FT                   /db_xref="GOA:Q46HU0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HU0"
FT                   /protein_id="AAZ58938.1"
FT                   /translation="MRVLGLMSGTSADGIDAVLVDFTGDPSRPKWQILNTFSYEYPSSI
FT                   REKIIQVGQGLKISSKDWLELAEEITELNAFAARTCDPDSTAEVVGCHGQTLFHRSVKK
FT                   SKRGGSLQILLGPLLANLLDQIVIYDFRSKDIASGGHGAPLVALVDEALVGRLYGWRGV
FT                   LNLGGIANLTIIPPKTGIDKTSQCLGWDCGPANSLVDLAVKESTNSSLTFDENGSLASL
FT                   GIPKLEIIDKWLRDPFFYLEPPRSTGREQFGFQYLQKRKKELGDISKEDLISTLTTFTA
FT                   SIISQDLDNLFKLKQIRLIELLVAGGGSKNLFLMRQLQKQCCGVHVRPIHEIGVPSQYR
FT                   EALVFATLSWWNFLGKKVHPKYITGANKPILYGVRVDP"
FT   gene            complement(133156..133458)
FT                   /locus_tag="PMN2A_1451"
FT   CDS_pept        complement(133156..133458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1451"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1451"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58939"
FT                   /db_xref="GOA:Q46HT9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT9"
FT                   /protein_id="AAZ58939.1"
FT                   /translation="MATRQNSSNGKQKSPRIQVVLPEDLCERLSELAERESRTVSNMAK
FT                   VLIQEGVKYHELKESSASKELETKEMKTQNFINALEKQKTQRLKGIPKRLKFKRD"
FT   gene            133598..133954
FT                   /locus_tag="PMN2A_1452"
FT   CDS_pept        133598..133954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1452"
FT                   /product="membrane protein"
FT                   /note="Alternative locus ID: NATL2_01351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58940"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT8"
FT                   /protein_id="AAZ58940.1"
FT                   /translation="MSKPSLPQASKAFSANVVADKGNVKRQRRKSRSNGKNGDVLISAV
FT                   VSSYLLTHLHHVLQRAEYGASKEGRSSQAANFAQLRKVLCMDARSMKDASALGLKESDL
FT                   DTCNESNGFETKAA"
FT   gene            133988..134218
FT                   /locus_tag="PMN2A_1453"
FT   CDS_pept        133988..134218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1453"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58941"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT7"
FT                   /protein_id="AAZ58941.1"
FT                   /translation="MSGNAAELYKLINADPNKKQDLFRQALQNPKGAMQSICAFGIEMN
FT                   LPVTSEEVKEYLTTVDDLDTKQWLLKARGGL"
FT   gene            complement(134219..134383)
FT                   /locus_tag="PMN2A_1454"
FT   CDS_pept        complement(134219..134383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1454"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01371"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1454"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58942"
FT                   /db_xref="GOA:Q46HT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT6"
FT                   /protein_id="AAZ58942.1"
FT                   /translation="MLRLEQIAALVLAAALAIPSYWFFWTMAGGGGYERRGIRENSQDT
FT                   LEIHSSFKK"
FT   sig_peptide     complement(134291..134383)
FT                   /locus_tag="PMN2A_1454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.452 at
FT                   residue 31"
FT   gene            134469..136187
FT                   /locus_tag="PMN2A_1455"
FT   CDS_pept        134469..136187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1455"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_01381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1455"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58943"
FT                   /db_xref="GOA:Q46HT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT5"
FT                   /protein_id="AAZ58943.1"
FT                   /translation="MLRLEKISKIYPTGEVLKDVSWEIRNGERIGLVGVNGAGKSTQLK
FT                   IIAGLEEATDGSLISEGDPSIAYLKQEFDVDLSRTVREELFVAFKEASDLLHSQKLVQE
FT                   NMESELASKDLDYLDLLIKELSVIQSKFESINGYDLESKVEKLLPTIGFNQNEADRLVG
FT                   DFSGGWQMRIALGKILLQSPDLLLLDEPTNHLDLETIEWLENYLLNQKIAMVIVSHDRS
FT                   FLDKVCTRIVNTERGKSKSYIGNYTSYLQQRDFELESTKVAYEKQQKDIQVQKAYIERF
FT                   RASATRSTQAKSREKLLDKVEKIEAPENNLKGPNFKFLEAPRAGRDILNIKDLTHSYED
FT                   NILFLGAFLELEPGERIAFLGPNGSGKSTLLRLIMGLEEPDEGSITIGKYNIIPSYFEQ
FT                   NQAEALELEKTVIETISQSVPDWTQTEIRSLLGSFGLTNDSVFKEVSQISGGEKARLAL
FT                   ALMIIKPSNLLILDEPTNHLDIPSKQMLEQALSNYNGTALIVSHDRYFISKVANTIVEI
FT                   RDGQLIKYQGDYKYYKEKKIEEAQEKEKELQLAERERKRLANREKQRRKKKTKQK"
FT   gene            complement(136212..137390)
FT                   /locus_tag="PMN2A_1456"
FT   CDS_pept        complement(136212..137390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1456"
FT                   /product="PDZ/DHR/GLGF protein"
FT                   /note="Alternative locus ID: NATL2_01391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1456"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58944"
FT                   /db_xref="GOA:Q46HT4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT4"
FT                   /protein_id="AAZ58944.1"
FT                   /translation="MHGLDDNRLIIGSLKLRQKKYFKIFVLVVLIFLNFRYETPLHSSE
FT                   ASLLSQENHNKQSFVSKALNISGDAVVTIETQRQVLSSSEGVFPPGILNDRYFERFFGL
FT                   RGLQVPRSRIEKGQGSGVIFSKEGLVLTNAHVIEKTDQLIVGLSDGRRVLGNVVGEDSL
FT                   TDLAVIKLKAKGPWPTAQLGNSDNLKVGDWAIAVGNPFGLENTVTLGIISNLNRDVAQL
FT                   GISDKRIDLIQTDAAINPGNSGGPLLNSVGEVIGINTLVRSGPGAGLGFAIPINRARKI
FT                   AKDLITSGRAKHPMIGVTLSSNIKQKSNFLSQTEDGAIIKYLMPNGPAEKGGLKVNDLI
FT                   ISINNEKISTPADVVKKINKNNLQSALRIKILRENIESIKIIKPVDIYDLQV"
FT   gene            137622..137900
FT                   /locus_tag="PMN2A_1457"
FT   CDS_pept        137622..137900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1457"
FT                   /product="uncharacterized membrane protein"
FT                   /note="Alternative locus ID: NATL2_01401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1457"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58945"
FT                   /db_xref="GOA:Q46HT3"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT3"
FT                   /protein_id="AAZ58945.1"
FT                   /translation="MLSNFLPFVYGLSVFVLLFLAARIMLNGFFSGQASFKIQNSFSKT
FT                   KGDDRTGLVTVHPELLDKDGSITDEDLLTVRFSKDSDHPQSYEKPSE"
FT   gene            137956..138339
FT                   /locus_tag="PMN2A_1458"
FT   CDS_pept        137956..138339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1458"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58946"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT2"
FT                   /protein_id="AAZ58946.1"
FT                   /translation="MEQRTRIVAAVLKNVKLPPRFRLRLLKEDPVRLELSLTPAYGKDP
FT                   IQVGLVESLDLVARRDREGRMPRDLQGTWDWTVRHGEVSTGGWNPYLKEALQTMFETGL
FT                   PAIIYEELTGEDYHPVDGARHVR"
FT   gene            138441..138587
FT                   /locus_tag="PMN2A_1459"
FT   CDS_pept        138441..138587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1459"
FT                   /product="possible high light inducible protein"
FT                   /note="Alternative locus ID: NATL2_01421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1459"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58947"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT1"
FT                   /protein_id="AAZ58947.1"
FT                   /translation="MKDNFEPRYGFVNFAEIWNGRLAMMGILIGLTTELLTGQGILTQM
FT                   GIG"
FT   gene            138621..139781
FT                   /locus_tag="PMN2A_1460"
FT   CDS_pept        138621..139781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1460"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="Alternative locus ID: NATL2_01431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1460"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58948"
FT                   /db_xref="GOA:Q46HT0"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HT0"
FT                   /protein_id="AAZ58948.1"
FT                   /translation="MTDLKNAKQSLTTYSVKELNESIGLLLSRGFAPKFILEAAVSKSQ
FT                   IKKGHLWLTLTDGKASVDAVAWSSTIKSLKFLPKQDDGVVIIGKLNFWESQARVSVQVF
FT                   DIRPSISTVLRKFEIVKSNLFKEGLIDDSLRKKLPKYPHSLGILTSVPSSALADMLRTA
FT                   KERWPLTKLQIIPIPVQGDNANKLKSILSKLKKNKLQVEALIIARGGGSREDLMLFDSE
FT                   IIAREIATFPIPVITGIGHEDDLTVADLVSDHRSATPTAAIVDLLPSREIEKNKFLQNK
FT                   KLLKYYLKLFFQNTKKTLITKKSIFQSYSPRLLIKNKRTRINYMYEILNALSPRKLLKR
FT                   GFALITDESGNSIYSVKNIKENDKLIVQFCDGKITAEVDSLNYDKI"
FT   gene            139809..140099
FT                   /locus_tag="PMN2A_1461"
FT   CDS_pept        139809..140099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1461"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /note="Alternative locus ID: NATL2_01441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1461"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58949"
FT                   /db_xref="GOA:Q46HS9"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS9"
FT                   /protein_id="AAZ58949.1"
FT                   /translation="MPLENQVIPNHLSMSNKVTNKKNIEIFKQDINRLSYEESISALET
FT                   ILNNVQDENISLDEIQINYIKGHLLLKHCEELLQFCEQEINEINPEFLELD"
FT   gene            complement(140101..140430)
FT                   /locus_tag="PMN2A_1462"
FT   CDS_pept        complement(140101..140430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1462"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1462"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58950"
FT                   /db_xref="GOA:Q46HS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS8"
FT                   /protein_id="AAZ58950.1"
FT                   /translation="MNKPSSLIWMVFILLIILPTPAGKFIIDLAGGIFLIITIIPLVLG
FT                   GVGWFTWKRIQSKVQNCEACGSTFLNSQMICPICGTPITKNADILENIPASAATIDIKS
FT                   EELDL"
FT   sig_peptide     complement(140356..140430)
FT                   /locus_tag="PMN2A_1462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.612) with cleavage site probability 0.603 at
FT                   residue 25"
FT   gene            complement(140493..141407)
FT                   /locus_tag="PMN2A_1463"
FT   CDS_pept        complement(140493..141407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1463"
FT                   /product="putative serum resistance locus BrkB"
FT                   /note="Alternative locus ID: NATL2_01461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58951"
FT                   /db_xref="GOA:Q46HS7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS7"
FT                   /protein_id="AAZ58951.1"
FT                   /translation="MGLNWTKKARWLFSSLWRAYERWSKCDCVDLSAAFAYYTLQSFFP
FT                   ILLISLSVASWFLGKQQGIEQRIIELTAEVLPSEVIALVASTLEQLINQGFGAGILGAM
FT                   FLMITAGNAYLTLQRGADRLWEDVLPVKSKPDPLRLQAFRFIRNRIEAFFVVLLVGILM
FT                   VIDQISANIRLIPEAVLEDLANTTPWVENAITKIPVLQVGQFILPLIGFSTMALLLQGL
FT                   LPSRRVPLKPLIPGALMIGTLLTILNLAVSRSILSLGSRFQAYGFIGGVLVLTLWVWMV
FT                   GVIIYFGQCWSVVIASMRRNRYV"
FT   gene            complement(141539..142357)
FT                   /locus_tag="PMN2A_1464"
FT   CDS_pept        complement(141539..142357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1464"
FT                   /product="inositol monophosphatase family protein"
FT                   /note="Alternative locus ID: NATL2_01471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58952"
FT                   /db_xref="GOA:Q46HS6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS6"
FT                   /protein_id="AAZ58952.1"
FT                   /translation="MNQDPISKPLSKAQLIAIHQLVDEVGKRQLQDFGQINSDIKPDGT
FT                   LITECDRWSDKTIVQGLSQITPGEGVLSEEGKKSIPSSSEYWVVDPLDGTTNFAAGIPY
FT                   WAISIARFTNGEPETAFLDIPALRKRIFAIKGKGVWLNDKPLKPESRFKKNSDCISLCS
FT                   RSIKVLQMKPEQSFPGKIRLLGVSSLNMTSVAIGQTIAALEATPKIWDIAAAWLILEEL
FT                   NCLINWLETNPKNILSGTDLTSVNFPLLTASTEDQLNNMLPWASALIQDS"
FT   gene            complement(142375..143955)
FT                   /locus_tag="PMN2A_1465"
FT   CDS_pept        complement(142375..143955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1465"
FT                   /product="outer membrane efflux protein"
FT                   /note="Alternative locus ID: NATL2_01481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58953"
FT                   /db_xref="GOA:Q46HS5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS5"
FT                   /protein_id="AAZ58953.1"
FT                   /translation="MRRVKRKFLIVAGLFISGLNPLWATSSQKITSNTKIKGNSSKSLS
FT                   QNQKQQRVLYELNAPEDLFLPSRSREVLVKTYQKVNLDQLENLLINNNRAIKIYLERVE
FT                   QAKSILKSSLSSWYPTLNLTANGIPQYFESNNFNESSVIQDTSSKQWSSSISAQVKWDL
FT                   INPARVPEIASARDSFEKSKYSYAIILRDLKLEAKKRYFNLQKANEEIEVAKKSIESST
FT                   IGLRDAEIRFESGIGTKLEVLEARTQLARDQQLFNIKLGDQKIGQRSLAEILNFPEDVT
FT                   PLIGTKTQVTGIWDLSLEDSIIAAYNSREELESILLEISINNSNANAALAASQPKLSIV
FT                   NTSTSSFAKGELNQISPNTSNTSSNFSNTIGLNATWFIFDGGNSRSLYNYNKSKAKEAK
FT                   LNFAARRAQIRQEVEQVFFKLESAKLNISASYTEVLSARESLRLAKLRYKSGITTQREV
FT                   VNNQRDLTDSEVRYIISVTSYNTLLADLSRQTGLDNIKPCDIKVNPQNQSDIDSKSLYE
FT                   SNLIPLCQL"
FT   sig_peptide     complement(143881..143955)
FT                   /locus_tag="PMN2A_1465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.982 at
FT                   residue 25"
FT   gene            complement(143993..145342)
FT                   /locus_tag="PMN2A_1466"
FT   CDS_pept        complement(143993..145342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1466"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="Alternative locus ID: NATL2_01491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58954"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS4"
FT                   /protein_id="AAZ58954.1"
FT                   /translation="MSTLRITQNKIKPAVVASIEEGSIGEELGFEVGDRLISINGVKPR
FT                   DLIDYKFLMAEENIQLIILDEKDKQHTIDIEKDYDDELGLAFTEALFDGLKQCNNQCPF
FT                   CFIDQQPPGKRKSLYLKDDDYRLSFLYGSYLTLTNLSKQDWERIEEQRLTPLFVSVHAT
FT                   DPSLRSKLLRNPKAIDLLNQLAWFSKKRIQIHAQIVVCPEINDGKALERTINDLYSFAQ
FT                   GDFPVVLSAAVVPVGLTRFRPSNDGLIPVDPVCATKVINQVEPMQRIFYKSTGSRFAWL
FT                   SDEWYLIAKKALPSLNSYEDLPQKENGVGSIRSFLRAMDEATRDLPTKIDQKKTCSWVV
FT                   GKLVENELQKPCKRINKINNFTLHLYGLPSPYWGQEQIVTGLLTGQDLIKGLRGKELGD
FT                   ELLIPSVMLRQGEKIFLDDMTLQELSLSLNVSVRIVHDAQDIVNKALGKA"
FT   gene            complement(145537..145734)
FT                   /locus_tag="PMN2A_1908"
FT   CDS_pept        complement(145537..145734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1908"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1908"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23846"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA8"
FT                   /protein_id="ABU23846.1"
FT                   /translation="MSLALTGRTFFDLWAWWDCLSKSELIKLSWFSAQPSMNLHSSRYP
FT                   NQTVLGIQIIKFLKKILKTS"
FT   gene            145734..146393
FT                   /locus_tag="PMN2A_1467"
FT   CDS_pept        145734..146393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1467"
FT                   /product="uncharacterized membrane protein"
FT                   /note="Alternative locus ID: NATL2_01511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1467"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58955"
FT                   /db_xref="GOA:Q46HS3"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS3"
FT                   /protein_id="AAZ58955.1"
FT                   /translation="MQFWASTMVVLPVFVQAPWVHVFPFSAFLFSFIIFFLGFYLLKFC
FT                   SYRWSSIGSLLVGVSWSWLGGCLFWGWLRAHPVWHLPVESIALPIAVSLLKTRWKIGAS
FT                   FYLASLLGTAFTDVMIVLTGVMKAWPEVVDAPFSEASKILSLTAEQLLEPFSLFAIFIA
FT                   ALLIISIANWMHQKSKSEPLSSDAWLVSSSALTTTLWVDGLFFATTLIQPQLSGLI"
FT   gene            146407..148107
FT                   /locus_tag="PMN2A_1468"
FT   CDS_pept        146407..148107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1468"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="Alternative locus ID: NATL2_01521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58956"
FT                   /db_xref="GOA:Q46HS2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS2"
FT                   /protein_id="AAZ58956.1"
FT                   /translation="MDLNTGFNKNDIYSTNWDVIVIGAGAAGLMSSLELPSNLKILLLN
FT                   RNTSKRSSSRWAQGGMAAVTRIEDSEDIHANDTIKAGAGLCDSEAVQMFVQSAPRLVDR
FT                   LMKLGMEFDRTSGKLSTTLEAAHTHRRVLHVKDRTGKALVDVLNEQVDQRGNVLHQRGI
FT                   RVTQIWVERGKCSGVQVLDGPALRWIQAKAVVLATGGGGHLFANTTNPTQAAGEGIALA
FT                   WRSGACIEDLEFFQFHPTALKLDNAPSFLISEAVRGEGAVLVDSFGESPVAHLEGKDLA
FT                   SRDQVSRALFQAMQKQKVDHIGLDVKSISVEDVAARFPSIFQRCRELGLEPLKEAIPVA
FT                   PSAHYWMGGVATNLKAQTNVKGLFAIGEVACTGLHGANRLASNSLMECLVFANQMRNIE
FT                   LTDYVTSDILGNNLSFNKSDLRFSKEQGTSYLSKEIEKLRQLCWRAAGVDRSRKGMNSA
FT                   LIKVKRDYENLLNEPLLNLVFSQSKYEINEFEELARRDLNLLLDLSNRQMSSLLMLEAC
FT                   LFREESRGGHFRDDFPTSVPFWQCHTRQMKGKNIHTRPIVDKAGFPKNL"
FT   gene            complement(148094..149035)
FT                   /locus_tag="PMN2A_1469"
FT   CDS_pept        complement(148094..149035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1469"
FT                   /product="thioredoxin domain 2"
FT                   /note="Alternative locus ID: NATL2_01531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58957"
FT                   /db_xref="GOA:Q46HS1"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS1"
FT                   /protein_id="AAZ58957.1"
FT                   /translation="MGPSRLKSRRRQDLGSKWARVAIAILSTVGVIDTGSITLNKWGII
FT                   GNLNCPGGLGGCDKVLNSPWGTFFQTNNFSIPLSLIGLISYLLILLMAIFPLIPILKNQ
FT                   KNNISKVAWWGSFYISTSTFIFSLILISVMIFKIKAFCFFCLLSFLISLSVLLLNIIGG
FT                   SWEDYGKLFFRGFLMSVAVLLAGLIWSSSVDPAIKEVSNNISGMPPAVIAISSPDKIKL
FT                   AEHLTKEGAVMYNAYWCPHCHDQKEMFGKEAAEKLNLVECAKDGFNNKRELCEAKGITG
FT                   FPSWEINGSIDSGVKSLEELADLTNYKDSKDF"
FT   gene            complement(149212..149304)
FT                   /locus_tag="PMN2A_1470"
FT   CDS_pept        complement(149212..149304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1470"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1470"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58958"
FT                   /db_xref="GOA:Q46HS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HS0"
FT                   /protein_id="AAZ58958.1"
FT                   /translation="MGILFYLVFVGAGLSAAFLIQKALKAIKLI"
FT   gene            complement(149367..149768)
FT                   /locus_tag="PMN2A_1471"
FT   CDS_pept        complement(149367..149768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1471"
FT                   /product="dihydropteroate synthase"
FT                   /note="Alternative locus ID: NATL2_01551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1471"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58959"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR9"
FT                   /protein_id="AAZ58959.1"
FT                   /translation="MNNPDLQEDLINSIKLLDAKLSKRQIELDPKGYFLIKIEPKTNEL
FT                   ILEHYLNDIDQKGRAIDPKSGEPIGCKTKSRNQPNNIYRGKSAKQLGIQISEGHGPFPI
FT                   SHLDHAIYIGRELQRAEQCLITGKQYIQD"
FT   gene            complement(149850..150116)
FT                   /locus_tag="PMN2A_1472"
FT   CDS_pept        complement(149850..150116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1472"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58960"
FT                   /db_xref="GOA:Q46HR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR8"
FT                   /protein_id="AAZ58960.1"
FT                   /translation="MTDNNLLDSPETNKSLSTEKDTVDSNEEKPFFAQGIFSYKDKGTQ
FT                   GVITLFGYELTAPAGLKNPGIVYLSFIFINLLIFLILKSFISG"
FT   gene            complement(150148..151329)
FT                   /locus_tag="PMN2A_1473"
FT   CDS_pept        complement(150148..151329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1473"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58961"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR7"
FT                   /protein_id="AAZ58961.1"
FT                   /translation="MNNIKIKWHATIQEIPKIIWNNFLKGNSTPFYKWDWLNALERSKS
FT                   VSTKYGWQPLFLSAWSENDLIACAPLYLKSHSYGEFIFDNAFVQLAQDMGLQYYPKLIG
FT                   MSPLSPIEGYRFLFAEGVNDRDLTQILISEIDSFAKQNGILSCNFLYVDPKWMKVAESL
FT                   NCAKWVNQQSLLTLNEEKSFSDFLQKFNSNQRRNIKRERESIKKCGVKVEALSGSQINV
FT                   MNLKKMHYFYQLHCSRWGVWGSKYLTESFFTELRSTELKENIVLFDAKEEGIDKTIGMS
FT                   LCVKNENMLWGRYWGAEKNIDNLHFEACYYSPIEWAIANKIKYFDPGAGGSHKKRRGFI
FT                   AKPNASLHRWYNLPMDSLIREWLPRANKLMLDQINATNNEVPFKFEEPKLSNT"
FT   gene            complement(151352..152029)
FT                   /locus_tag="PMN2A_1474"
FT   CDS_pept        complement(151352..152029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1474"
FT                   /product="pyrimidine reductase"
FT                   /note="Alternative locus ID: NATL2_01581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58962"
FT                   /db_xref="GOA:Q46HR6"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR6"
FT                   /protein_id="AAZ58962.1"
FT                   /translation="MKKKWVKLVLASSIDGRIAYPEGGKTQLGQSGDRLVLEESLAWSD
FT                   GILMGGQTLRDHQSICLIKNKSLLKKRTSEGKNEQPIALIASNQIDFPENWLFFQQPLQ
FT                   RWLLQMQDKKNEIMLPDGFDKRINLKITWRDSLDDLYQKGIAKIVLLGGANLISAFLLE
FT                   NLIDELQITITPHLIGGDYCWVSSELRNLSTIMNKKNKWILKESQKLGNNELLIRYFRN
FT                   HLS"
FT   gene            complement(152030..152956)
FT                   /locus_tag="PMN2A_1475"
FT   CDS_pept        complement(152030..152956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1475"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase-like
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_01591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58963"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR5"
FT                   /protein_id="AAZ58963.1"
FT                   /translation="MEAITSNFPHGEGRTCVITRRACFSASHLYRLPELSDDDNSALFG
FT                   PCSIAPGHGHNYELIVTMEGDLNKYGMVLNLSDVKHAIKNEVTSQLDFRFLNDTWPEFD
FT                   LSKPEGCLPTTESLVRIIWERLKSHLPLKSLRLYENPKLWADYQGNAMDAYLTVQTHFS
FT                   AAHRLAREDLPQTENEKIFGKCARPNGHGHNYLVDITVKGKINPRTGMICDLSALNSLI
FT                   NDLVVEPFDHTFLNKDIPYFANCVPTAENIALHISDKLTNPINAIGANLYKIKLQESPN
FT                   NAAEVYANVPESTIDTKDSKNQVRLLR"
FT   gene            153009..153605
FT                   /locus_tag="PMN2A_1476"
FT   CDS_pept        153009..153605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1476"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Alternative locus ID: NATL2_01601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1476"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58964"
FT                   /db_xref="GOA:Q46HR4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HR4"
FT                   /protein_id="AAZ58964.1"
FT                   /translation="MAVQSTPKTLKEKLGGRNIFLIGMMGSGKSQTGPVLAKMINYAFV
FT                   DTDDVIEKASKQSISSIFEKDGEKVFRDVEKKVLKEISQHHSLVIATGGGLVTLPENWG
FT                   ILHQGIVIWLDLDLRRSIKRLESDHKRRPLLLGDNLAENFSQIYESRKPIYLESDLRIE
FT                   VEDQSPYEVATMVAEHLQSILIDQEPQAERHTTEL"
FT   gene            complement(153559..153822)
FT                   /locus_tag="PMN2A_1909"
FT   CDS_pept        complement(153559..153822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1909"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1909"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23847"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDA9"
FT                   /protein_id="ABU23847.1"
FT                   /translation="MSDPLIREMDNYVVLVPGESEQFLDKEQTLLWLQSWLNKFDSLPL
FT                   DLDCKSSIAEAAQHLLDTACDLEIKTGFTIQWYAVRLEAPGR"
FT   gene            153821..154552
FT                   /locus_tag="PMN2A_1477"
FT   CDS_pept        153821..154552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1477"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1477"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58965"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR3"
FT                   /protein_id="AAZ58965.1"
FT                   /translation="MRQKFFFFLISILIVFTYTVSALAESSLEINNFQRSKLYERKSIW
FT                   PDWRLPSSIKRPGLKDDLIYPDWFEGVWDVTSEIESDQNQEPIIHSAKFIHNTSGDLIA
FT                   DREYNTKSYALSTKTGGFLSVKNDPKSPNRQFAKLTEDRYLETKIIGRLQEKIDNNIFI
FT                   TDELILQIFHTPEFSRVSQVETLTEFKKCGSIQNNKINMSDFNICGEQFQAIYNQPGQN
FT                   LISLPIKTEKSKLILRKTNDD"
FT   sig_peptide     153821..153895
FT                   /locus_tag="PMN2A_1477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(154539..155258)
FT                   /locus_tag="PMN2A_1478"
FT   CDS_pept        complement(154539..155258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1478"
FT                   /product="glutathione S-transferase zeta class"
FT                   /note="Alternative locus ID: NATL2_01631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58966"
FT                   /db_xref="GOA:Q46HR2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR2"
FT                   /protein_id="AAZ58966.1"
FT                   /translation="MLELHQFRHSPYCLKVRMALAAKKLAYRTVEITPAVGQIDIFQKT
FT                   GQKKLPVLFDNETIIHDSSSIIRHLEKIEIEPKLIPEGLKEASQVQIIENWADTTLAKS
FT                   IKIVFLEELSKNPKLISSLFSNKISDSMQKPLFNIPTKIASQISGLINQKEKESLTLNL
FT                   ENLSNLINQENFLIGDKLSIADISVASHLSLLKFPNSSGENLTGQGCSIYVKDPSLQNL
FT                   FKWRDFIEDQLAITNHH"
FT   gene            155319..155525
FT                   /locus_tag="PMN2A_1479"
FT   CDS_pept        155319..155525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1479"
FT                   /product="uncharacterized membrane protein"
FT                   /note="Alternative locus ID: NATL2_01641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58967"
FT                   /db_xref="GOA:Q46HR1"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HR1"
FT                   /protein_id="AAZ58967.1"
FT                   /translation="MGEFFSNVSRYPKYLITIVLGVFTAAISPLIKRGSNPITAIALVG
FT                   ALLSGLLTIGFLLKAMAFPQAIT"
FT   gene            155528..155899
FT                   /locus_tag="PMN2A_1480"
FT   CDS_pept        155528..155899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1480"
FT                   /product="ribosome-binding factor A"
FT                   /note="Alternative locus ID: NATL2_01651"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1480"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58968"
FT                   /db_xref="GOA:Q46HR0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HR0"
FT                   /protein_id="AAZ58968.1"
FT                   /translation="MANSRRVEKLAALLKREVSELLVNGIRDERIHQAMITITSVEVSG
FT                   DLQHAKIFISLFGEEKKKDEVLVGLEEAKGFIRAELAQRLQMRRSPELVFKIDKGMTKG
FT                   PAVLDLLNALELERKSKDL"
FT   gene            155917..157551
FT                   /locus_tag="PMN2A_1481"
FT   CDS_pept        155917..157551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1481"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="Alternative locus ID: NATL2_01661"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1481"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58969"
FT                   /db_xref="GOA:Q46HQ9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041518"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ9"
FT                   /protein_id="AAZ58969.1"
FT                   /translation="MNKSDLRRQVAELFIVRASGFNLDSQRLYPNLEESNSNLKRLLEE
FT                   GVGGVIVLGGTVKELEIRCNILKKWSGRPLLLCADIEEGVGQRFYGGTKFVPPMGIAQI
FT                   YKKDQTLAISIAEKIGYFTGKEAKKIGLNWLLAPVCDINNNPNNPVINLRAWGEEPETV
FT                   KSLTSAFQRGVSRSKMLTCAKHFPGHGNSEVDSHLDLPEIHHDLSKLEKFELIPFKSLI
FT                   NQGVNSVMIGHLLFPKIDPIFPATLSKRVVTDLLRIKFKYDGLVVSDALVMNAITNKYS
FT                   SGKAAVMAFDAGIDLIMMPKDIDEAIDSLTDAFYSGKISLERLNISRERRKKQLDLVSN
FT                   EADFKKEDLNNEDIKNKFLLDASKFSNSIIKSSIFVREESTIKAEYNDINLIQIDNFDQ
FT                   VANKFIPALDFPKAVGFKNLIIHPLGISPWGKTNKNFLELGQFSNSKILVQLFVRGKPF
FT                   IGLDYHNDHWIDTIEKLEFEQRLSGIIIYGCPYLFDKIKKTIHKNIPLAYSPSQTEEAQ
FT                   NQILSRILQSKTTQKEIDKESSIEFTD"
FT   gene            157638..158438
FT                   /locus_tag="PMN2A_1482"
FT   CDS_pept        157638..158438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1482"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="Alternative locus ID: NATL2_01671"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1482"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58970"
FT                   /db_xref="GOA:Q46HQ8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ8"
FT                   /protein_id="AAZ58970.1"
FT                   /translation="MKHTEMSLTDKKIIITRAQEQTSEARKIFRKNGAEVFDLPSLVIG
FT                   PPDDWAPLDDALKKISTFDWIIFSSANGVRNVEDRMREIGLSLSKISKTIQIAAVGRKT
FT                   ASLLSDMDAEISFVPPSFVADSLLEYFPQNQKGLKLFIPRVQTGGRSILSDSFRLNGAE
FT                   VTEVAAYESSCPKDVPQKTIEALKSGEIDIIAFTSGKTVINTVSLFNKYFGGNWFKLIE
FT                   KIKLVSIGPQTTISCKKLIRKPDKEAEPHDLEGLLNACLELKFN"
FT   gene            complement(158441..158893)
FT                   /locus_tag="PMN2A_1483"
FT   CDS_pept        complement(158441..158893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1483"
FT                   /product="oligoketide cyclase/lipid transport protein-like
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_01681"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1483"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58971"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ7"
FT                   /protein_id="AAZ58971.1"
FT                   /translation="MGKWLDHTVITEIHAPVELVWKFWSDLDSMPLWMTWIESVKAVDQ
FT                   KTSTLPDLTEWTLAANGFRFKWKAQITERVEAEKLEWKSVGGLPTKGAVRFYNEESSKT
FT                   VVKLKISYELPQVLANLMKANILGGMVTKELQKNLDGFKELVEKSA"
FT   gene            complement(158897..160357)
FT                   /locus_tag="PMN2A_1484"
FT   CDS_pept        complement(158897..160357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1484"
FT                   /product="zeta-carotene desaturase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Alternative locus ID: NATL2_01691"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1484"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58972"
FT                   /db_xref="GOA:Q46HQ6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ6"
FT                   /protein_id="AAZ58972.1"
FT                   /translation="MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDS
FT                   DGNHIEMGLHVFFFNYANLFELMRKVGAFENLLPKDHTHLFVNKGGDIKSLDFRFFAGA
FT                   PFNGLKAFFTTPQLNWIDKLRNALALGTSPIVRGLIDYEGAMKTIRSLDSISFQKWFLN
FT                   HGGSINSIKRMWNPIAYALGFIDCEAISARCMLTIFMMFASKTEASKLNLLKGSPHKWL
FT                   TKPILDYIEQRGGRLHLENIVKEIHSDDSDHPSVTGITLQTPEGEKKIQADKYLAACDV
FT                   SGIKRIIPRSWRRFKEFDLLFKLDAVPVATVQLRYDGWVTEINNKQAQKNLNNPSGLDN
FT                   LLYTADADFSCFADLALSSPEDYKKEGQGSLLQCVLTPGDPWITKSSDELVKHTDLQVR
FT                   TLFPSSRDLKLLWSNVVKVSHSLYREAPGMEPYRPDQKTSFSNFFLAGSYTKQDYIDSM
FT                   EGATMSGHLAASAMLSKSVSLAKNPSVA"
FT   sig_peptide     complement(160295..160357)
FT                   /locus_tag="PMN2A_1484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.678) with cleavage site probability 0.271 at
FT                   residue 21"
FT   gene            160463..160852
FT                   /locus_tag="PMN2A_1485"
FT   CDS_pept        160463..160852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1485"
FT                   /product="HesB/YadR/YfhF"
FT                   /note="Alternative locus ID: NATL2_01701"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1485"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58973"
FT                   /db_xref="GOA:Q46HQ5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ5"
FT                   /protein_id="AAZ58973.1"
FT                   /translation="MIESNAPPTTHKAQDGKGVLITTPALDQLSRLCKEQGSGKLLRVG
FT                   VRSGGCSGMSYTMDFVSDDDIQKDDEVYEYSVGTSSFKVICDPKSLLYIYGMQLDFSTD
FT                   LIGGGFNFTNPNASQTCGCGSSFAV"
FT   gene            160884..161303
FT                   /locus_tag="PMN2A_1486"
FT   CDS_pept        160884..161303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1486"
FT                   /product="TPR-repeat protein, specific for cyanobacteria"
FT                   /note="Alternative locus ID: NATL2_01711"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58974"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ4"
FT                   /protein_id="AAZ58974.1"
FT                   /translation="MDQPDESLFEEALNRYKAGSPADELIEDFQKIASSTPNNAAAWTC
FT                   LSWLQLLCDSPQEALRSARYAVKLNGQDPQSRINLSLALLETNSKGVRDHIDYVKRAML
FT                   VLPELEKELKESFEDGLSRKPDWKTLLKIKNWLDL"
FT   gene            complement(161330..162259)
FT                   /locus_tag="PMN2A_1487"
FT   CDS_pept        complement(161330..162259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1487"
FT                   /product="Conserved hypothetical protein YfcH"
FT                   /note="Alternative locus ID: NATL2_01721"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1487"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58975"
FT                   /db_xref="GOA:Q46HQ3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ3"
FT                   /protein_id="AAZ58975.1"
FT                   /translation="MKLLLTGCTGFIGRELIPLLIKEGHSLTVISRQSKGKIQTIPNEQ
FT                   NINFIQMNPAESSSWDKEEIQNSLKSCEGVINLAGEPIAEKRWTTDHCKEITNSRIETT
FT                   KNLIKSLRNLRKPPKVLINASAIGFYGSNPQTEFTEENIQGDDFLANLCKEWESSAKNK
FT                   PRATRLLIVRIGIVLAKDGGALGKMLPIFRAGLGGPIGDGKQWMSWIHRTDLCNLINES
FT                   VKNSAWSGVVNGVAPNPVRMNEFSNSLGQVLGRPSLFAVPAPILKLILGDGARVVLEGQ
FT                   NVQTQRLNKLKFKFNFPMINEAFKSILA"
FT   gene            162449..162712
FT                   /locus_tag="PMN2A_1488"
FT   CDS_pept        162449..162712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1488"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01731"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1488"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58976"
FT                   /db_xref="GOA:Q46HQ2"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HQ2"
FT                   /protein_id="AAZ58976.1"
FT                   /translation="MSEQTGKVDDSQSPPKVQKKLRKGDLVKVDREKYSNSLESKASDT
FT                   NLPEYIFQGPGEVLLIKGDYCQVRWRRPVPDVWINSDHIVSY"
FT   gene            complement(162735..163385)
FT                   /locus_tag="PMN2A_1489"
FT   CDS_pept        complement(162735..163385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1489"
FT                   /product="Heat shock protein DnaJ, N-terminal protein"
FT                   /note="Alternative locus ID: NATL2_01741"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1489"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58977"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ1"
FT                   /protein_id="AAZ58977.1"
FT                   /translation="MSKDPYQILKVHPSAKLEEIKKAYRKLVKIHHPDKGGNSAVMLEV
FT                   NSAWEILKKKHKDLNLNKVNNSKLYNQNEYKREANSHSKPEDLKKWFQNIYLPIDKLLG
FT                   QIINPMGAKIRDLSADPYDEILMDSFCLYLEQSKNKITKIKKIYTSFACPSIIRDFSLD
FT                   LYHCLSHVEDGINELERYTMGYVDNYLHDGKAMIAFAKKKRKFLQSNKKEWLH"
FT   gene            complement(163406..164374)
FT                   /locus_tag="PMN2A_1490"
FT   CDS_pept        complement(163406..164374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1490"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="Alternative locus ID: NATL2_01751"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58978"
FT                   /db_xref="GOA:Q46HQ0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HQ0"
FT                   /protein_id="AAZ58978.1"
FT                   /translation="MPIANDITYLVGQTPLVKLNRLPNEFDCRAEIIAKLESFNPTASV
FT                   KDRIAGAMVMSAEKEGTIKPGHTVLVEPTSGNTGIALAMVAAAKGYRLILTMPDTMSTE
FT                   RRSMLRAFGAELQLTPGQEGIQGAIQLAKELVASIPNAYLLQQFDNLSNPEIHEKTTAE
FT                   EIWEDCEGKLDALIAGVGTGGTITGCARFLKQKNPKIKVFAVEPSSSPVLSGGNPGSHA
FT                   IQGIGAGFIPNVLDMNQIDEVIRINDNEAMDIGRRLAKEEGLLSGVSSGAAVAAALKVG
FT                   NQPEFANKRLIVILPSFGERYLSTTMFTSIPAKPVKGNEYL"
FT   gene            complement(164419..164538)
FT                   /locus_tag="PMN2A_1910"
FT   CDS_pept        complement(164419..164538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1910"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01761"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1910"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23848"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB0"
FT                   /protein_id="ABU23848.1"
FT                   /translation="MGNALGQYQRIIPPIYISKRPIKLLNNKFSSIIKKELNY"
FT   gene            164512..166083
FT                   /locus_tag="PMN2A_1491"
FT   CDS_pept        164512..166083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1491"
FT                   /product="unknown"
FT                   /note="Alternative locus ID: NATL2_01771"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58979"
FT                   /db_xref="GOA:Q46HP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP9"
FT                   /protein_id="AAZ58979.1"
FT                   /translation="MILTESISHNCRPPILWIFLFWTIACGIAFVSLGNLPLRDFDEAT
FT                   VARVALELNQKSGLERLLPSIWDKPYLNKPPGLHWIISFAIGISRNFQNNFDFLPSEFC
FT                   IRFFPALFSTFVVPLGGLIQWNLRPKDRIACITTSAILLTLLPIIRYGRMAMLDGTQLS
FT                   AIALLWFCLSSIKNNRPTNFNFLGAGFTCSFMLLLKAPVIIPALFASLLPLIWEYKSKK
FT                   YFNNFSWSWFFYGLIPGFAWHVWNFISYGSGAFWLWWGDGAGRVLFEKGSGSELGVLVP
FT                   IIEILEGGWPWILLWPIGFLWACFSLNTRWGVWALSTQIIILGSILPLKMQLPWYIHPF
FT                   WLPFALVCGPPVSWLIHREENGYIFARKILRKIPYIFSLIGLCIFTFSLLLKLNIFNFG
FT                   EGYFYAIFFISLAWFIGGLLLSNSRKNIRKIGFIGLIVGSIIGLFFFVSSKFWLWEINE
FT                   NWDVRPVAEFIDGFPNQQIFIRNSFERPSLNWYARKQIKSFDEENKTKCKVLKKTNAWD
FT                   LYTCND"
FT   gene            166166..166426
FT                   /locus_tag="PMN2A_1492"
FT   CDS_pept        166166..166426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1492"
FT                   /product="conserved hypothetical protein in cyanobacteria"
FT                   /note="Alternative locus ID: NATL2_01781"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1492"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58980"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HP8"
FT                   /protein_id="AAZ58980.1"
FT                   /translation="MYCIELTIKLSPMPLVVQRKEHGEAKRLYSDVVGSIENGNPRLLE
FT                   LTCEKVEDKRITVLVSEITAVQIYEKTSSSTSKRPGFSLQN"
FT   gene            166450..167136
FT                   /locus_tag="PMN2A_1493"
FT   CDS_pept        166450..167136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1493"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_01791"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1493"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58981"
FT                   /db_xref="GOA:Q46HP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP7"
FT                   /protein_id="AAZ58981.1"
FT                   /translation="MKPTAWSGYLEFDQVSFSWPNGVNVINQCSFSILKPGLWMLVGEN
FT                   GSGKSTLFRLINGGIRPKSGKIFCSLRPSMVYQNPDHQLLMPTCKSELMLSVPKTITQT
FT                   NLLDLIHSALEKVDLGEMLDRPIHTLSGGQKQRLALAGAIVSNSNLLLLDEPTALLDPQ
FT                   SQNSVLKVMKKLTSSSADPITAIWVTHRLEELYFCDGAAIVKNGAISNWNSGSKVFQEL
FT                   KSLALR"
FT   gene            167166..167237
FT                   /locus_tag="PMN2A_R0030"
FT   tRNA            167166..167237
FT                   /locus_tag="PMN2A_R0030"
FT                   /product="tRNA-Asn"
FT   gene            167600..168397
FT                   /locus_tag="PMN2A_1494"
FT   CDS_pept        167600..168397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1494"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="Alternative locus ID: NATL2_01801"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58982"
FT                   /db_xref="GOA:Q46HP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP6"
FT                   /protein_id="AAZ58982.1"
FT                   /translation="MKPCILLIEDDQDMRDLVAGHLEHTGFDVQKAEDGIKGQALALQY
FT                   APDLILLDLMLPKVDGLTLCQRLRRDERTSAIPILMITALGGIKDKVTGFNSGADDYIT
FT                   KPFDLEELQVRIKALLRRTNRAPLGSNNQQEILDYGPLTLVPERFEAIWFESPVRLTHL
FT                   EFELLHCLMQRHGQTVAPSLILKEVWGYEPDDDIETIRVHVRHLRTKLEPDPRKPRFIK
FT                   TVYGAGYCLELPTGDKISEIQPSITQARETNSFKNNTDERVIA"
FT   gene            complement(168394..169353)
FT                   /locus_tag="PMN2A_1495"
FT   CDS_pept        complement(168394..169353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1495"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Alternative locus ID: NATL2_01811"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58983"
FT                   /db_xref="GOA:Q46HP5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP5"
FT                   /protein_id="AAZ58983.1"
FT                   /translation="MDDFQNIFGQDLAIKILKSAISKEHISHAYLFSGPEGVGRKKTAK
FT                   IFINSILDKNQEKKSTKIKINNNNHPDLLWVEPSYIVQGQSISQTKAILDGISMKSPPQ
FT                   IRLNQIKEIIEFLGKKPFESERSIVIIEDIERINESAANALLKTLEETCTGLFILITQR
FT                   PEKLLSTIRSRCQIVPFIRLNDNQVNKIIKKSEVIQEIDDITSNKIQELIDFSYGSPGR
FT                   CIVNLQFWLSLSTSLRQKLEIQLNNPIELLKLAKEITDELNIEQQLWLIDFQQNRAWIK
FT                   EKNSNIVIQLEELRKQLLKFVQPRLAWEVTLLEINFLN"
FT   gene            complement(169355..169990)
FT                   /locus_tag="PMN2A_1496"
FT   CDS_pept        complement(169355..169990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1496"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Alternative locus ID: NATL2_01821"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58984"
FT                   /db_xref="GOA:Q46HP4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HP4"
FT                   /protein_id="AAZ58984.1"
FT                   /translation="MKGKFIVFEGIDGSGKTTQINQLSKWLISSDLIPENNKLVITREP
FT                   GGTKLGKSIRSLLLDTSIEKSPDSITELLLYAADRSQHINEIIRPTLDQGDWVISDRFC
FT                   GSTLAYQGYGRKLDINLIKDLEAIATQGIAPDITFLLDIPIEESIRRRRNRKDDRIEKE
FT                   GREFLSNVSLGFQALSEDSNWKKISAIDSKEKIISEIKSEIKKLIKNK"
FT   gene            complement(169987..172317)
FT                   /locus_tag="PMN2A_1497"
FT   CDS_pept        complement(169987..172317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1497"
FT                   /product="ATPase, E1-E2 type:Copper-translocating P-type
FT                   ATPase:Heavy metal translocating P-type ATPase"
FT                   /note="Alternative locus ID: NATL2_01831"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1497"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58985"
FT                   /db_xref="GOA:Q46HP3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP3"
FT                   /protein_id="AAZ58985.1"
FT                   /translation="MSNKKIAQSKKSILLDIDGMRCGSCVQAVEKILKNHPNINNASVN
FT                   LVTKTALVEIKEPNYPFSDVIQTLTSKGFPTTERPDQTITKNTELERNENQNLWNKWRQ
FT                   LIIATSLLILSGLGHLVEGQQISFPLIGSLPFHAALATFALLGPGKSILNAGLKSAIML
FT                   TPTMDTLVSLGVMSAYIASIIALIWPTVGWPCFFNEPVMLLGFVLLGRFLEERARINTG
FT                   TALKELAKLQPETANLILDNNEIREIRIGALKPGEKIQLLAGDRIPVDGLVIKGNSAID
FT                   ISSLTGESLPLEATPGVELPSGSLNLESTITLEVQKIGSETAIAKIISLVEEAQARKAP
FT                   IQGLADKVAGMFCYGVTTLALITFLFWWRIGTRIWPEVLEVSNAGFMHSHNLHDHLMNT
FT                   PQTPIGLSFQLSIAVLVVACPCALGLATPTVITVASGEAAKRGWLFKGGDVIEMASKIS
FT                   QIIFDKTGTLTIGRPLVVGCWKNNELERNFMLQLAASIEQESRHPLAQAIIQEAHKKEI
FT                   KLEKVSSSTTYPGKGLAGKINNLEGLIRVGTPEWIKSEGIEWNAMIENNFKLSKRKAQS
FT                   IVAVALDNKLLGFFLIDDQIRKDAFLSINKLRSRGFSLSLFSGDRDSAVLSIGEKLGFS
FT                   SKQVTWQMLPSDKLNKLNLLKNNGLVAMIGDGINDAPALAAADLGVAIGTGTQIAQDSA
FT                   DLVLLGENLEALPNALNLSKQAMLKIKQNLAWAFGYNLIALPIAAGLLLPSSGLLLSPP
FT                   LAALLMALSSISVVLNALSLKSK"
FT   gene            172479..173000
FT                   /locus_tag="PMN2A_1498"
FT   CDS_pept        172479..173000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1498"
FT                   /product="TPR repeat"
FT                   /note="Alternative locus ID: NATL2_01841"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1498"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58986"
FT                   /db_xref="GOA:Q46HP2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HP2"
FT                   /protein_id="AAZ58986.1"
FT                   /translation="MPRSQNKDNFLDKAFTKMAEGIVKVMPIDSKEKEAYLYYRKGLAA
FT                   QNDGDYSEALEYYEESLKLEDNQVDRGETLKNMAIIYMSNGDEERAINTYKKALGQNPK
FT                   QPSCLKNMGLIYEKRGRMAQRNGNQDECDIWFDQAAEVWSKAVRLYPGGYLDIENWLKT
FT                   TGRGNVDVYL"
FT   gene            complement(173017..174396)
FT                   /locus_tag="PMN2A_1499"
FT   CDS_pept        complement(173017..174396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1499"
FT                   /product="DNA repair protein RadA"
FT                   /note="Alternative locus ID: NATL2_01851"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58987"
FT                   /db_xref="GOA:Q46HP1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP1"
FT                   /protein_id="AAZ58987.1"
FT                   /translation="MSRSVSIYVCQSCGAQTRQFFGRCNNCGEWNSIIEEKINQKSDKS
FT                   IYTKINSPKEKSPYRSELISQTKNQLIERISSGYKELDRVLGGGLVPGSLVLIGGDPGI
FT                   GKSTLILQSATEMAHHKSVLYVAAEESAQQVKLRWNRIEDAESNLHLLAETDLEMVIKE
FT                   LDHLKPEVAVIDSIQALHDQSLSSSPGSVAQVRECSAALQQIAKRQNISLLIIGHVTKD
FT                   GMLAGPKVLEHLVDAVLTFEGDRFASHRLLRGVKNRFGATSELGVFEMQADGLSEVPNP
FT                   SELFLSKTSAPGISTIVTCEGTRPLAIDIQALLNPTSYASPRRTTTGIEINRLHQILAV
FT                   LEKNMNLSLSRYDCYLAVAGGLEVEEPGADLGIAAAIVSSLKDIELEEGVVFIGEIGLA
FT                   GQLRLVRQMQQRINEVIRLGYKTLIIPDGIDTSEFETNQKLKILKASNINQALIYALDN
FT                   N"
FT   gene            174504..175250
FT                   /locus_tag="PMN2A_1500"
FT   CDS_pept        174504..175250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1500"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="Alternative locus ID: NATL2_01861"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58988"
FT                   /db_xref="GOA:Q46HP0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HP0"
FT                   /protein_id="AAZ58988.1"
FT                   /translation="MTATSPSKETILVADDEASIRRILETRLSMIGYQVVTACDGNEAL
FT                   DLFRNCEPDLVVLDVMMPKLDGYGVCQELRKESDVPIVMLTALGDVADRITGLELGADD
FT                   YVVKPFSPKELEARIRCVLRRVEKEQIAGLPNSGVIAVMNLKIDTNKRQVYRNDERIRL
FT                   TGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPAN
FT                   PELILTARGTGYLFQRIVDSMIPEGS"
FT   gene            175255..176577
FT                   /locus_tag="PMN2A_1501"
FT   CDS_pept        175255..176577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1501"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /note="Alternative locus ID: NATL2_01871"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1501"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58989"
FT                   /db_xref="GOA:Q46HN9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN9"
FT                   /protein_id="AAZ58989.1"
FT                   /translation="MEKNHLNNKTNRSKAIRRLVIWYRRNSAVTSLVDTATSSATAASN
FT                   VAGTVVSNAGSVVTSAGSIARSTLEPFVFDPLRRLQGGESTDEKNTIQDSDRIWVAVDG
FT                   MGGDYAPGAILDGCLKSLSLLPLKIKFVGEIDKIKKAALEFGLEESLDKAIDDGNFELI
FT                   ASGLSVGMDEEATAVRKKKDASINIAMKLVKDGKAMGVYSAGNSGAMMASGIFKLGRLK
FT                   GIDRPAIGALFPTKDPGQPVLVLDVGANMDCKPTYLHQFALLGNIYSRDVLQVDKPRIG
FT                   LLNIGEESCKGNELSQATYKLLNEEERFCFSGNCEGRDVLSGDFDVVVCDGFTGNVLLK
FT                   FLESVGSVLLGVLRAELPRGRRGKVGSAFLRNNLKRIKKRLDHAEHGGALLLGINGICV
FT                   VGHGGSKALSVLSALRVVHSAASHGVMDDLADLNQPVVLKV"
FT   sig_peptide     175255..175383
FT                   /locus_tag="PMN2A_1501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.904 at
FT                   residue 43"
FT   gene            176635..177651
FT                   /locus_tag="PMN2A_1502"
FT   CDS_pept        176635..177651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1502"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="Alternative locus ID: NATL2_01881"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1502"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58990"
FT                   /db_xref="GOA:Q46HN8"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HN8"
FT                   /protein_id="AAZ58990.1"
FT                   /translation="MISNSQLDLGISFVGSGSATPQKIIKNDQLGQRVDTNDEWIQTRT
FT                   GIGQRRVIGENESLIDLATDAAVNAVKMADWDVQTIDLIILATSTPEDLFGSAPKIQSN
FT                   LGASNAVAFDLTAACSGFLFALVTASQYLASGSMKRALVIGADQLSKWVDWDDRKTCVL
FT                   FGDGAGAVALESSGDESGLIGYDLKSDGSKGGCLNLSQSNVFLDLVQGANHQKGEYLPI
FT                   KMEGKEVYKFAVKEVPIILGEILEKCQIKSESIDWLLLHQANQRILDAVASRFSIPSEK
FT                   VLSNLKYYGNTSAATIPLMLDEAVRDKRIKSGDLIACSGFGAGLSWGAALFYWHGPY"
FT   gene            177679..178575
FT                   /locus_tag="PMN2A_1503"
FT   CDS_pept        177679..178575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1503"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /note="Alternative locus ID: NATL2_01891"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58991"
FT                   /db_xref="GOA:Q46HN7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN7"
FT                   /protein_id="AAZ58991.1"
FT                   /translation="MTIAWVFPGQGSQKLGMANSLQDLPGSRERFELASQILGRDLWKI
FT                   CSGEVAPNEEIYDLNDTRNTQPALFVVESLLVDDLKRQGRETHMIAGHSLGEIVGLYSA
FT                   DVLDAKTALILLKKRSELMAAAGGGAMIAVMGFDRDELDDLIRETEGASIANDNSESQV
FT                   VLSGSPEAVRKVADNLKCKRAIPLKVSGAFHSIFMTEASKSFNEELDQVTFQDSQVPVL
FT                   SNVDPTPTVNGDILKDRLKKQMTTGVRWRETMQVMQNKGITTMVEIGPGNVLSGLAKRS
FT                   MKGTMTSQISNASDLGY"
FT   gene            178626..179258
FT                   /locus_tag="PMN2A_1504"
FT   CDS_pept        178626..179258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1504"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="Alternative locus ID: NATL2_01901"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1504"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58992"
FT                   /db_xref="GOA:Q46HN6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN6"
FT                   /protein_id="AAZ58992.1"
FT                   /translation="MPRQSFVYACVSYLFVFPIFRFLFRGQTKGISNLPNTGGVVIVSN
FT                   HGSHLDPPILGHALGRPVAFMAKSELFNVPLLSFIISACGAYPVKRGAGDREALRNASN
FT                   RLVEGWATGVFLDGTRQENGRVNDPKAGAALLAARTGSPILPVAIVNSHRAFPKGSLLP
FT                   RFVSIHLRVGELIQPPKTRKREDLTSTTKEIQISINSMLDQGLIKNI"
FT   gene            complement(179310..179969)
FT                   /locus_tag="PMN2A_1505"
FT   CDS_pept        complement(179310..179969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1505"
FT                   /product="inactive putative metal-dependent protease"
FT                   /note="Alternative locus ID: NATL2_01911"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1505"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58993"
FT                   /db_xref="GOA:Q46HN5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN5"
FT                   /protein_id="AAZ58993.1"
FT                   /translation="MTNFHNSKSKFLLALHSSSQSFGIAIKDTENSEKIIRSEVFNIGR
FT                   SLSNKLFSCIETMLPRKFWKQIIRISVAKGPGSFTSTRLTISMARTIAQQIDCSLDSMS
FT                   SFHLMAPRLYKDLNKNQILNSFWIKDLLPRRGIVAGKYQLVKIHKGSNFHEFNEIISPQ
FT                   LTSNEKILNPSIEASNNIEKDIISLINFSQYCHDSNLSSDWRKTLPIYPTSPIDNK"
FT   gene            complement(179987..180238)
FT                   /locus_tag="PMN2A_1506"
FT   CDS_pept        complement(179987..180238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1506"
FT                   /product="putative Ycf34"
FT                   /note="Alternative locus ID: NATL2_01921"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1506"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58994"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN4"
FT                   /protein_id="AAZ58994.1"
FT                   /translation="MCICVDCAWVDRCKTYYTVEEHHQVKHLSKNPDFQGTNPKIHINI
FT                   IDMPDSETGIEWDVRGCDSFHQDLGKWSRLRPGEEIPK"
FT   gene            180268..181455
FT                   /locus_tag="PMN2A_1507"
FT   CDS_pept        180268..181455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1507"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /note="Alternative locus ID: NATL2_01931"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58995"
FT                   /db_xref="GOA:Q46HN3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN3"
FT                   /protein_id="AAZ58995.1"
FT                   /translation="MISKDTLLSNDLFGDLNPRDWPISISDLPPGSALVGGSVRDALLN
FT                   KLSQKPDLDFVIPTNAINFSENLSKKINGTFIKLDEKRDIARLVINGWTLDFARQVGEN
FT                   LQDDLLRRDFRINAIALRLTGKPEIFDPTGGINDLKSKKIVAISEKNLLDDPLRILRGF
FT                   RFMCELDFELEKKTKTFLKNNVDKLSNIAPERMKMEILKIVNSKWNSSVWKTYLELQLL
FT                   NEWNDNNFPYIELERKDISTKNLIFGSFLSKLIFLLSDEGLSRLTFSKNQIKRCKNLRF
FT                   WVHKINKLDDLSEDERFQLHIDLEEDLPSFILFLKERDSSPWLKRWKDPHDPLFHPSAP
FT                   FDGHLLQKAFGIPPGPFLGELIRYLSREKAYGRISTNNEAMEVARKWTLENSPFL"
FT   gene            181522..181953
FT                   /locus_tag="PMN2A_1508"
FT   CDS_pept        181522..181953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1508"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /note="Alternative locus ID: NATL2_01941"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58996"
FT                   /db_xref="GOA:Q46HN2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN2"
FT                   /protein_id="AAZ58996.1"
FT                   /translation="MSVRLYIGNLPQNVNVKELEALLTSIGEGIKFKAVFDRDTKACRG
FT                   FGFANIKDENVANELIEKLNGQEFNGNKLRVERSERKDSNSGNSRRGGNANNGNKGSSR
FT                   KDVKKVVHSDAPMKEAPDPRWAGELSKLKDLLANQKTPA"
FT   gene            complement(181958..182896)
FT                   /locus_tag="PMN2A_1509"
FT   CDS_pept        complement(181958..182896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1509"
FT                   /product="phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="Alternative locus ID: NATL2_01951"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58997"
FT                   /db_xref="GOA:Q46HN1"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN1"
FT                   /protein_id="AAZ58997.1"
FT                   /translation="MAQPSLNLEDAYEACRKETAQWAKTFYLGTMLLPPAKRRAIWAIY
FT                   VWCRRTDELMDSTEAQKKSRNELSDRLNQWEDKTKNIFAGNTQDDLDAVLADTLQKFPQ
FT                   SIQPYIDMIEGQRMDLDTTRYKTFEELELYCYRVAGTVGLMTQGVIGIDAAYTRNPNLP
FT                   PPDTSRAAIALGIANQLTNILRDVGEDRGRGRIYLPLEDLKKFNYSEEDLFKGTINENW
FT                   KALMAFQLARARDWFQKSEEGIKWLSIDARWPIWTSLRLYSGILNSIEKIDYDVFSNRA
FT                   YVKGWVKAVNLPISYLITINDEKYKLRTLIN"
FT   gene            complement(182972..184366)
FT                   /locus_tag="PMN2A_1510"
FT   CDS_pept        complement(182972..184366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1510"
FT                   /product="zeta-carotene desaturase / three-step phytoene
FT                   desaturase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Alternative locus ID: NATL2_01961"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58998"
FT                   /db_xref="GOA:Q46HN0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HN0"
FT                   /protein_id="AAZ58998.1"
FT                   /translation="MRVAIAGAGLAGLSCAKYLADAGHTPFVYEARNVLGGKVAAWKDD
FT                   DGDWYETGLHIFFGAYPNMLQLFKELDIEDRLQWKSHSMIFNQPEEPGTYSRFDFPDLP
FT                   APINGVAAILSNNDMLSWPEKISFGLGLVPAMLRGQNYVEDCDKYSWTEWLKKQNIPER
FT                   VNDEVFIAMSKALNFIGPDEISSTVLLTALNRFLQEKNGSKMAFLDGAPPERLCQPIVD
FT                   HIRTLGGDVFLNSPLKKINLKEDGSVENFLIGSAKEPQGKEIQADAYVSAMPVDIFKTI
FT                   LPNEWASQDIFRKLEGLKGVPVINIHLWFDRKLTNIDHLLFSRSPLLSVYADMSITCKE
FT                   YEDPNRSMLELVFAPAKDWIGRKDEEIIDATMQELKKLFPMHFSGDNQAKLRKYKVIKT
FT                   PKSVYKAVPGCQDLRPDQKTPIRNFFLTGDYTMQKYLASMEGAVLSGKICAEKIQISTD
FT                   IGSSTS"
FT   sig_peptide     complement(184304..184366)
FT                   /locus_tag="PMN2A_1510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.809) with cleavage site probability 0.772 at
FT                   residue 21"
FT   gene            184471..184818
FT                   /locus_tag="PMN2A_1511"
FT   CDS_pept        184471..184818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1511"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /note="Alternative locus ID: NATL2_01971"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1511"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ58999"
FT                   /db_xref="GOA:Q46HM9"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HM9"
FT                   /protein_id="AAZ58999.1"
FT                   /translation="MSNTILKCTTRHVRIFTAVVENNDLIFDNGHLTLDIDPDNEFSWS
FT                   DQSIKKVQDYFRELVDFQADNELSDYSLRKIGSLLEDFIRKLLKDGELSYNPNSRVMNY
FT                   SMGLPRTQELL"
FT   gene            184815..185474
FT                   /locus_tag="PMN2A_1512"
FT   CDS_pept        184815..185474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1512"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_01981"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1512"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59000"
FT                   /db_xref="GOA:Q46HM8"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM8"
FT                   /protein_id="AAZ59000.1"
FT                   /translation="MNQGPYNRRPSSRRRSDLARRQEGNRFNSRKDSNVRDQYESRGSR
FT                   FQSSGPSGGGGGGIKINSNSIAILAGVLVIGVGIGSLITSTTSGGQGNIASQQQLDMAV
FT                   PDPDFCRQYGASAFVIDVEMYTTLNPSTSFVTQPALQPGCVIRRENWTVLQKQGAINNE
FT                   DVRECKQRMNTFAYIGSIRDQPIVRCVYQADVNENKFIIRGAEEDAVGINKEAIQF"
FT   gene            complement(185471..186421)
FT                   /locus_tag="PMN2A_1513"
FT   CDS_pept        complement(185471..186421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1513"
FT                   /product="RuBisCO operon transcriptional regulator"
FT                   /note="Alternative locus ID: NATL2_01991"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59001"
FT                   /db_xref="GOA:Q46HM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM7"
FT                   /protein_id="AAZ59001.1"
FT                   /translation="MAEIPFTLDQLRILKAIVDEGSFKKAADSLFVTQPAVSLQVQNLE
FT                   KQLDIAIFDRGGRKAQLTEAGKLLLNYCEKILGECLETCKAVEDLNNLKGGSIIIGASQ
FT                   TTGTYLMPRMIGVFRQKYPEVSVQLQIHSTRRTGWSVANGQIDIAIIGGQLPLELNELL
FT                   EVIPFATDELALVLPTNHPLAKSKELTKEDLYSLRFITLDNQSTTRKVLDQLLSSSGLD
FT                   VQRLHIEMELNSLEAIKNAVQSNLGAAFLPVVSIERELSGGSIHRPIVADLEVKRELKV
FT                   ITNPGRYSSRAAEAFTRDILPLFASSFSPLFNPQN"
FT   gene            186530..187276
FT                   /locus_tag="PMN2A_1514"
FT   CDS_pept        186530..187276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1514"
FT                   /product="conserved NnrU/NnuR ortholog membrane enzyme"
FT                   /note="Alternative locus ID: NATL2_02001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1514"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59002"
FT                   /db_xref="GOA:Q46HM6"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM6"
FT                   /protein_id="AAZ59002.1"
FT                   /translation="MTLSDTHGSSFVMILLLFCFAVIHSGGAALRVKAESVIGARAWRL
FT                   IFAFASIPSAVILVGYFIAHRYDGFRFWNLQGVSELIPLIWILSAISFLFLYPATYNLL
FT                   EIPAVLKPKVRIYATGIIRVTRHPQAIGQIIWCFAHLLWIGTSFTLVTCLGLIAHHLFA
FT                   IWHGDRRLSLKFGQEFEDVKKRTSVVPFLAVLDGRQKLQIKEFLRPSQMGILIAVFFFW
FT                   WSHKFISVGAQRFLSFDLTELLARIA"
FT   sig_peptide     186530..186616
FT                   /locus_tag="PMN2A_1514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.810) with cleavage site probability 0.307 at
FT                   residue 29"
FT   gene            187302..189308
FT                   /locus_tag="PMN2A_1515"
FT   CDS_pept        187302..189308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1515"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_02011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1515"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59003"
FT                   /db_xref="GOA:Q46HM5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM5"
FT                   /protein_id="AAZ59003.1"
FT                   /translation="MHSAADFAWLIPLLPLCGAVLIGLGLISFNDLFNRSRKPVAITLL
FT                   TSVGASAFISYAVLAEQLSGKPPVEHLFIWASAGSFELPMGYVIDPLAAVMLALVTTIA
FT                   FLVMIYSHGYMAHDPGYVRFFTYLALFSSSMLGLIVSPNLLEIYVFWELVGMCSYLLVG
FT                   FWYDRDGAAHAAQKAFIVNRVGDFGLLLGILGLFWATGSFDFHGIADGLSESVSSGTVP
FT                   IWAALTLCILVFMGPMAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLVARLD
FT                   PLFSQFPFVGLFIAIIGTVTCFLGASIALTQMDLKKGLAYSTVSQLGYMMLAMGCGAPV
FT                   AGMFHLVTHACFKAMLFLGSGSVIHAMEEVVGHEPILAQDMRLMGGLRKKMPITAITFF
FT                   IGCIAISGIPPLAGFWSKDEILGQAFNSFPILWFIGFLTAGMTAFYMFRLYFLTFEGEF
FT                   RGENQEMQLSLLALAGKEKDEEHEEHEVGNIHESAWPMTLPLAILAIPSVLIGFIGVPW
FT                   NSIFANLLDPLEALEVAENFSWGEFLPLATASVAISSTGIVLAVLTYYLKRLDLGVYLS
FT                   KKYPQINSFLQNKWYLDDINEKIFVKGSRKLAREVLEVDAKVVDGVVNLTGLLTLGSGE
FT                   GLKYFETGRAQFYALIVFGGVIALVALFGVVGA"
FT   gene            189447..191063
FT                   /locus_tag="PMN2A_1516"
FT   CDS_pept        189447..191063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1516"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_02021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59004"
FT                   /db_xref="GOA:Q46HM4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HM4"
FT                   /protein_id="AAZ59004.1"
FT                   /translation="MLIPEPILAHFPWLSLSIFFPIVGALIVPFIPDKGEGKEVRWYAL
FT                   IIALITFLITVAAYFKGFDPSQEGLQLYEKVSWLPDLGLTWSVGADGLSMPLILLTSFI
FT                   TSLAVLAAWPVSYKPKLFFFLILAMDGGQIAVFAVQDMLLFFLAWELELFPVYLFLAIW
FT                   GGKKRQYAATKFIIYTAGSSLFILLAGLAMGFFQGGGMPDFGYTHLAQQNFGKGFQLLC
FT                   YSGLLIAFGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPDA
FT                   HAQFAPLLIVLGVVNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGA
FT                   MLQMVSHGLIGASLFFLVGATYDRTHTLQLDEMGGIGQNMRIMFALWTACAFASLALPG
FT                   MSGFISELMVFVGFVTDEVYTLPFRIVVASLAAIGVILTPIYLLSMLREIFFGKENAKL
FT                   ISKAKLVDAEPREIYIIACLLVPIIGIGLYPKIMTDTYISSIDGLVKRDLLAVERIRSD
FT                   QTTIISNSNLSIGTIEAPLLD"
FT   gene            191128..192021
FT                   /locus_tag="PMN2A_1517"
FT   CDS_pept        191128..192021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1517"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02031"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59005"
FT                   /db_xref="GOA:Q46HM3"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM3"
FT                   /protein_id="AAZ59005.1"
FT                   /translation="MPVDLLTQSADSGARLAIRLLQDAAQRGDIDPWDVDVIPVVDGFL
FT                   DQLKQRIEIPKKISQHFSQNGGSYEVDLAQSSEAFLAASVLVGLKAEVLEAEMFSVDME
FT                   VEEDSELDFGEQGWLDESFQLPVRPERHLFRRPVAPPPFRRPVTLGELINQLETIAESL
FT                   KNDDLNNRRNLRQKKLSNREVIAQVSSLAHREKLPETTAALAIFINKWEKALHWVDFEL
FT                   LVKSWKENSASNDLDTDRVGVFWALLFLCSQGKVEIDQKGSLFSPISLKRLLQPGMVAQ
FT                   LPLASLDVTDVSPAAA"
FT   gene            192078..193256
FT                   /locus_tag="PMN2A_1518"
FT   CDS_pept        192078..193256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1518"
FT                   /product="putative sugar-phosphate nucleotidyl transferase"
FT                   /note="Alternative locus ID: NATL2_02041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59006"
FT                   /db_xref="GOA:Q46HM2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM2"
FT                   /protein_id="AAZ59006.1"
FT                   /translation="MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHG
FT                   FTEVMVNVSHLAEEIENYFRDGQRFGVEIAYSFEGRIEDGELIGDALGSAGGLKKIQDF
FT                   QKFFDDTFVVLCGDALIDLDLSEAVKRHKEKGALASLITKRVSKDQVSSYGVVVTDEED
FT                   RVKAFQEKPSIDNALGDTINTGIYLFEPEIFNYIPSGKPFDIGSDLFPKLVEEGAPFYA
FT                   LPMDFEWVDIGKVPDYWRAIRNVLKGDVRQVEIPGKQVRPGIYTGLNVAANWDKINVKG
FT                   PIYVGGMTRIEDGVTIVGPSMIGPSCCICEGATIDNSIIFDYSLIGPGVQLVEKLVFGR
FT                   YCVGKEGDHFDLQEAALDWLITDARRQDLGEPSPQQKAMAELLGTDLIGSSN"
FT   gene            complement(193249..194130)
FT                   /locus_tag="PMN2A_1519"
FT   CDS_pept        complement(193249..194130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1519"
FT                   /product="conserved hyopthetical protein"
FT                   /note="Alternative locus ID: NATL2_02051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1519"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59007"
FT                   /db_xref="GOA:Q46HM1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM1"
FT                   /protein_id="AAZ59007.1"
FT                   /translation="MKSKLQKRLESGLSAITAEIMPPRGGNTASAISKAIKLKDLVHGF
FT                   NVTDGSRAIMRMSSLALCKLLLEANLEPVLQLSCRDRNRIALQAELLGAHALGITNILC
FT                   LTGDPVRVGDQSQAKSVQDFNSIELIKQVTSLNKGIDPVSDLLPDGPTNLFAGAAADPN
FT                   CRGFDSLRRRIELKKTAGANFLQTQMVMDPKVLERFCREITEPMKIPVLAGVFLLKSAK
FT                   NAQFINRVVPGACIPESIISRLESSSNPIDEGISIAADQVKSFLGIAQGVHLMAVKAEQ
FT                   QIPIILDRANIN"
FT   gene            194215..194490
FT                   /locus_tag="PMN2A_1520"
FT   CDS_pept        194215..194490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1520"
FT                   /product="regulatory protein, LuxR"
FT                   /note="Alternative locus ID: NATL2_02061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59008"
FT                   /db_xref="GOA:Q46HM0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HM0"
FT                   /protein_id="AAZ59008.1"
FT                   /translation="MFTGEIANSSHMGLSAREMEIIGLVADGLTNQEIAEKLTISKRTV
FT                   DNHVSNMFTKTGSKNRVALLNWAMDHGKICRDGFNCCSLPDDETDS"
FT   gene            complement(194496..194645)
FT                   /locus_tag="PMN2A_1521"
FT   CDS_pept        complement(194496..194645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1521"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59009"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL9"
FT                   /protein_id="AAZ59009.1"
FT                   /translation="MYGLYDTEGILRFTCSDKEACIAYAKLFEFSSIEFSLMPLSDLTE
FT                   GDNN"
FT   gene            complement(194732..195232)
FT                   /locus_tag="PMN2A_1522"
FT   CDS_pept        complement(194732..195232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1522"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1522"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59010"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL8"
FT                   /protein_id="AAZ59010.1"
FT                   /translation="MGIEIERRFLVANEDWKDQVIRSESVSQAYLNSSVDEWATRVRII
FT                   DNNKGYITLKSSLNGLANYEFEYSIPRKDAIELIQLSKYKITKIRYQLKINKKNWVVDV
FT                   FEESNSYLKIAEIELNSESEEIQVPSWCGKEITGIKSLSNASLAKAPISELSVKDRIKI
FT                   KSL"
FT   gene            complement(195239..196147)
FT                   /locus_tag="PMN2A_1523"
FT   CDS_pept        complement(195239..196147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1523"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="Alternative locus ID: NATL2_02091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59011"
FT                   /db_xref="GOA:Q46HL7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HL7"
FT                   /protein_id="AAZ59011.1"
FT                   /translation="MTTNLIWILYRSDSDTAYKETLNCKKIIEGYGKKVLFSEISNETN
FT                   NINQLFLKSEVLPEITIVLGGDGTVLRAARYLSPKNIPILSFNVGGNLGFLTHDRQILK
FT                   QETFWERVSNNRFNIQKRMMLEATVFREKNNNENTIKKSFFALNDFYLRSCTDEIAPTC
FT                   SLALEIDGEAVDRYKGDGLIFSTPTGSTAYSMAAGGPIIHPSLDAIIVSAICPMSLASR
FT                   PIVVPPESQLVIKPIRGMKQKIKLWLDGSSGCLIEAEDTCLIKKSNHSTSIIILDENHS
FT                   YYKTITQKLHWASSLNNPNKQ"
FT   gene            complement(196157..196486)
FT                   /locus_tag="PMN2A_1524"
FT   CDS_pept        complement(196157..196486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1524"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_02101"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1524"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59012"
FT                   /db_xref="GOA:Q46HL6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL6"
FT                   /protein_id="AAZ59012.1"
FT                   /translation="MLENSIGPVPLQAYLIVAAFLFCTGVWGLINSRNAVRVLMSIELM
FT                   LNAVNINLMSFSSYVDGSVIRGQVFSIFVITVAAAEAAVGLAILLSLYRNRVTIDMESF
FT                   NLLKW"
FT   gene            complement(196521..197123)
FT                   /locus_tag="PMN2A_1525"
FT   CDS_pept        complement(196521..197123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1525"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_02111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59013"
FT                   /db_xref="GOA:Q46HL5"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL5"
FT                   /protein_id="AAZ59013.1"
FT                   /translation="MNIAYSTELICFLILSAVIVSGSLAVVLLENIVYSAFLLGGVFMA
FT                   VAGLYLLLNASFVAAAQILVYVGAVNVLILFAIMLVNNKEKLKPIKGLRTRKLISGGVC
FT                   GGLLILLLRVSITTKWNLPGPTSIGEEATERIGEHLFTDYLLPFELASILLLMAMIGAI
FT                   VLARRDVSIPRADMNDIKNQKSLSDRKVPLLSENSIK"
FT   sig_peptide     complement(197046..197123)
FT                   /locus_tag="PMN2A_1525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.921 at
FT                   residue 26"
FT   gene            complement(197120..197776)
FT                   /locus_tag="PMN2A_1526"
FT   CDS_pept        complement(197120..197776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1526"
FT                   /product="NADH-plastoquinone oxidoreductase, subunit
FT                   I:NADH-quinone oxidoreductase, chain I"
FT                   /note="Alternative locus ID: NATL2_02121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1526"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59014"
FT                   /db_xref="GOA:Q46HL4"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HL4"
FT                   /protein_id="AAZ59014.1"
FT                   /translation="MLGFLEKVADYTKEAVSAAKYLVDGLGVTFDHMRRRPVTVQYPYE
FT                   KLIPSERYRGRIHYEFDKCIACEVCVRVCPINLPVVDWVMNKETKKKELRNYSIDFGAC
FT                   IFCGNCVEYCPTNCLSMTEEYELSAFDRHSLNYDNVALGRLPTSVTSDPSVRPLRELPY
FT                   LPKGIMDPHELPANQLRAGKLPSQIIKELQADKSEEEGKNNSSDMVPNKLNSTNK"
FT   gene            complement(197886..199004)
FT                   /locus_tag="PMN2A_1527"
FT   CDS_pept        complement(197886..199004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1527"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_02131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1527"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59015"
FT                   /db_xref="GOA:Q46HL3"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HL3"
FT                   /protein_id="AAZ59015.1"
FT                   /translation="MNSGIDLEMSFTQGVQNLGLSHELAHLLWIPLPMLLVLVSAVIGV
FT                   LVTVWLERKISAAAQQRIGPEYAGALGILQPMADGLKLLVKEDIIPARADSVLFTVGPI
FT                   LVLVPVILSWLIVPFGQNLLISNVGIGIFLWIALSSIQPIGLLMSGYSSNNKYSLLGGL
FT                   RAAAQSISYEIPLALAVLAIVMMSNSLSTVDIVEQQNTAGFLSWNIWRQPVGFIIFWIC
FT                   ALAECERLPFDLPEAEEELVAGYQTEYSGMKFALFYLAGYINLVLSALLVSVLYLGGWG
FT                   FPISIDWFSSFIGLSIDNPLVQIIAASLGIVMTILKAYLLVFLAILLRWTTPRVRIDQL
FT                   LDLGWKFLLPISLVNLLVTASLKLAFPMTFGG"
FT   gene            complement(199078..200205)
FT                   /locus_tag="PMN2A_1528"
FT   CDS_pept        complement(199078..200205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1528"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="Alternative locus ID: NATL2_02141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1528"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59016"
FT                   /db_xref="GOA:Q46HL2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL2"
FT                   /protein_id="AAZ59016.1"
FT                   /translation="MVLKPGLEGVPVTNSGICEINGTEGRLSYRGYPISELAQKSSFLE
FT                   TAFLLIWGELPTENELEKFEKDVQMHRRVSFRIRDMLKCFPESGHPMDALQASAASLGL
FT                   FYSRRAIDDPKYIYDAVVRLIAKIPTMVAAFEQIRKGDDPIQPQDDLPYSSNFLYMLTE
FT                   REPNPLAARVFDRCLILHAEHSLNASTFSARVTASTLTDPYAVVASAVGTLAGPLHGGA
FT                   NEDVIAMLEEIGRPDEVSSFLNDAIAKKRKIMGFGHREYRVKDPRATILQAFAEELFSE
FT                   FGKDEMYEVAKALEEEAISKLGPKGIFPNVDFYSGLVYRKLGIPRDLFTPVFAISRVAG
FT                   WLAHWREQLGANRIFRPSQIYEGAKMRNWKPLESR"
FT   gene            200165..200332
FT                   /locus_tag="PMN2A_1911"
FT   CDS_pept        200165..200332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1911"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1911"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23849"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB1"
FT                   /protein_id="ABU23849.1"
FT                   /translation="MVTGTPSKPGFRTKLVVFFSLSMALAPAKQFSVQLKNFQLELYFI
FT                   ELNYIFNIAL"
FT   gene            complement(200341..201927)
FT                   /locus_tag="PMN2A_1529"
FT   CDS_pept        complement(200341..201927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1529"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59017"
FT                   /db_xref="GOA:Q46HL1"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL1"
FT                   /protein_id="AAZ59017.1"
FT                   /translation="MKSLQSYFLISAIVILSILTGIFIWRNKHLTQIPKFNEESFNAPV
FT                   SSKYIPKNTDLVFHWKLNPGLLPKYIENYQDKVSKHAINKKVSFIRDSSFQLIGFNFAK
FT                   DISKWVGDYGSFAVFDSNKKTINDWLMVLAIKEDVNIKHELESILGSKVVDESTNQSNK
FT                   ISTSKTEIISKQINSNNSIYFANDEDNLLISSNPNIIQSSIEKLDSNIINTKKMYKNIQ
FT                   LKDNLKDGLLLLEMSPKKILNLIGQEEDLLNINKVDNLLSSVNVDKNKLNLEGILAYNV
FT                   KTKMPVKDINSNLIDIKKESELPENYILVDNPKQYFQKDSFHPYQKLIASIIKESTTSD
FT                   YSELLKIILENSQGNLIWINDKDWLILTRKSDTKKTEIDDILKKENFLNSNIDFKSRKL
FT                   EIWSKISTNENNTYELKDNIEAIVEEDDKTYIWSQNLSSISNFDNTNYLKNYSDNEQNT
FT                   NEFNDFDDVLKIHLGKEKTKAILNSFYPYILLKTMLGNTLNPPQDIDIAIAVPTINYPD
FT                   FIKVKINLKTS"
FT   gene            202004..202360
FT                   /locus_tag="PMN2A_1530"
FT   CDS_pept        202004..202360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1530"
FT                   /product="rhodanese-like protein"
FT                   /note="Alternative locus ID: NATL2_02171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1530"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59018"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HL0"
FT                   /protein_id="AAZ59018.1"
FT                   /translation="MNQNIPLNISPKELNKILEDDSSEKPFIVDVREDNEIAIASFSFS
FT                   VLHLPLSKAANWSDKIVELLPKDQPVVVICHAGVRSLNFGIWLLEQGIAKSVWNLVGGI
FT                   DAWSTDVDQSVPRY"
FT   gene            complement(202373..203626)
FT                   /locus_tag="PMN2A_1531"
FT   CDS_pept        complement(202373..203626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1531"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="Alternative locus ID: NATL2_02181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1531"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59019"
FT                   /db_xref="GOA:Q46HK9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HK9"
FT                   /protein_id="AAZ59019.1"
FT                   /translation="MTGTLPTQFKDSDLSPLTRPNTLGRFGKYGGQYVPETLIPALIEL
FT                   EQAAKEAWKDSSFNSELNHLLKTYVGRSTPLYEATRLTEHYRKNTLKGPRIWLKREDLN
FT                   HTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGKEDMR
FT                   RQALNVFRMQLLGASVRPVTSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPM
FT                   LVRDFHAVIGEETKQQCKQAFGRSPDVLLACVGGGSNAMGLFHSFVEDKSVRMIGVEAA
FT                   GDGVETGRHAATITEGRIGVLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPEHSYLK
FT                   EIGRAEYAAVTDTEAIEALQLVSKLEGIIPALETAHAFAYLEKLCPTLNHNSEIVINCS
FT                   GRGDKDVNTVAEKLGSEI"
FT   gene            203666..203989
FT                   /locus_tag="PMN2A_1532"
FT   CDS_pept        203666..203989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1532"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="Alternative locus ID: NATL2_02191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59020"
FT                   /db_xref="GOA:Q46HK8"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK8"
FT                   /protein_id="AAZ59020.1"
FT                   /translation="MSKGGWSEFNDPLKTIGSNTQNSVTPKGKRQVRLERTRSGKKGKL
FT                   VTVIKGLELEQVEAKKILKNLKIACGTGGAVKGDFLELQGDQISKAQNFLLKEGFRPKQ
FT                   SGG"
FT   gene            204042..204680
FT                   /locus_tag="PMN2A_1533"
FT   CDS_pept        204042..204680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1533"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="Alternative locus ID: NATL2_02201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1533"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59021"
FT                   /db_xref="GOA:Q46HK7"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK7"
FT                   /protein_id="AAZ59021.1"
FT                   /translation="MEQNSKSPLSKATNIVWHQSSIDREARFQQRGHRSAILWFTGLSG
FT                   SGKSTLANAVNVALHKDGYSTYVLDGDNIRHGLCKDLGFSDLDREENIRRIGEVSKLFL
FT                   DAGIIVLTAFVSPFRVDRDNARSLVGENDFIEIYCSADLGVCETRDTKGLYAKARNGDI
FT                   KDFTGISSPYEEPESPELKIDTGNLEIDQCVDIVTNLLVERKIISKISK"
FT   gene            complement(204705..205241)
FT                   /locus_tag="PMN2A_1534"
FT   CDS_pept        complement(204705..205241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1534"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="Alternative locus ID: NATL2_02211"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59022"
FT                   /db_xref="GOA:Q46HK6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK6"
FT                   /protein_id="AAZ59022.1"
FT                   /translation="MSLTEANTFKQVAVVMGSDSDLKTLKPAVAILDQFGISNEVRILS
FT                   AHRTPKEMMDFAQMAESNGFGVIIAGAGGAAHLPGMIASLTTLPVIGVPVKSKALSGID
FT                   SMYSILQMPSGIPVATVAIEGGLNAGLLATQILAINNTELKNKLNAYRCELHDLVVKKD
FT                   HTLKEIGAITYLEKM"
FT   gene            205320..206480
FT                   /locus_tag="PMN2A_1535"
FT   CDS_pept        205320..206480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1535"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="Alternative locus ID: NATL2_02221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59023"
FT                   /db_xref="GOA:Q46HK5"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK5"
FT                   /protein_id="AAZ59023.1"
FT                   /translation="MRKITNIKVPQPEKSEDEKNLFSLVLDEHGIILSIDKTCKRESSY
FT                   DEDWHGDWLSPRAIDLQMNGGLGISFTDLNFNKIPKLLTLLDQLWLDGVEGICPTFVSC
FT                   SLDQFQLGMEVLKETKKYTSTNRCRLLGAHMEGPFLCETYSGAHDTGSICRPSISALNE
FT                   RIKGFEDDIALMTLAPELKGSLDVISRLRELNIVVSLGHSSADFDSAIKAFNNGVSMIT
FT                   HTFNAMKGLHHRAIGPIGAAARRDDIFLGLIGDGVHVHSDMIRLLKILAPKQIVLVSDA
FT                   ISAYGLGDGSFNWDKRLITVENGLCRLPNETIAGSTLPLLDACKKIANWINDPSAAIWM
FT                   ATLAPRMVLSQNKMTAKSFFIGKNIKSLLRWKMNSCNHQLSWQLAA"
FT   gene            206509..207210
FT                   /locus_tag="PMN2A_1536"
FT   CDS_pept        206509..207210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1536"
FT                   /product="Mg-protoporphyrin IX methyltransferase"
FT                   /EC_number="2.1.1.11"
FT                   /note="Alternative locus ID: NATL2_02231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59024"
FT                   /db_xref="GOA:Q46HK4"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK4"
FT                   /protein_id="AAZ59024.1"
FT                   /translation="MTTQIEKNEKAEVTEYFNGTGFDRWNRIYSESDDVNKVQKNIRIG
FT                   HQKTVDDVISWLKEYDNIKDKSFCDAGCGVGSLSIPLAKLGAKSIHLSDISEAMINETK
FT                   SRAKEEGLDFNKLNFRTSDLENLKGSFNTVICLDVFIHYPQQEAEAMVKHLCELSDERL
FT                   IVSFAPYTPLLALLKGIGQLFPGPSKTTRAYTLRESGIIEAAKQSGFKVVKSKLNQAPF
FT                   YFSKLIEFVKS"
FT   gene            complement(207242..207970)
FT                   /locus_tag="PMN2A_1537"
FT   CDS_pept        complement(207242..207970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1537"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="Alternative locus ID: NATL2_02241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1537"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59025"
FT                   /db_xref="GOA:Q46HK3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK3"
FT                   /protein_id="AAZ59025.1"
FT                   /translation="MSDPNPSTQEVSQTPRILLVDDEPGLRTAVQAYLEDEGFQVTTAV
FT                   DGEEGWEKAQKMIPDVIISDVMMPRCDGYGLLKKIREDERLGGTPVIFLTAKGMTADRT
FT                   QGYQAGVDDYMPKPFDPDELVARVKNVVQRQERLLTEAARFANADVGQMAKQITEIKSM
FT                   LSHGDKNHSRKDDSIPNFTPREASVLQLVAEGLMNKEIARQLETSIRNVEKYVSRLFIK
FT                   TGTSSRTELVRYALENHLVT"
FT   gene            208047..209195
FT                   /locus_tag="PMN2A_1538"
FT   CDS_pept        208047..209195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1538"
FT                   /product="NifS-like aminotransferase class-V"
FT                   /note="Alternative locus ID: NATL2_02251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59026"
FT                   /db_xref="GOA:Q46HK2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HK2"
FT                   /protein_id="AAZ59026.1"
FT                   /translation="MDNNHLIFDFQSSTPCCTKVVEEMAPYWNELWGNPSNTNNRSGVF
FT                   ASAAVEVSREKIASYLNINPKRLIFTSGATEANNLGLVGHARAKAQLIGKPGHIITVST
FT                   EHHAVLDPLRQLQKEGFRLTELHPNKEGLINIEQLSEAFEKDTFLVSVMAANNEIGVLQ
FT                   PIGDIGSFCKRKGIAFHSDAAQAFGYLDLDPDKFRIDLMSLSAHKIYGPKGIGALVIRE
FT                   GFPLEPSQYGGGQELGLRSGTLPVPLIVGFAKAVEITKNDQDERNKRLLFFRNLLLSGL
FT                   KKNISGLIVNGSIDQRLPHNLNITFPGVKGSQLHGQLRRFIFCTSGSACSNGEASHVLQ
FT                   EIGLSKKDAEASIRMSIGRNTTEKDINKAINIITNIVINLRQ"
FT   gene            complement(209203..210117)
FT                   /locus_tag="PMN2A_1539"
FT   CDS_pept        complement(209203..210117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1539"
FT                   /product="bacterial methyltransferase"
FT                   /note="Alternative locus ID: NATL2_02261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59027"
FT                   /db_xref="GOA:Q46HK1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HK1"
FT                   /protein_id="AAZ59027.1"
FT                   /translation="MKEGPISSSSNFNHIPVMGKEIIRSLKELPSELTKKGLIIDATIG
FT                   GGGHSAQILENFPGIKIIGLDQDPMAIKAASKKLIKFGTRIEIISTNFADFSHHEQAIC
FT                   VLADLGVSSHQLDEPSRGFSFRLNGPIDMRMNPKEGSSAAELIETLSEQNLADLIYELG
FT                   EEKRSRRIARKIKNDLAENGPYSGTQDLSYAIAGCFPPKQRYGRIHPSTRTFQALRIAV
FT                   NNELGSLESLLLKAPNWLLENGLFMVMSFHSLEDRRVKSSFKTDNRLKVLSKKPIRASP
FT                   EEIELNPRSKSAKLRISAKKFLT"
FT   gene            210159..211343
FT                   /locus_tag="PMN2A_1540"
FT   CDS_pept        210159..211343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1540"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_02271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1540"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59028"
FT                   /db_xref="GOA:Q46HK0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HK0"
FT                   /protein_id="AAZ59028.1"
FT                   /translation="MTQLETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIG
FT                   YLHRGMEKIAENRTNVMFVPYVSRMDYAAGMFYEAIVVNAPERLANIKVPKRASYIRAI
FT                   MLELNRIANHLLWLGPFLADVGAQTPFFYIFREREMIYDLWEAATGQRLINNNYFRIGG
FT                   VACDLPWGWLEKCKDFCDWFGPKIDEYEKLITNNPIFRRRIEGLGVIGKEQAINWSLSG
FT                   PMLRAAGVPWDLRKVDHYECYDDFEWDIAWEKEGDCYARYRVRIEEMRQSLKILRQACE
FT                   MIPGGPTENLEAQRTVEGKKGDLSGFDYQYVAKKVAPTFKIPNGELYTRLESGKGEIGV
FT                   FIQGNNDVTPWRFKIRAADSNNLQILPHILKGAKVADIMAILGSIDVIMGSVDR"
FT   gene            211333..211800
FT                   /locus_tag="PMN2A_1541"
FT   CDS_pept        211333..211800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1541"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59029"
FT                   /db_xref="GOA:Q46HJ9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR022829"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HJ9"
FT                   /protein_id="AAZ59029.1"
FT                   /translation="MIDRFLDKRNPREWLCLKRTVRFGETDAAGVVHFLELFRWCHETW
FT                   EESLEKYGIALKDIFPTNEINTSQLDIALPVVHCEANYFQPLYVGDTINIELETEKINE
FT                   SSFVLRFKFKKNGEQIGSTNIKHVSINPITRKKCALSKQINLWLHESSSNF"
FT   gene            complement(211797..213032)
FT                   /locus_tag="PMN2A_1542"
FT   CDS_pept        complement(211797..213032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1542"
FT                   /product="O-succinylbenzoate--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="Alternative locus ID: NATL2_02291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1542"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59030"
FT                   /db_xref="GOA:Q46HJ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ8"
FT                   /protein_id="AAZ59030.1"
FT                   /translation="MTKIAVVECIPEKNLDCSKEILKNFAKHNWVYLATPKDQTKIPTS
FT                   STLPEGEGIIISSGGSIGGPNLCFQSLKNLTNSALSTGKWLKNHGLKPNECIILNSLPL
FT                   HHISGFMPWWRHQTWGSGYYWISNSIMHKPLQLKQFSEALTNKHRRPLITSLVPTQLLS
FT                   LIDNTDGLKWLQSLAVIWVGGASIPIDLAEKARRKSINLAPCYGATETVAMVTCLSPKD
FT                   FLNGSNSVGFPLEDVEIEINKRNSLKIKTSRIATSKWKNNKFESIKDSNGWWEAGDLAQ
FT                   YIILDNRKAIQILGRRDSAINSGGETIFPEDIEMELMKIISKNQIPIKDIFVLGVSDKK
FT                   WGQRLVALTKFKGKELNRYPIISLLNDLIEDWQPSKKPLNWYDCPKLSRNINKKWEIKK
FT                   WQDWIAFNKPIN"
FT   gene            complement(213029..214000)
FT                   /locus_tag="PMN2A_1543"
FT   CDS_pept        complement(213029..214000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1543"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="Alternative locus ID: NATL2_02301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59031"
FT                   /db_xref="GOA:Q46HJ7"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ7"
FT                   /protein_id="AAZ59031.1"
FT                   /translation="MKLIINIKPFSFDLTRKLITSKGIIHKKIGLLLQIKDSNGNYGWG
FT                   EVSPIEKKELEKSIESLDFIGKQTTKDSIENYLFELPGALAFGLGSCLADLESLTHRKL
FT                   NLEGFDDAKSAYLLPTDIDPLESIRKYVDESNEKKSSCTIKWKVSHLENNFKEEKTLQK
FT                   ILDILPNNFKLRIDPNGGWSRQKAQEWINELKNEPRLEWIEQPLPSKDIEGLFSLATQI
FT                   PIALDESLVEFPYLRKTWKSWQIRRPALDGDPRLLLKEIEQEDSQTVISTAFETGIGRR
FT                   WVNHLAARQVKGGNPRAPGLAPGWCPKGPLFNNNPKLVWEAV"
FT   gene            complement(214024..214944)
FT                   /locus_tag="PMN2A_1544"
FT   CDS_pept        complement(214024..214944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1544"
FT                   /product="1,4-dihydroxy-2-naphthoate phytyltransferase"
FT                   /note="Alternative locus ID: NATL2_02311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1544"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59032"
FT                   /db_xref="GOA:Q46HJ6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR011937"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ6"
FT                   /protein_id="AAZ59032.1"
FT                   /translation="MKSSTTERKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLG
FT                   QFIGFLIASILILLWENLTNDLFDDETGVDKYKFHSVVALTGNKTTVSRVAYFSLLLGL
FT                   FIIFILALKSKITVLFLVIICCFLGYLYQGPPFRLGYKGLGEPLCWIAFGPLATAAALI
FT                   VISPKSNFDAIPWGTALIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVVLGTNRA
FT                   ANFLPWLVGLIFLLELLPVLNGIWPITTLMCLISLPSGLDLIKLIKRHHNKPELIKNSK
FT                   FSALRFQTINGLCLSIGFATSYFFL"
FT   gene            215044..216444
FT                   /locus_tag="PMN2A_1545"
FT   CDS_pept        215044..216444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1545"
FT                   /product="isochorismate synthase"
FT                   /note="Alternative locus ID: NATL2_02321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1545"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59033"
FT                   /db_xref="GOA:Q46HJ5"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ5"
FT                   /protein_id="AAZ59033.1"
FT                   /translation="MNLEPVFSELLVSSLQKWSERKVDECILSISVPVSQTDPLATLPL
FT                   IAEKHQFRFLWDLSPRLCLSAGGHCQSLDLSGPKRFENAQRFSDEIFTRLIDISPSPVF
FT                   SASRVLFSFSFFDQIKSNEQSIDDKFSLQAVLPKWQLTAKDGLTWLRLNSVAQNPSDVR
FT                   EAIERLWSTREKINKSPVRIVNDENENFLVDNFSDDWQSQYRDALTKGIELINSGDLDK
FT                   LVLATRQRLLLRKPLDPLHLLARLRVQQTNSCRFLWQKNHDESFFGASPERLISLNQNQ
FT                   LLIDALAGTAKKGDDGRELLASSKDLREHHFVVNSIVEQLFRRGIKASYSSQPKLMTQD
FT                   HLIHLHTLIQASVEEKSPLDLVEALHPTPAVAGLPLSKSLSWLRALEPFDRKTYASPIG
FT                   WIDKNQNSEFRVAIRYGQVRANELKLFAGAGLVKGSTVEGEMQEVALKFEVLRNQLNLD
FT                   RVNCSNDL"
FT   gene            complement(216422..217351)
FT                   /locus_tag="PMN2A_1546"
FT   CDS_pept        complement(216422..217351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1546"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="Alternative locus ID: NATL2_02331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59034"
FT                   /db_xref="GOA:Q46HJ4"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ4"
FT                   /protein_id="AAZ59034.1"
FT                   /translation="MKQLFVLDPIENINPKKDSSAALMQAASRADIDVWICTPSDLQAR
FT                   GDDAWVVSNKVNCEPWINVQSSRSLPLRDFSCIWMRKDPPVDEAFLYATHLLEVAERDG
FT                   VNVINKPASLRAWNEKLGALRFSNLMAPTLVASRVEQLITFAKEYGEVVLKPLGGKGGQ
FT                   GVIRIAKDAPGLEALLELVTSQEHLPVMMQQFLPEVINGDKRILLVNGEPLGAINRRPK
FT                   EGDFRSNLALGGKAETTKLTPKEIEICNQIKPALQEEGLFFVGIDVIGGMLSEINVTSP
FT                   TGIREVESLMNVPLADQVIDYLIDHLNN"
FT   gene            complement(217355..217645)
FT                   /locus_tag="PMN2A_1547"
FT   CDS_pept        complement(217355..217645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1547"
FT                   /product="glutaredoxin, GrxC"
FT                   /note="Alternative locus ID: NATL2_02341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1547"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59035"
FT                   /db_xref="GOA:Q46HJ3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ3"
FT                   /protein_id="AAZ59035.1"
FT                   /translation="MNRSIPDSGITTVEIYTWRFCPFCLRAKALLNEKGVQFTEYSIDG
FT                   DDGARTKMSERAGGRRTVPQIFINGKSIGGCDELYELERNNELNELIGIRN"
FT   gene            217617..217781
FT                   /locus_tag="PMN2A_1912"
FT   CDS_pept        217617..217781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1912"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1912"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23850"
FT                   /db_xref="GOA:A7MDB2"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB2"
FT                   /protein_id="ABU23850.1"
FT                   /translation="MPESGIDLFIYSFWVDMLIAFNVLILLPRLQDLTDFKRDLSLLTS
FT                   RLGTAQDCL"
FT   gene            217873..218814
FT                   /locus_tag="PMN2A_1548"
FT   CDS_pept        217873..218814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1548"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="Alternative locus ID: NATL2_02361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1548"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59036"
FT                   /db_xref="GOA:Q46HJ2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ2"
FT                   /protein_id="AAZ59036.1"
FT                   /translation="MRQLDEVKAELEKLITWRGAIEDANLSVELYELDPDEEILSEAHN
FT                   GLEQLKQELERWETERLLSGIYDKEGAVLSINAGAGGTDAQDWAQMLLRMYTRWAENNG
FT                   MKVSINELSEGEEAGIKSVTIEIEGVYAYGFLQNEKGTHRLVRISPFNANGKRQTSFAG
FT                   VEVMPKLDEEVELEIPEKDLEITTSRSGGAGGQNVNKVETAVRILHVPTGIAVRCTQER
FT                   SQLQNKDKAMALLKSKLMVIAVEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVKDL
FT                   RTEQETTDVDSVMNGKIDIFIQSLLRQNIEES"
FT   gene            218826..219017
FT                   /locus_tag="PMN2A_1549"
FT   CDS_pept        218826..219017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1549"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02371"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1549"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59037"
FT                   /db_xref="GOA:Q46HJ1"
FT                   /db_xref="InterPro:IPR021702"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HJ1"
FT                   /protein_id="AAZ59037.1"
FT                   /translation="MNNKIISDDVTKKATPPPSFVKLAMKNMVRKGSQSLSHFGLTALG
FT                   FLGFILLVAVLGKPHIPQ"
FT   gene            219022..219576
FT                   /locus_tag="PMN2A_1550"
FT   CDS_pept        219022..219576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1550"
FT                   /product="Protein of unknown function UPF0054"
FT                   /note="Alternative locus ID: NATL2_02381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1550"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59038"
FT                   /db_xref="GOA:Q46HJ0"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HJ0"
FT                   /protein_id="AAZ59038.1"
FT                   /translation="MVNSSTSSDQLDVDLSFTPFPVQDLDVFVNSDTLELMKNPSKWIE
FT                   EIGSWIRFIQVNSALKCPEIVLNSSQFSLGLELTNDKKILDLNHAWLGQSKATDVLSFP
FT                   IIDETFFGVSNECIELGDIVISVPTAIRQAKDNNADLFRELRWLATHGLLHLLGWDHSD
FT                   EESLHKMLLIQEQLLEIRGIL"
FT   gene            219602..220060
FT                   /locus_tag="PMN2A_1551"
FT   CDS_pept        219602..220060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1551"
FT                   /product="prokaryotic diacylglycerol kinase"
FT                   /note="Alternative locus ID: NATL2_02391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1551"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59039"
FT                   /db_xref="GOA:Q46HI9"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI9"
FT                   /protein_id="AAZ59039.1"
FT                   /translation="MVPEISNDSKREVRDMSKTLQIANKRSSWKIAKDLPTSFLYAAKG
FT                   LKYAFSTQRNFRIHVGFALGAFGLSFFLGLNKSDLAIMTLTATSVLVVELLNTAIESVV
FT                   DLAIGKRFHPLAQIAKDCSAGAVLVASISSVLIAVLLLFPPLLKQLGV"
FT   gene            220074..220670
FT                   /locus_tag="PMN2A_1552"
FT   CDS_pept        220074..220670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1552"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="Alternative locus ID: NATL2_02401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1552"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59040"
FT                   /db_xref="GOA:Q46HI8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI8"
FT                   /protein_id="AAZ59040.1"
FT                   /translation="MFLVIDNYDSFTYNLVQYLGELSSQHPIASEVRVERNDALTIKEI
FT                   KDLNPDAILLSPGPGDPNQSGVCLDILSELSIEIPTLGVCLGHQAITQAFGGKIIRAKE
FT                   LMHGKTSNVLHRGTGIFKDLPNPLVATRYHSLIAERESFPECLEVIAWLEDETIMGISH
FT                   KDYPHIYGVQFHPESVLTEAGHKLLSNFLDIATAT"
FT   gene            complement(220710..221825)
FT                   /locus_tag="PMN2A_1553"
FT   CDS_pept        complement(220710..221825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1553"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="Alternative locus ID: NATL2_02411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59041"
FT                   /db_xref="GOA:Q46HI7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI7"
FT                   /protein_id="AAZ59041.1"
FT                   /translation="MENIESSFIDLPNPRKDIEDLQPYSAPLEGRRNLLRLDFNENTIG
FT                   PSPLVIKSLREISRDEISAYPEYSGLKEKVVESLIKKNSNVNINSSEVGIFNGVDAAIN
FT                   AIFHAYGNFDDLMLTTLPTFGYYTPCAQMRGMQIKAIPYEGEGFQYPFDSICEFLTQNN
FT                   PKILLICNPNNPTGTRLSPERIIEISKLSSKTLVVVDELYEAFTGDSVLPFLNFQTTPN
FT                   LVVLRSLSKTAGLASLRIGFAIGHSKVINIVNRVTGPYDVNSFAVIAAFAALNDQSYID
FT                   SYVQEVLEARNWIKDQFEKHHVKHHIDGGNYFLLWPKSKPQLVEQKLKSSGILIRNMDK
FT                   KKNLKGSIRVSIGTIDQMKRFWSAFRIVDEV"
FT   gene            complement(221825..223648)
FT                   /locus_tag="PMN2A_1554"
FT   CDS_pept        complement(221825..223648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1554"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="Alternative locus ID: NATL2_02421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1554"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59042"
FT                   /db_xref="GOA:Q46HI6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HI6"
FT                   /protein_id="AAZ59042.1"
FT                   /translation="MLEISARLEEALNRAFIKVFPQEDRSSKTSSILTGSNLVPASKPE
FT                   FGDFQINCALSLAKEIKQPPREIAQKIANQLQKDNDFVRMCNPPRIAGPGFINLSINSK
FT                   TLISEIHVRLNDKRLGVPLKKFSTDKIEEGKSNNRVILDFSSPNIAKEMHVGHLRSTII
FT                   GDSLARILEFRGYEVLRLNHVGDWGTQFGMLITHLKEVVPEVLHTKDVVEISDLVNFYR
FT                   QAKKRFDEDQIFQNKSRSEVVNLQAGDKESLIAWQLLCNQSRKEFQKIYDRLDIKLTER
FT                   GESFYNKFLVDVINDLKNKKLLINDQGAQCIFLDGLVGKNGKPQPIIIQKSDGGFNYAT
FT                   TDLAAIKYRLTIPPHGDGACRLIYVTDAGQASHFSGVFQIAKLANWIPTDCQIEHVPFG
FT                   LVQGEDGKKLKTRSGETIRLVDLLDEAIQRAKNDLKNRLNTERRSENENFIDKVSTTVG
FT                   IASIKYADLSQNRISNYQFSFDKMLSLQGNTAPYLLYALVRIAGISRKGGDLNVSSHNI
FT                   QFNESQEWELIRKLLQLDYIIAEVEKELLPNRLCGYLFELSQTFNRFYDQVPILKASEP
FT                   SRASRLILCSITADTLKLGMSLLGIPTLERM"
FT   gene            complement(223716..224579)
FT                   /locus_tag="PMN2A_1555"
FT   CDS_pept        complement(223716..224579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1555"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="Alternative locus ID: NATL2_02431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1555"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59043"
FT                   /db_xref="GOA:Q46HI5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI5"
FT                   /protein_id="AAZ59043.1"
FT                   /translation="MDLRSPKLHKILDTWIEEDLGDGDLTRFVLNDRSASAHWVAKEDG
FT                   TFCGGDLVKLIFRKIDPKVDIQLLIEDGQKFEKNQRLLELKGSSSSLVAGERVSLNVAM
FT                   HLSGIATSTALLVTKLSGSKVKLADTRKTTPGIRVFEKYAFHCGGGINHRLGLDDAAML
FT                   KENHIEWSQGISESIKILKNTIPWTKKIIVEAETPSQAKEAVKAGADGVLLDEMSIQAI
FT                   EKLVPELRQLSKNSKSKYVSQNIVIEVSGINPNNVSDYIFTGIDLISTSAPITKSKWID
FT                   FSMRFD"
FT   gene            complement(224879..226273)
FT                   /locus_tag="PMN2A_1556"
FT   CDS_pept        complement(224879..226273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1556"
FT                   /product="tRNA modification GTPase trmE"
FT                   /note="Alternative locus ID: NATL2_02441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1556"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59044"
FT                   /db_xref="GOA:Q46HI4"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HI4"
FT                   /protein_id="AAZ59044.1"
FT                   /translation="MNSFSPTEDTIAAIATAVSPGQGSIAAIRISGSSAIETSKNIVDV
FT                   PGIQDWSTHKVLYGHVTEENRKKYIDEVLILVMKGPRSFTGEDVVEIHCHGGIIPVQKI
FT                   LERILAFPSVRRAEPGEFSQRAVLNGRLSLTQAESISELVSARSRKAAELAINGIEGNI
FT                   QTTIQSIRKRLIEQLTEIEARIDFEEDLPLLDEKHVKNEIVAIKKDLNELIDNAKRGSW
FT                   VRSGLKVALTGKPNVGKSSLMNRLSKQEKAIVTDLPGTTRDILESEIILEGIPVTFIDT
FT                   AGLRDTKDIIEKIGISRTKKTLIHADLIILIFDYSSGWTNEDESILKQLPINIPLLIVG
FT                   NKSDLTNDQSFEKVPKYILKKENLVIISAKTGNGEDDLINYLLKKCGSSQTHGLDIALN
FT                   ERQLDLAKSTMKSLENINKVFDEKLPWDFWTIDLRQAINYLGELTGEDLTESLLDNIFS
FT                   KFCIGK"
FT   gene            226191..226283
FT                   /locus_tag="PMN2A_1913"
FT   CDS_pept        226191..226283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1913"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1913"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23851"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB3"
FT                   /protein_id="ABU23851.1"
FT                   /translation="MAAILPWPGETAVAIAAIVSSVGENEFINQ"
FT   gene            226344..226799
FT                   /locus_tag="PMN2A_1557"
FT   CDS_pept        226344..226799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1557"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59045"
FT                   /db_xref="GOA:Q46HI3"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI3"
FT                   /protein_id="AAZ59045.1"
FT                   /translation="MKKIFLNLIQRIRKFISWLWNQEGSPSQRALGLGVGIFSGCFPFF
FT                   GLQTLMGVFLAKIFKGNSILAAVGTWISNPFTYVPLYYFNYRLGSLILNKNKNIVDIGH
FT                   ITTNELWSQGWDLSSRLIMGSICMGLFAGIVGGLGLYFLLKKTYHKM"
FT   gene            complement(226860..229187)
FT                   /locus_tag="PMN2A_1558"
FT   CDS_pept        complement(226860..229187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1558"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="Alternative locus ID: NATL2_02471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59046"
FT                   /db_xref="GOA:Q46HI2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI2"
FT                   /protein_id="AAZ59046.1"
FT                   /translation="MPKVTSSQNSNQTNTVCDQFFDGQPRLRTHQIKHIDDYEIILPEW
FT                   LKNCIENIPPGIGASCPRDSEALLVAAFDLAYQLHKGQFRKSGEPYITHPVAVADLLRE
FT                   IGASASVIAAGFLHDVVEDTDITPEQLEGYFGSEVRYLVEGVTKLGGIHFNNRTEAQAE
FT                   NLRKMFLAMSSDIRVVLVKLADRLHNMRTISYLGEEKQTRIARETREIYAPLANRLGIG
FT                   RLKWELEDLAFKLLEPDPFREIQQQIASKRSEREERLNTTVQLLKDRLNSAGLHQCEVS
FT                   GRPKHLYGIWSKMQRQKKEFHEIFDVAALRIIVSDVETCYRALAVVHDTFRPIPGRFKD
FT                   YIGLPKPNGYQSLHTAVIGRHRPIEVQIRTPEMHRVSEFGIAAHWKYKEGGSPANPDSE
FT                   KFNWLRQLVEWQQEDGVNDHNDYLASIKEDLFDEEVFVFTPKGDVLGLRNGSTAIDFAY
FT                   RIHSEVGNHCNGARINDRLCVLSTPLENGDFVEILTHKSSHPSLDWLNYVATPTARNRI
FT                   RQWYKKSHRQETISRGKELLEQEFGRKGIDNLLKGHAITKVAERCNLKSTEDLLAALGF
FT                   GALTLHQVINRFREEIKILNQVPETELSDLELATQIGTQANLASNKSKVSQTKYSPIVG
FT                   LEGLDYRIGGCCSPLPGEAILGTVALGNHGITIHRTNCVNIESIPNSRRLSVQWNTNAR
FT                   IKEEKFPIQLRIEVIDRVGVLKDILMRLSDRGINVIDARVQTSHGKPECIDLKVELESV
FT                   NQLEITINQIRSMVDVLDIART"
FT   gene            229243..230847
FT                   /locus_tag="PMN2A_1559"
FT   CDS_pept        229243..230847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1559"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_02481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1559"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59047"
FT                   /db_xref="GOA:Q46HI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI1"
FT                   /protein_id="AAZ59047.1"
FT                   /translation="MNNCSKEVLKINKLNAIYPNSTTYVINGLNLKMNRGDRLALVGSS
FT                   GCGKSTVAKAIMQLLPDGSTCYGEIFLNGKNVLKLDEDSLSTIRGKEVGLIFQDPMSRL
FT                   NPLMTVGGHIVDTFKAHDNSEPIYNLVKKAKSLLEKVGIDPLRFNSFPHEFSGGMQQRV
FT                   AIALAICLRPPLIIADEPTTSLDTIVADQIMSELSLLCDEIGTALLLISHDLSMAYKWC
FT                   NKIAILDCGKIVESGNIKQIIGDPKTNIAQRLVNSGRFLEGSEREVINKSTVLLSVNRL
FT                   RCWHDLGFWPFNSFWLKAVNEVTFSLYEGETLGIVGPSGCGKSTLCRALTGLLPTRGGS
FT                   VLFLGKNISIINRKSLKQLRKYIQIIFQDPSASLNPKMSVMDAIIDPILIHKLLSRSQA
FT                   REKARNLLDLVGLAPTAMYEQRLPSQLSGGQQQRVAIARALALSPKILICDESVSMLDA
FT                   EIQAEVLELLRSLQEKLKLSMLFITHDLSVAAGFCHRVLVLDKGKIIEENVGKNLLNYP
FT                   QKYLTKKMVKACPRLPD"
FT   gene            complement(230831..231811)
FT                   /locus_tag="PMN2A_1560"
FT   CDS_pept        complement(230831..231811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1560"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /note="Alternative locus ID: NATL2_02491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1560"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59048"
FT                   /db_xref="GOA:Q46HI0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HI0"
FT                   /protein_id="AAZ59048.1"
FT                   /translation="MDKEIKHGFGQGPGELFEGEYKKPLPMRLDRWLVSQRAEQSRAHI
FT                   QKFIEAGFARVNGKTGKAKTPVRPGDIIQLWVPPPEPLPYLKPEEIDLDILYEDDHLIV
FT                   INKTAGIAVHPAPGNKSGTLVNGLIHHCPDLPGIGGKLRPGIVHRLDKDTTGCIVVAKT
FT                   QEALVKLQIQIQKRVASRNYIAVVHGAIKNNEGMIVGSIGRHPKDRKKYAVVDEESGRY
FT                   ACTHWKLIKNLGNFSLLKFKLDTGRTHQIRVHSAHIGHPIIGDQTYSRCKKLPIKLGGQ
FT                   ALHAIELGLIHPITLEKMKFTAPLPEDFERLLKVLQPKNNINPEV"
FT   gene            complement(231811..232674)
FT                   /locus_tag="PMN2A_1561"
FT   CDS_pept        complement(231811..232674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1561"
FT                   /product="Ras superfamily GTP-binding protein YlqF"
FT                   /note="Alternative locus ID: NATL2_02501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59049"
FT                   /db_xref="GOA:Q46HH9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HH9"
FT                   /protein_id="AAZ59049.1"
FT                   /translation="MNKQIIQWYPGHIAKAEKQLKENLSKVDLVFEVRDARIPLATSHP
FT                   YLQKWLKGKKQILVLNRKDMINVEAYQAWDKKLRSEGKVPWWCDAKAGTGVLQIKHAAI
FT                   RAGQELNQRRLDRGMKNRAIRVLTLGFPNVGKSALINRLVKKKVVSSSRKPGVTRSLRW
FT                   VRLGQDLDLLDAPGVLPPRFEDQNAALKLAICDDIGQAAYDTEQVAISFMKLLETLENI
FT                   QEAGIKSMCLQNRYGIFVNETIKDKYSWLLSAAERHTSGDTQRMSQRLLDDFRKNLLGN
FT                   ISLELP"
FT   gene            233157..234362
FT                   /locus_tag="PMN2A_1562"
FT   CDS_pept        233157..234362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1562"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="Alternative locus ID: NATL2_02511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1562"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59050"
FT                   /db_xref="GOA:Q46HH8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HH8"
FT                   /protein_id="AAZ59050.1"
FT                   /translation="MSKRSLSSLGAEDLCGKRVLVRVDFNVPLGDEGLITDDTRIRAAL
FT                   PTINDLLDKSARVILSAHFGRPKGQVNETMRLTAVAQRLSELLGKTVVKTESCIGAEAK
FT                   SKVDAMSNGDVVLLENVRFISGEEKNDTEFAKELASLAEVYVNDAFGAAHRAHASTEGV
FT                   TKFLSPCVAGYLMEKELKYLQGAIDQPQSPLAAIVGGSKVSSKIGVLESLIDKCDKIIV
FT                   GGGMIFTFYKARGLSVGNSLVEEDKLELASALEKKAQEKGVEFLLPTDVVLADNFSPDA
FT                   NSKLSKVDAISEGWMGLDIGSESVELFQNALKDCKTVIWNGPMGVFEFEKFANGTNAIA
FT                   NTLAELSAQGCCTIIGGGDSVAAVEKAGLAKKMSHISTGGGASLELLEGKVLPGVSALD
FT                   DA"
FT   gene            complement(234401..235120)
FT                   /locus_tag="PMN2A_1563"
FT   CDS_pept        complement(234401..235120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1563"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1563"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59051"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HH7"
FT                   /protein_id="AAZ59051.1"
FT                   /translation="MRHSLTTKLIGFLFLYPLLINSALSKNINNQLLSNQLEQILNERK
FT                   DDLVKDLFSKQSFYKFNKQSLAFRNKYKDSKWSIKITRNDPKKSLLDVKIKSTRTIGNQ
FT                   TYNLYTKQTVEIETYKNKIKSYQVIDEESILNSQQSPLIVKIISPDKVLTGERYEINLI
FT                   IERPLDNLLTASGMIVLKNNEKMILSNDLFGIKPNQSGGLFKYIQAPSEPGSQTISAII
FT                   THPEGIYSFTKKIKVGL"
FT   sig_peptide     complement(235043..235120)
FT                   /locus_tag="PMN2A_1563"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.827) with cleavage site probability 0.793 at
FT                   residue 26"
FT   gene            235176..236234
FT                   /locus_tag="PMN2A_1564"
FT   CDS_pept        235176..236234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1564"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="Alternative locus ID: NATL2_02531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59052"
FT                   /db_xref="GOA:Q46HH6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HH6"
FT                   /protein_id="AAZ59052.1"
FT                   /translation="MPRLLIAASGTGGHIYPALSFADSLSNSWEIVWLGVPHRLEVELV
FT                   PEKYNLIKLKVGGLQGNSFRKLFNLCKLLFASVQVSVLLRQKKINVIFTTGGYISAPSI
FT                   LGAKMAGIPVLLHESNAIPGKVTRLLGRFCDHVALGIPSASEYLQRCRTSFTGTPVRTE
FT                   FLLEKSLPSWVPLGEGVLIVVMGGSQGAIKMNEMVRKILPCLIEKGCRVVHLTGKNDCF
FT                   YRNRDQEKNHPNLVVRDFSDEIPALLRNADLAISRSGAGAICELMVTKTPSILIPFPSS
FT                   TDQHQELNAAYMARFGGAIIVNQHDPEKNILKNIVSNLLDSNSLREMKLNMNNHDYSYP
FT                   EKKIFEIIHSIS"
FT   sig_peptide     235176..235244
FT                   /locus_tag="PMN2A_1564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.920 at
FT                   residue 23"
FT   gene            complement(236227..237309)
FT                   /locus_tag="PMN2A_1565"
FT   CDS_pept        complement(236227..237309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1565"
FT                   /product="L-threonine O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /note="Alternative locus ID: NATL2_02541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1565"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59053"
FT                   /db_xref="GOA:Q46HH5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HH5"
FT                   /protein_id="AAZ59053.1"
FT                   /translation="MNINFENHGGNIEKEARQLGLSTENIIDASASIVPFKLPKKLNNY
FT                   LINSIKNRSIRSYPDSSYFEVRNAISKWHNIEPSMILPGNGASELFTWAARDASLNGIS
FT                   SLPSPGFGDYQRALKCWNATYVHNPLPLSWTNNNPQSFPIEPKANVLWITNPHNPTGQL
FT                   WSRSSIENLLANYKLVICDEAFISLVPGGESQSIIDLTNIYKNLIVIRSLTKFLGIAGL
FT                   RVGYAVTNSDRLLKWKEIRDPWPVNTLAINATKMIMKDSKMHKKRLNKIHRWVEKEGKW
FT                   LYQSLSSFSTIKPLPSTTNFQLIKSESSILNLLENLKKRGILLRDCRSFINLDEKWFRI
FT                   SLLKREQNIQIINTLKDYIN"
FT   gene            complement(237391..238548)
FT                   /locus_tag="PMN2A_1566"
FT   CDS_pept        complement(237391..238548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1566"
FT                   /product="dihydroorotate oxidase A"
FT                   /EC_number="1.3.98.1"
FT                   /note="Alternative locus ID: NATL2_02551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59054"
FT                   /db_xref="GOA:Q46HH4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HH4"
FT                   /protein_id="AAZ59054.1"
FT                   /translation="MPTTKKNDLYNILLGQLLSQDEGIDAEILTNSALNAIKFASLNRN
FT                   FPLISNILLKASSDFQRNNSSLNQIVFGSHFKNPVGLAAGFDKNGVGAGLWNYFGFGFA
FT                   ELGTITWHAQEGNPKPRLFRIAKEKAALNRMGFNNQGAENFLKTIEKQKILAPGNRPCV
FT                   LGINLGKSKITPLDEAHKDYSLSLKLLAPLSDYAVINVSSPNTPGLRSLQGTKQIKKLI
FT                   STLKDLPNCPPLLVKIAPDLSNEAIDEIARVAMENGIDGIIAINTSLDRFDLKNLKIKT
FT                   GNTLGQENGGLSGLPLQKRGLDVIRRLRRSTDNDLPLIGVGGIHSARAAWERITAGASL
FT                   VQIYTGWIFEGPNLVPDILDGLIQQMEKHGFRNIKEAIGSEEPWK"
FT   gene            complement(238535..239020)
FT                   /locus_tag="PMN2A_1567"
FT   CDS_pept        complement(238535..239020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1567"
FT                   /product="possible ribonuclease HI"
FT                   /note="Alternative locus ID: NATL2_02561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1567"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59055"
FT                   /db_xref="GOA:Q46HH3"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HH3"
FT                   /protein_id="AAZ59055.1"
FT                   /translation="MSKEEKLAIAAATDGACSGNPGPGGWGALIRFQDGSEIEFGGNSP
FT                   ETTNNRMELQAALFILEKLKNIKFAPSLTIKTDSKYLIDGMDKWMPNWKKKGWKTASGK
FT                   PVLNQDLWKALDHPELPKIKLQYVKGHSGEKDNDRVDAIAVAFSKGRKIQLKDFANN"
FT   gene            complement(239088..239483)
FT                   /locus_tag="PMN2A_1568"
FT   CDS_pept        complement(239088..239483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1568"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="Alternative locus ID: NATL2_02571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1568"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59056"
FT                   /db_xref="GOA:Q46HH2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HH2"
FT                   /protein_id="AAZ59056.1"
FT                   /translation="MSAKTDEILDSLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAA
FT                   PGAAAGGDGADAAEEKTEFEVVLESFEASSKIKVLKEVRNATGLGLGEAKALVEAAPKT
FT                   IKEGATKEDAEALKKAIEAVGGKVTLK"
FT   gene            complement(239536..240063)
FT                   /locus_tag="PMN2A_1569"
FT   CDS_pept        complement(239536..240063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1569"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="Alternative locus ID: NATL2_02581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59057"
FT                   /db_xref="GOA:Q46HH1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HH1"
FT                   /protein_id="AAZ59057.1"
FT                   /translation="MGRTLESKKQIVKKIEDLLDNSEMALVLDYKGLSTKEMSDLRSRL
FT                   QQSDGVCKVTKNTLMRQAIKGKNSWTGLDSLLTGTNAFVLIKGDVGSAVKAVQAFQKET
FT                   QKSETKGGLFEGKLLSQDEIKAIAKLPSKEALMGQIAGALNSITSKIAIGINEVPSGLA
FT                   RSLKQHSENGES"
FT   gene            complement(240287..240994)
FT                   /locus_tag="PMN2A_1570"
FT   CDS_pept        complement(240287..240994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1570"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="Alternative locus ID: NATL2_02591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59058"
FT                   /db_xref="GOA:Q46HH0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HH0"
FT                   /protein_id="AAZ59058.1"
FT                   /translation="MKNFSKRMTTLLSKVEERSYSPIEAIKLVKENANAKFDETIEAHI
FT                   RLGIDPKYTDQQLRTTVALPSGTGQKIRIAVVTRGEKVNEATKAGADLAGEEDLVDSIN
FT                   KGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEGAIKEFKAGKLEFR
FT                   ADKAGIVHVRFGKASFSEEALLENLKTLQTTIEKNKPSGAKGKFWRSFFITSTMGPSVE
FT                   VDINELQDLQKEK"
FT   gene            complement(241065..241490)
FT                   /locus_tag="PMN2A_1571"
FT   CDS_pept        complement(241065..241490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1571"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="Alternative locus ID: NATL2_02601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59059"
FT                   /db_xref="GOA:Q46HG9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HG9"
FT                   /protein_id="AAZ59059.1"
FT                   /translation="MAKKVVALIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNSR
FT                   TQDKAGFVIPVEISVFEDRSFSFITKTPPASVLITKAAGIAKGSGESAKGSAGSISTSQ
FT                   LEEIAKTKLPDLNCSSIESAMKVIEGTAKNMGVSIKD"
FT   gene            complement(241594..242262)
FT                   /locus_tag="PMN2A_1572"
FT   CDS_pept        complement(241594..242262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1572"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="Alternative locus ID: NATL2_02611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1572"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59060"
FT                   /db_xref="GOA:Q46HG8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG8"
FT                   /protein_id="AAZ59060.1"
FT                   /translation="MSEIETTPAKDSKIIDRSEASEDDQSSFANQSIKTNIARWYAIQV
FT                   ASSCEKKVKATLEQRAITLGVSDRIIEIEIPQTPAVKLKKDGSRQTTEEKVFPGYVLVR
FT                   MVLDEDTMMAVRSTPNVINFVGAEDRRATGKARGHIKPRPLSRQEVNRIFKRAAEKKTV
FT                   VKLDVEEGDQIVVTAGPFKDFQGEVIEVSGERNKLKALLSIFGRETPVELEFSQITKQN
FT                   "
FT   gene            complement(242305..242547)
FT                   /locus_tag="PMN2A_1573"
FT   CDS_pept        complement(242305..242547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1573"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="Alternative locus ID: NATL2_02621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1573"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59061"
FT                   /db_xref="GOA:Q46HG7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG7"
FT                   /protein_id="AAZ59061.1"
FT                   /translation="MTSPTSKEDQEKVIPTKKEKTALKKSFLSSTIDEMKLVVWPSRQQ
FT                   LFSESVAVILMVTLSAVSIAAVSRFYGWASTQIFR"
FT   gene            complement(242620..245415)
FT                   /locus_tag="PMN2A_1574"
FT   CDS_pept        complement(242620..245415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1574"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_02631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59062"
FT                   /db_xref="GOA:Q46HG6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG6"
FT                   /protein_id="AAZ59062.1"
FT                   /translation="MTTLNQKSSKMNGSLTTEPDSFSDEAWSLLLIAEQSARRWRHKNL
FT                   DVEHLIEVLFRNKKYQKYTNSLPINHKELNEILENFIAELPINNQPDLFIGEDLEILLE
FT                   VADDFRSRWGSNQIEISHILIAIGRDNRLGEDLLYQAGLPSEILEAELRRLPAPKSFKQ
FT                   SKRNQDKPITNRPQKDSQSFMPTETTAKDPKPEPLPPLSKEEITSKQEPLNLNEAPSAL
FT                   DLYCKDLTTEAENGTLDPVIGRESEIKAITKVLSRRGKNNPVLIGAPGVGKTAIAELLA
FT                   QKIVDNELPESLQGLRLISLDIGALIAGAKFRGQFEERFRSLLSEINNSEKGVILFIDE
FT                   LHTIVSKDRSNTDAGSLLKPLLASGDLRCIGATTPDNYRRTIEKDLALNRRFQQVSIKE
FT                   PSLDLSLEILKGLKENYEVHHGVIITDEALITANRLAYRYISDRCLPDKAIDLIDEASA
FT                   QVRIESALKPKIIEEKESQVNHLESSIINADKDTTLETINNLQEKKELLLFELAEIKQK
FT                   WQDQIDKSAELQELKISLKELKNLIREVEISGDMEEVERLKYDQLYQLQERIEEIEVSI
FT                   REDNEYGNSLLKDKVNPEDIADVVSRWTGIPVRKVVSGERQKLLKLEQDLGKKVIGQLN
FT                   AVQAVSAAIRRARAGMQDIKRPIGSFLFLGPTGVGKTELAKSLASSLFDEEDALLRLDM
FT                   SEYMERNAVSRLLGAPPGYVGYEEGGQLTEAIRKRPYAVLLLDEIEKAHQEVFNILLQV
FT                   LDDGRLTDSQGRTVDFRNTVIVMTSNLASKAILNNSLQLQSENSNKNILLQELDQKINE
FT                   ALTKHFRPEFLNRIDEVIKFNPLKPDSLEQIVRLQLDELKKLLKHQGLDLYVDENTIKI
FT                   LAEEGYEPEYGARPLRRVIRRRLENPLATQILEEAFQGAKSIRVETKDDDSEKLLFLID
FT                   N"
FT   gene            245573..246874
FT                   /locus_tag="PMN2A_1575"
FT   CDS_pept        245573..246874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1575"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="Alternative locus ID: NATL2_02641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1575"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59063"
FT                   /db_xref="GOA:Q46HG5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HG5"
FT                   /protein_id="AAZ59063.1"
FT                   /translation="MADSLELVIDTIMAREVLDSRGNPTVEAEVLLEGGAIGRSIVPSG
FT                   ASTGAHEAHELRDGGKRYLGKGVLQAVNHIEENIAPALCGLSSLDQATVDSVMKQLDDT
FT                   DNKSNLGANSILAVSMATARAAANGLGLPLYRYLGGPMSSLLPVPLMNVINGGEHAANN
FT                   LDFQEFMLVPHGAESFREALRMGAEVFHTLKDLLSQKGLSTAVGDEGGFAPNLESNKAA
FT                   GDLLMQAIEQAGFKPGEQVSLALDVASTEFYAEGQYCYGGNSYSSEQMVEELAGLVNAF
FT                   PIVSIEDGLAEDDWDGWRLLTKKLGKNVQLVGDDLFVTNTLRLQRGIDENIANSILIKV
FT                   NQIGSLTETLEAIELASRSSYTTVISHRSGETEDTTIADLSVATKSGQIKTGSLSRSER
FT                   VAKYNQLLRIEDELGSQATYAGLVGLGPRGSLKG"
FT   gene            complement(246885..248564)
FT                   /locus_tag="PMN2A_1576"
FT   CDS_pept        complement(246885..248564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1576"
FT                   /product="protein kinase"
FT                   /note="Alternative locus ID: NATL2_02651"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1576"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59064"
FT                   /db_xref="GOA:Q46HG4"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG4"
FT                   /protein_id="AAZ59064.1"
FT                   /translation="MIFLASQLQRLVRAFRIWMILLGLLFYLWFDSKKWTYLKGYTTKK
FT                   REKRTTSRAKWITKELINLGSAFIKLGQLLSARADVIPSSWVNELTSLQDRVPPFAFEK
FT                   VDEILKKQLGNSYNKIISIDKNPIGSASLAQVHKARLNNDKNIIFKVQRPDIEKFFRLD
FT                   LDVMNQVAKVVQRIKSLSRGNDWIGIAKESRRVLLRELDFRIEAQYAARFKQQFIDDSD
FT                   ILIPSVFWDLSTSKVLCLEYLPGIKINDIQSLKSNDIDTSSIAKIGATSYLKQLVNYGF
FT                   FHADPHPGNLAVSKSGSLIYYDFGMMGFVSERIRGRLNSMIKAAALRDVSGLVKELQIA
FT                   GLIEDDIEIGPVRRLIRIMLNEALTPPFDSQIIEKLSGDISELAYGKPFRIPIELIFVF
FT                   RALSTFEGVGRYLDPEFNLIAIAKPFLLPLMTSKNTDSNDLFNELGRQVTEIGSKAVGL
FT                   PKRLDENLERLEQGDLQLQVRMGESDRQLRRMINAQQTLGNSVLLGSLAISSALLASNS
FT                   KPYLFFIPLIPGFPIALNWITLQFKMRNENRLDNFQGRRGSR"
FT   gene            complement(248561..248872)
FT                   /locus_tag="PMN2A_1577"
FT   CDS_pept        complement(248561..248872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1577"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02661"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1577"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59065"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG3"
FT                   /protein_id="AAZ59065.1"
FT                   /translation="MSDSEILLKAAINRISARITEKLINSAQEFTEIAEELPQKLQNEW
FT                   DSFKEEIIEESERLEKKTNKSKEKTSEEQLSKEDSIQIQIDNLRSKVIDINKDIEGKN"
FT   gene            248929..249072
FT                   /locus_tag="PMN2A_1914"
FT   CDS_pept        248929..249072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1914"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02671"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1914"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23852"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB4"
FT                   /protein_id="ABU23852.1"
FT                   /translation="MKLGIGRFALNQLNLFRRLVVIVHLKEFSLELDKLTFDLIWEKSL
FT                   IY"
FT   gene            249140..250096
FT                   /locus_tag="PMN2A_1578"
FT   CDS_pept        249140..250096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1578"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="Alternative locus ID: NATL2_02681"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1578"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59066"
FT                   /db_xref="GOA:Q46HG2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG2"
FT                   /protein_id="AAZ59066.1"
FT                   /translation="METIETDVVIVGGGPAGCSCALYTSRADLRTVILDKNPDVGALAI
FT                   THQIANYPGVSSEMSGEALLKLMRDQATQYGADYRRAQVFGIDSSGDWKTIYTPEGTFK
FT                   AKALVVASGAMGRPASFKGEAEFLGRGVSYCATCDGAFYRDREVAVVGINKEAIEEANV
FT                   LTKFASKVHWITSNDPKPDDHHAQDLLSKPNVNHWSKTRLMQIEGNDGGVTGIKVKNRS
FT                   IDTHQNLALEGVFVYMSGSKPITDFLGEQVAFKEDGGVLVDDFMSTTVEGVWAIGDIRN
FT                   TPFKQAVVAASDGCIAAMAIDRYLNSRKSIRVDWVHA"
FT   gene            complement(250120..250401)
FT                   /locus_tag="PMN2A_1579"
FT   CDS_pept        complement(250120..250401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1579"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02691"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59067"
FT                   /db_xref="GOA:Q46HG1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG1"
FT                   /protein_id="AAZ59067.1"
FT                   /translation="MKRLDLIFSERELDDVLSALEKAEVPGYTVMKHATGRGPERIVTE
FT                   DMEFTGFGSNAHVIIFCEQEVIDKIRENIKSVLSYYGGVAYVSEATPL"
FT   gene            complement(250413..251405)
FT                   /locus_tag="PMN2A_1580"
FT   CDS_pept        complement(250413..251405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1580"
FT                   /product="permease"
FT                   /note="Alternative locus ID: NATL2_02701"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1580"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59068"
FT                   /db_xref="GOA:Q46HG0"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HG0"
FT                   /protein_id="AAZ59068.1"
FT                   /translation="MGQNLFIQNALSPPILFFFLGAIAYALKSDFEIPAPLPKLFSLYL
FT                   LLAIGFKGGIELQKSGFTYPVLPTVVAAILMSLLIPLICFVILRLKFDVFNAAAISAAY
FT                   GSISAVTFITAESFLESQNIPFDGFMVAALALMESPAIIIGLLLVKFGATKNRPIKRKM
FT                   KWGSILHESMLNGSVYLLLGSLLIGFLTSAVDPTDIKKMEPFTGELFYGAECFFLLDMG
FT                   IVAAQRLARLNKTGAFLIMFSILMPIINAVLGSVVAKFLNLDSGNALLFVVLCASASYL
FT                   AVPTAMRMTVPEARPSYYISTTLGLTFPFNIIFGIPVYMSLVNTMIPQI"
FT   gene            complement(251452..253119)
FT                   /locus_tag="PMN2A_1581"
FT   CDS_pept        complement(251452..253119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1581"
FT                   /product="putative sulfate transporter"
FT                   /note="Alternative locus ID: NATL2_02711"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59069"
FT                   /db_xref="GOA:Q46HF9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF9"
FT                   /protein_id="AAZ59069.1"
FT                   /translation="MALINGFHLKNIRGDVLGGLTAAVVALPLALAFGNAALGPGGAIY
FT                   GLYGAVVVGFLAALFGGTPAQVSGPTGPMSVTVAGVVASLAAVGVPRDLSAGEILPLVM
FT                   AAVVIGGLFQILFGLLRLGKYITLVPYSVVSGFMSGIGVIIITLQIGPLLGISTRGGVL
FT                   ESLSTLFNNFEPNGAAIAVATMTLAIVFLTPRKISQWVPSPLLALLIVTPLSILLFGDS
FT                   SLDRIGAIPEGGLSLSLPDPSLGNFFPIILKAGLVLAVLGAIDSLLTSLVADNISQTRH
FT                   NSDRELIGQGIGNAVAGIFTGLPGAGATMRTVINVKSGGSTPISGMVHSVVLLFVLVGA
FT                   GPLAAQIPTALLAGILIKVGLDIIDWGFLLRAHKLSLKTASVMYGVLFMTVFWDLIWAV
FT                   LVGVFIANMLTIDSITETQLEGMEADNPFDSSSNNNAANAQLPSDEKALLDRCAGEVML
FT                   FRLKGPLSFGAAKGITERMMLVRNYKVLILDITDVPRLGVTATLAIEDMVQEALSNSRK
FT                   AYVAGATGRVKDRLAKFGVDVIGTRKEALVAAIDSLNG"
FT   sig_peptide     complement(253021..253119)
FT                   /locus_tag="PMN2A_1581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.757) with cleavage site probability 0.344 at
FT                   residue 33"
FT   gene            253262..254197
FT                   /locus_tag="PMN2A_1582"
FT   CDS_pept        253262..254197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1582"
FT                   /product="Heat shock protein DnaJ, N-terminal protein"
FT                   /note="Alternative locus ID: NATL2_02721"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59070"
FT                   /db_xref="GOA:Q46HF8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF8"
FT                   /protein_id="AAZ59070.1"
FT                   /translation="MELNGFKDYFKILGISRNATDQEIKSAFRKLARQFHPDLHPHDQK
FT                   AESEFKEINEAYEILSDEAKKKSYEQYLSYWLKKRAGKYRDFSTENNENQFDEYLNFDD
FT                   FLSDLIGRFSEVSQDIYSNISSNKNAQSLNLDAEFNLQISFLEALNGAKKNLLVNDERI
FT                   EVTIPQGIETGSKIRIKNKGNIQSGKGKRGDLLIEVSVKSHPIWKVKGLDVYADLPLSL
FT                   DEFALGANIMVVSPQGDTYLSIPSGSLPEQKLRLQGQGLHNLDTQGDLFFTLKLKLPEN
FT                   WSADELRLLEKLRSVRIDEPRSSWFEKART"
FT   gene            254232..255230
FT                   /locus_tag="PMN2A_1583"
FT   CDS_pept        254232..255230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1583"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Alternative locus ID: NATL2_02731"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1583"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59071"
FT                   /db_xref="GOA:Q46HF7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF7"
FT                   /protein_id="AAZ59071.1"
FT                   /translation="MDLTYRPRRLRRTNSLREMVRENTVSASDFIYPLFVHEGSDTQEI
FT                   AAMPGTSRWPIDGLIDEVKRAWNLGIRCVVIFPKVPDEQKTEDGAECFNEKGLIPRTIE
FT                   RLKKEIPEMCVMTDVALDPYSCDGHDGIVSDDGIILNDATVNYLCKQAVVQARAGADLI
FT                   GPSDMMDGRVGAIREALDDEGFEHVGIISYTAKYSSAYYGPFREALDSAPRSISNKPIP
FT                   KNKNTYQMDPANAREAITEAQLDEQEGSDILMVKPGLAYLDIIYRLREESELPIAAYNV
FT                   SGEYSMVKAAAQRGWIDEREIVLETLLSFKRAGANLILTYHACDAAGWLKE"
FT   gene            255279..255683
FT                   /locus_tag="PMN2A_1584"
FT   CDS_pept        255279..255683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1584"
FT                   /product="lactoylglutathione lyase/catechol 2,3-dioxygenase
FT                   related enzyme"
FT                   /note="Alternative locus ID: NATL2_02741"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1584"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59072"
FT                   /db_xref="GOA:Q46HF6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF6"
FT                   /protein_id="AAZ59072.1"
FT                   /translation="MQKKQSELNIESVHRLGHVAIRVEDVNRAKSFYMALGMKLIWDDT
FT                   DWCYLEAGDSKDGLALLGPSYKAAGPHFAFHFTNKDEIKRIHDSLKKQGIKVGALHDHR
FT                   DGTSSFYLKDTEGNWLEMLYHPSTGIPTNQ"
FT   gene            255699..258113
FT                   /locus_tag="PMN2A_1585"
FT   CDS_pept        255699..258113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1585"
FT                   /product="MutS 2 protein"
FT                   /note="Alternative locus ID: NATL2_02751"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1585"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59073"
FT                   /db_xref="GOA:Q46HF5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF5"
FT                   /protein_id="AAZ59073.1"
FT                   /translation="MGLTKNHDDSKKTQIISESLDLLEWPTVCSHLSTFALTQQGRKKC
FT                   ESFDLPRNLSLSQELLSQTLEIGSLDSSLNEGISFDGVHDLENILLICSKGGIAIGEDL
FT                   LKVADTLRAARKLRKLIFDQVIRPRLSELLKDVATLPDLQKLLEFGLDEGGRIADRASP
FT                   KLSELRRYRNSVRLQRKDILQDIIRKYGGLLQDNIISERYGRPVLAFKAGTSDQIKGMV
FT                   HDSSASGNTIYVEPQVVISIGNRLAKIDSEISDEERRLLADWSKEVGLNAIVIAHLVEI
FT                   LLQIEFALSRARYSKWLNGVPAILDQEEHSPFEIKDFRHPLLVWNDFYEKKNTVVPTSF
FT                   DVAPDLKVVAITGPNTGGKTVALKSIGLAVLMAKAGLLLPCTGSPRLPWCKNVFADIGD
FT                   EQSLQQNLSTFSGHILRISRILDAIDVFPGTTLVLLDEVGAGTDPTEGTALAMALLQVM
FT                   ANRARLTIATTHFGQLKALKYSDSRFENASVSFDSETIQPTFHLQWGIPGRSNAIEISK
FT                   RLGLDEQVIISAQKFINPERVDNVNQVIQGLEKQRERQQSAAEDAAALLAKTELLHEEL
FT                   LNSWQKQRQQSEEFNEQGRFKLESSIREGQKEVRHLIKRLRDQNASGETARIAGQRLRQ
FT                   IEKGYRNDKRINHTQSWTPKIGEKVRLSSIGKAGEIISFSDDGMQLTVLCGVFRSKVNL
FT                   TEVESLDGQKVEINQSVQVKTSQVRKNLSLVRTKKNTLDVRGLRVHEAEGVIEEKLRNC
FT                   SGALWVIHGIGSGKLKKGLRKWFDSLPYIEKVADAEPHDGGPGCSVVWMVD"
FT   gene            258213..259202
FT                   /locus_tag="PMN2A_1586"
FT   CDS_pept        258213..259202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1586"
FT                   /product="GTPase"
FT                   /note="Alternative locus ID: NATL2_02761"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1586"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59074"
FT                   /db_xref="GOA:Q46HF4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HF4"
FT                   /protein_id="AAZ59074.1"
FT                   /translation="MQFIDQAIIDVKAGSGGDGISAFRREKYVPAGGPAGGDGGQGGNV
FT                   VLEADDNLQTLLDFKFQKLISAENGQRGGPNKCTGASGKDTVLKVPCGTEVRHLSTNII
FT                   LGDLTNKGQQLIVAFGGKGGFGNARYLSNSNRAPEKFTEGKVGEEWSLQLELKLLAEVG
FT                   IIGLPNAGKSTLISVLSSARPKIADYPFTTLIPNLGVVRRPSGDGTVFADIPGLISGAS
FT                   KGIGLGHDFLRHIERTKVLLHLIDSASTDPINDFKTINEELTSYGHGLISRPRIFVLNK
FT                   KELLNENEIKKLLNKIEKMTMKKVHIISAVTKFGLDDLLSSIWNELGY"
FT   gene            259280..259462
FT                   /locus_tag="PMN2A_1587"
FT   CDS_pept        259280..259462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1587"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02771"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59075"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF3"
FT                   /protein_id="AAZ59075.1"
FT                   /translation="MDFYSCFDGQGEIIARCQTDQDINVLKKMGRPIAEVRHMKNEEAV
FT                   VCSLTGSPSDFNMDY"
FT   gene            complement(259532..259750)
FT                   /locus_tag="PMN2A_1588"
FT   CDS_pept        complement(259532..259750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02781"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1588"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59076"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF2"
FT                   /protein_id="AAZ59076.1"
FT                   /translation="MKTIDEHIKKDESEIQEAKAQGNDSKLHHLEDELNSLKEYKEHHP
FT                   EDKHDPNALELFCDANPDEPECLVYDD"
FT   gene            complement(259919..260581)
FT                   /locus_tag="PMN2A_1589"
FT   CDS_pept        complement(259919..260581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1589"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Alternative locus ID: NATL2_02791"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1589"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59077"
FT                   /db_xref="GOA:Q46HF1"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF1"
FT                   /protein_id="AAZ59077.1"
FT                   /translation="MKEENSYFTSSNPIKGVYGDFIVTSNDKKEVLFYRLSILFCGLFF
FT                   SIGIAQWFFNGSNQIWIWLLCMAISIGLSLKWIHIYLRPLHQTLTIFWVLGCIGLLILL
FT                   YHFGVTNLIYGLRENPKSILLVGPLFASLTGIGFKEFFCFRRIEAIGITIFIPIALIGY
FT                   LTELANESFTFATLVVSSLLLLSMGIRKFNLPAEADIGDKSVFDYLESQRKLKVSDI"
FT   gene            complement(260591..261565)
FT                   /locus_tag="PMN2A_1590"
FT   CDS_pept        complement(260591..261565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1590"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02801"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1590"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59078"
FT                   /db_xref="GOA:Q46HF0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HF0"
FT                   /protein_id="AAZ59078.1"
FT                   /translation="MAIPPIFVKAARDIWSFEWKILMNGLAPSDSNGNYKRPINIQQQI
FT                   QIPTKEDLKNRASNQMPGLIIGRSCPWAHRAWIIHEIKGLKKSINLHIAQVDEEGGRWR
FT                   LDPPIKGCKTLQELYQKCGNYQSRRATVPMLFDPGKEPESKLRLINNESAELVEILNNW
FT                   PIYDQEIDLNPSKYKKEIINWQNLIQENVNNGVYKCGFARNQKAYEKASNNLFSALNII
FT                   EEHLKSNGPWLCGKNLSIADIRLFPTLIRWEAIYYPLFKCSNKPIESFPHIIKWRKKIF
FT                   NMYNIKKTCDVDAWRKDYFGALFPLNPSSIIPKGDDITTTINN"
FT   gene            261609..262526
FT                   /locus_tag="PMN2A_1591"
FT   CDS_pept        261609..262526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1591"
FT                   /product="aspartoacylase"
FT                   /EC_number="3.5.1.15"
FT                   /note="Alternative locus ID: NATL2_02811"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1591"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59079"
FT                   /db_xref="GOA:Q46HE9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HE9"
FT                   /protein_id="AAZ59079.1"
FT                   /translation="MKQLQVLLVAGTHGNEINGIWLFDEWKKSSFLINTHGIKTFKVIG
FT                   NPEAKKAGKRYIHHDLNRSFKEESFIKINPLNCERTRASELVNLYGEAGENPCQIALDF
FT                   HTTTASMGSCIVVYGRRDADLALASLIQNQLGLPVYLHESDQKQTGFLVESWPCGLVVE
FT                   IGPIGQGLLNSRIISQTKLILETLMEQIHEVKNLNLFFPNKLIIHRHIKSIDFPRDEEG
FT                   NIDGYVHSLRQSKDWQELKKNDELFCKLNGEIIRFEEDEPYIPVFINEAAYVEKNIAMS
FT                   FTKRELWNFKKEWKQALIDLIHQK"
FT   gene            complement(262517..262651)
FT                   /locus_tag="PMN2A_1915"
FT   CDS_pept        complement(262517..262651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1915"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02821"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1915"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23853"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB5"
FT                   /protein_id="ABU23853.1"
FT                   /translation="MVLIKWLINGHRLEERVPLSDARHRKYELEAQGAIIYWSERTHF"
FT   gene            262849..263931
FT                   /locus_tag="PMN2A_1592"
FT   CDS_pept        262849..263931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1592"
FT                   /product="Photosystem II reaction centre protein PsbA/D1"
FT                   /note="Alternative locus ID: NATL2_02831"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1592"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59080"
FT                   /db_xref="GOA:Q46JV2"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46JV2"
FT                   /protein_id="AAZ59080.1"
FT                   /translation="MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAA
FT                   TTCFIVAFIAAPPVDIDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLD
FT                   EWLYNGGPYQLVIFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYP
FT                   FGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTS
FT                   SLIRETTGLDSQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLASWPV
FT                   ICVWLTSMGICTMAFNLNGFNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNF
FT                   PLDLAAAESTSVALVAPAIG"
FT   gene            264062..265147
FT                   /locus_tag="PMN2A_1593"
FT   CDS_pept        264062..265147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1593"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="Alternative locus ID: NATL2_02841"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59081"
FT                   /db_xref="GOA:Q46HE7"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HE7"
FT                   /protein_id="AAZ59081.1"
FT                   /translation="MGSSFGKLFTISSFGESHGGGVGVIIDGCPPRLELDINEIQNDLN
FT                   RRRPGQSKITTPRNESDEVEILSGLLGNKTLGTPIAMVVRNKDHRPKDYSEIKKTFRPS
FT                   HADATYQKKYGIQASSGGGRASARETIGRVAAGSVAKQLLNKSAKTEILAWVKRIHDIE
FT                   AEIHPSEVTFDEIEKNIVRCPNQSAADLMIQRVEAFGKEGDSCGGVIECVVRNPPIGIG
FT                   MPVFDKLEADLAKALMSLPATKGFEVGSGFGGTYLKGSEHNDPFLPSDSNQLKTATNNS
FT                   GGIQGGISNGEDIVLRVGFKPTATIRKSQKTIDEDGNAITLKATGRHDPCVLPRAVPMV
FT                   EAMVALVLADHLLRQRGQCPD"
FT   gene            complement(265219..265854)
FT                   /locus_tag="PMN2A_1594"
FT   CDS_pept        complement(265219..265854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1594"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="Alternative locus ID: NATL2_02851"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1594"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59082"
FT                   /db_xref="GOA:Q46HE6"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HE6"
FT                   /protein_id="AAZ59082.1"
FT                   /translation="MEAKQNYLKKTLRIQPLIVVIRLEHNFFNLSKKKENLLSKIEKLS
FT                   NFGIKNIEIGWDSNPEWVNLILEIKKRFKSINIGVASISSRQSLESLLSLDVNYSMSQF
FT                   FNKEIHIQAIEYNQLVIPGISNIENFKEAIDLGYKIVKIFPASKLGINFINELKDFKKK
FT                   DIFFIGAGGIKSKHLKKFLQSGYDALVIGRELRNQTPDKDLEIWLKDY"
FT   gene            complement(265871..267718)
FT                   /locus_tag="PMN2A_1595"
FT   CDS_pept        complement(265871..267718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1595"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="Alternative locus ID: NATL2_02861"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1595"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59083"
FT                   /db_xref="GOA:Q46HE5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HE5"
FT                   /protein_id="AAZ59083.1"
FT                   /translation="MNKRWRNIGLYVLIVVVVIFVGSAFFDKPSPTKSSRTLRYSDFIE
FT                   AVQEKQISRVLISPDKGTAQIVESDGNRALVNLAPDQQLLQLLTDNDVDIAVQPTTQAN
FT                   PLQQAATSLIFPILLLGGLFFLFRRAGSGGGGNPAMNFGKSKARLQMEPETKVTFGDVA
FT                   GIEGAKLELTEVVDFLKNPDRFTAVGAKIPKGVLLVGPPGTGKTLLAKAVAGEASVPFF
FT                   SISGSEFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQ
FT                   TLNQLLTEMDGFEGNSGIIIVAATNRPDVLDSALMRPGRFDRQVTVDRPDYSGRLQILN
FT                   VHAKSKTLSKAVDLDQVARRTPGFTGADLANLLNEAAILAARRELTEVSNDEVSDAIER
FT                   IMVGPEKKDSVISEKRKKLVAYHEAGHAVVGAVMPDYDPVQKISIIPRGGAGGLTFFTP
FT                   SEERMESGLYSRSYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLKQVASVARQMITK
FT                   FGMSDKLGPVALGRSQGGMFLGRDISAERDFSEDTAATIDSEVSVLVEIAYERAKKALN
FT                   DNRQVLEELTAMLMETETVDSLEFQDLLIRHEVKVAEYA"
FT   gene            complement(267762..269012)
FT                   /locus_tag="PMN2A_1596"
FT   CDS_pept        complement(267762..269012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1596"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="Alternative locus ID: NATL2_02871"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59084"
FT                   /db_xref="GOA:Q46HE4"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HE4"
FT                   /protein_id="AAZ59084.1"
FT                   /translation="MVEFNENNFLNMGPLSGRISRLLKEKMTSKQSSNKNLAGLIKPYG
FT                   GELINLMASDQEAKELKKNSFKTLNCSDRNACDIELLLIGAFSPLNGFMNEKNYNSVVK
FT                   QNRLESGLLFGLPIVMDTDREDINPGDSVLLNYKDQELAILEIQEKWTPDKVIEAKFCY
FT                   GTTSLEHPAVRMISMERKKYYLGGSIKGLELPKRVFTCQTPAQVRENLPSGEDVVAFQC
FT                   RNPIHRAHYELFTRALEANNVSKNGVVLVHPTCGPTQEDDIPGSVRFQTYEKLASEVNN
FT                   PKIRWSYLPYSMHMAGPREALQHMIIRRNYGCTHFIIGRDMAGCKSSLDGEDFYGPYDA
FT                   QNFANECCQELEMQTVPSLNLVFTEEEGYVTADYAKEKGLHIKKLSGTQFRKMLRSGEE
FT                   IPEWFAFKSVVDVLRAA"
FT   gene            complement(269064..269867)
FT                   /locus_tag="PMN2A_1597"
FT   CDS_pept        complement(269064..269867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1597"
FT                   /product="photosystem II manganese-stabilizing protein
FT                   PsbO"
FT                   /note="Alternative locus ID: NATL2_02881"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1597"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59085"
FT                   /db_xref="GOA:Q46HE3"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HE3"
FT                   /protein_id="AAZ59085.1"
FT                   /translation="MRFRPLLALMLAFCLTFTTLPSSASAALKGREQGNARFGNVVNTG
FT                   QADACTVLPAGSSGSINADGQFKSLCLQPTEVSVKLPGNKRNKSDFAIAKIISPRFNTS
FT                   LDEVYGDLSGGKFTEKGGIDFSLITVLAPNGEEFPFAFSVKEMVAESKKGKSIEPGAEF
FT                   SGPTTTPSYRSADFLDPKSRAKSTGVEYAQALIARGGDDEDLARENVKDDLGGKGEITL
FT                   TVDSVDADTNEFGGQFVAIQPSDNDLGSKDPVDIKIKGIFYGRKA"
FT   sig_peptide     complement(269787..269867)
FT                   /locus_tag="PMN2A_1597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.882 at
FT                   residue 27"
FT   gene            269988..270104
FT                   /locus_tag="PMN2A_1916"
FT   CDS_pept        269988..270104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1916"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02891"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1916"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23854"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB6"
FT                   /protein_id="ABU23854.1"
FT                   /translation="MDLTHRFHSKPFYSSLFWRLDSDFRKKQIRKISINFLF"
FT   gene            complement(270096..271352)
FT                   /locus_tag="PMN2A_1598"
FT   CDS_pept        complement(270096..271352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1598"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /note="Alternative locus ID: NATL2_02901"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1598"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59086"
FT                   /db_xref="GOA:Q46HE2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HE2"
FT                   /protein_id="AAZ59086.1"
FT                   /translation="MINSTSLSGKKILVAVTGSIAAVKAPILVSRLIKAGAEVKCVITQ
FT                   SATNLVSPLSLSTLSRNKCYQDKDQWADSQTKPLHIALAEWAELIIVAPLSATSLSKFT
FT                   SGSADGLLASILLASQSQIVMAAAMNTSMWENQSVKKNWNYVKTIDQVITLEPSAGLLA
FT                   CDRVGNGKMVNLDIIEMASESAFIFHAENKFLTKDLKDIRFLISAGPTVEALDAARQLT
FT                   NRSSGKMGVLIAQAAKLRGAEVDLVHGPVSVQQDLLEGLNTYPVRSSNEMGAKIDDLQP
FT                   SAQVIVMAAAVSDFKNNSPSEKKISKEFFLKSVFDDLEMTSDLIKNQTKKKLENQIFLG
FT                   FAAETGSDNEIIEKGEKKRVSKGCDLLMANPIDRAGQGFDENFNSGFLLGPKKMVKNLS
FT                   FSTKLAISHQLLDEIRNLK"
FT   gene            271560..271901
FT                   /locus_tag="PMN2A_1599"
FT   CDS_pept        271560..271901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1599"
FT                   /product="uncharacterized secreted or membrane protein"
FT                   /note="Alternative locus ID: NATL2_02911"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1599"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59087"
FT                   /db_xref="GOA:Q46HE1"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HE1"
FT                   /protein_id="AAZ59087.1"
FT                   /translation="MTLRMQKTFLYKSSTKIVDRLANWAANPWRRYSLLAIIFLIGFLA
FT                   GSSLGMINGVLALMDPVGAFIALIFLELLIQARFVFLKSNKPIILVRIFDMFRIGLAYG
FT                   LFSEGLKLL"
FT   sig_peptide     271560..271712
FT                   /locus_tag="PMN2A_1599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.799 at
FT                   residue 51"
FT   gene            complement(271919..272938)
FT                   /locus_tag="PMN2A_1600"
FT   CDS_pept        complement(271919..272938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1600"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="Alternative locus ID: NATL2_02921"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1600"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59088"
FT                   /db_xref="GOA:Q46HE0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HE0"
FT                   /protein_id="AAZ59088.1"
FT                   /translation="MNNWKHNHVLDLSTFSLEDYKTVLELTTRFKDVHKSSSRKLPALH
FT                   GRLIANLFFEPSTRTRTSFELAAKRLSADVQNFSVSSSSLNKGETPLDTILTYISMGAD
FT                   ILVIRHESTNVPAELANYVDINNINTSILNAGDGFHSHPSQGLLDLFTLATFFNPNEPS
FT                   TNSLLNKKITIVGDILHSRVARSNLWALTACGAEVTLCGPPSLLPEEFIDFVQNPPLGQ
FT                   NFDPINKRGSVFIKRSLKDALKNSDAVMTLRLQKERMKQNMLTDLDSYYVQYGITHESL
FT                   KWCEKKVPVLHPGPVNRGVEISNRLVEDNSINLISKQVENGIPTRMALLYLLGLNKKD"
FT   gene            complement(272935..273504)
FT                   /locus_tag="PMN2A_1601"
FT   CDS_pept        complement(272935..273504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1601"
FT                   /product="methylpurine-DNA glycosylase (MPG)"
FT                   /note="Alternative locus ID: NATL2_02931"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1601"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59089"
FT                   /db_xref="GOA:Q46HD9"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD9"
FT                   /protein_id="AAZ59089.1"
FT                   /translation="MVAPSLIGCFLIKRLSKNSYLAGVIVETEAYSQEEASCHGFSGRT
FT                   QRNKTLFGEPGNFYIYLSYGINSCVNIVTGKKNWANGVLLRSIAIKGEHERIASGPGLL
FT                   AKRFGLNKNFDNLHLSPANDFWLSEGENLTRMGNIVQTTRIGISQAKDIPWRWYLKSSR
FT                   SVSKRVRGDRIPPKNKCWEPSTFEEL"
FT   gene            273760..274047
FT                   /locus_tag="PMN2A_1602"
FT   CDS_pept        273760..274047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1602"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="Alternative locus ID: NATL2_02941"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1602"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59090"
FT                   /db_xref="GOA:Q46HD8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HD8"
FT                   /protein_id="AAZ59090.1"
FT                   /translation="MTKISSSDVRKVAQLARLELPEDQIETYTEQLEEILSYVDQLQEI
FT                   DTKNIPPTTRAVEVVNAMRDDLVEVNCSREDLLNQAPHREGDFFRVPKIL"
FT   gene            complement(274060..275091)
FT                   /locus_tag="PMN2A_1603"
FT   CDS_pept        complement(274060..275091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1603"
FT                   /product="beta-carotene hydroxylase"
FT                   /note="Alternative locus ID: NATL2_02951"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1603"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59091"
FT                   /db_xref="GOA:Q46HD7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD7"
FT                   /protein_id="AAZ59091.1"
FT                   /translation="MTQCLSRSDKNKATKKLKSLRDWQNEIQEYLDPPKPLNVTLGLFF
FT                   GGYFLAIVSVWQWYQGNWPLPILVALAFLALHMEGTVIHDACHNAAHPNKWINQFMGHG
FT                   SAILLGFSFPVFTRVHLEHHKYVNDPKNDPDHIVSTFGPIWLIAPRFFYHEYFFFERKL
FT                   WRKFELMQWGIERGIFICIVIAGIKYNFMNVIYNLWFGPALMVGVTLGIFFDYLPHRPF
FT                   QSRNRWKNARVYPSKLMNLLIMGQNYHLVHHLWPSIPWFEYKPAYEATKPLLDQKGSPQ
FT                   RMGIFETQKDSLNFLYDVLLGIRSHKERRSKMRPIARILPKNNWRRKYIKLIHKTRIRT
FT                   ESK"
FT   gene            complement(275141..275223)
FT                   /locus_tag="PMN2A_R0031"
FT   tRNA            complement(275141..275223)
FT                   /locus_tag="PMN2A_R0031"
FT                   /product="tRNA-Leu"
FT   gene            275427..275945
FT                   /locus_tag="PMN2A_1604"
FT   CDS_pept        275427..275945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1604"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_02961"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1604"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59092"
FT                   /db_xref="GOA:Q46HD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD6"
FT                   /protein_id="AAZ59092.1"
FT                   /translation="MVISISGYLFLFVGLLILALPLMLMELSRPRDWLMGGLFLFLGLF
FT                   LLVENDLLRGSINLLVISMAILYGKMILEIIQTRWNQLSSEEKKRVGSFQRWFESFRQL
FT                   GQSFALLGAGFFNFFKGFTTKSEKPLKEKKWVHPELKEEVKKKVVERSTSTDSNKIGNQ
FT                   EFAENEETS"
FT   gene            275997..278900
FT                   /locus_tag="PMN2A_1605"
FT   CDS_pept        275997..278900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1605"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Alternative locus ID: NATL2_02971"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1605"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59093"
FT                   /db_xref="GOA:Q46HD5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HD5"
FT                   /protein_id="AAZ59093.1"
FT                   /translation="MNNIKKDSQKDRPTYKDTLNLLQTNFGMRANATLREPELQAFWRE
FT                   KNIDFELGLNNSGETFTLHDGPPYANGTLHMGHALNKVLKDIINKFQTMKGKKVCYVPG
FT                   WDCHGLPIELKVLQAMDKSQRAELTPIKLRKKAAAYAKKQVSQQMDGFKRWGVWGDWDQ
FT                   PYLSLDKKFEASQIKLFGEMVFKGYIYRGLKPVHWSPSSQTALAEAELEYPTGHTSKSI
FT                   YVGFKVNQIPKRLTQEISKQAPDLINSEGKLKELKLVIWTTTPWTIPANEAISVNQKLE
FT                   YVIAQSSDRSLIIIANDLLQEVSKSVGINYEKRVLIKGSILDGIIYKHPLFDKISPVVL
FT                   GGDYITTESGTGLVHTAPGHGVDDFNTAKKYNLSISCPVDEKGFLTKEAGKFEGLNVLK
FT                   DANSVIISDLINAGSLLKEIPYEHRYPYDWRTKKPTIFRATEQWFASVEGFRDKALSAI
FT                   EDVIWLPESGKNRINSMVRERGDWCISRQRTWGVPIPVFYEKNGQEILLNKETISHIAD
FT                   LFSVHGADIWWEYEVSELLPPSYLNQADRWQKGTDTMDVWFDSGSSWSSVISKKENLNY
FT                   PADLYLEGSDQHRGWFQSSLLTSVAVNEHAPFKKVLTHGFALDENGRKMSKSLGNIIDP
FT                   LVIINGGSNKKLDPAYGADVLRLWVSSVDYSADVPIGSNILKQISDVYRKVRNTSRYLL
FT                   GNLYDFDYKIDSIDIANLPLLDKWMLNRTAEVIDEISDAYNNFEFSKFFQTIQNFCVVD
FT                   LSNFYLDIAKDRLYVSSKSDFRRRSCQTVLSLVIEKISGLIAPVLCHMAEDIWQNIPYD
FT                   LEEASVFQRGWPNVPKSWKNSSFNCHVTELRKLRAVINRMLESCRNNQALGSSLEASVR
FT                   VDISDEKVKAAIEWLAESESNNVDVLRDWFLVSSLQIGGEPWAEVLVSEDNDYASVEIA
FT                   KARGFKCERCWHYEIEMSKNPQHTNICKRCEKVVLAI"
FT   gene            complement(278936..279559)
FT                   /locus_tag="PMN2A_1606"
FT   CDS_pept        complement(278936..279559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1606"
FT                   /product="uncharacterized membrane protein"
FT                   /note="Alternative locus ID: NATL2_02981"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1606"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59094"
FT                   /db_xref="GOA:Q46HD4"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD4"
FT                   /protein_id="AAZ59094.1"
FT                   /translation="MRFFLTEPQFQILVWLSYRIAATFAFGLPLFLLIWAKRSNSSSID
FT                   RLLSIYWKVSSIYAINLIFLSVESQLGQSISFIAPILIVSSIWFWSDLNEEIDEMPDYK
FT                   PIALTTRIWRWTLTFWSLLNTGLHIFSWRCLNSINENYCDNWREIPFNSFMTTKTLIKF
FT                   VLDGNWSTGFAKFFAYLSLILYLIGLLQWLIIKLPKNGRFAGKF"
FT   gene            279817..280461
FT                   /locus_tag="PMN2A_1607"
FT   CDS_pept        279817..280461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1607"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="Alternative locus ID: NATL2_02991"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1607"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59095"
FT                   /db_xref="GOA:Q46HD3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HD3"
FT                   /protein_id="AAZ59095.1"
FT                   /translation="MRQHVNPLSQFFQLPLSLPSKNILFEKSHYPIHLDIGSAKGEFLI
FT                   ELATKCPDWNFVGLEIREPLVSLCEKKRRKLELTNLKFLFCNVNVSLDEWLSDLDFGQL
FT                   KRVSIQFPDPWFKRKHFKRRVLKTNILNSIAKAMSKNGEIFIQSDIFELIEYMTNTIDE
FT                   NRYFTRKNVGDLRSINKNPYNVMTDREILSLKKNLLIYRVMYIRNSLLFTN"
FT   gene            280542..281111
FT                   /locus_tag="PMN2A_1608"
FT   CDS_pept        280542..281111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1608"
FT                   /product="thioredoxin-like protein TxlA"
FT                   /note="Alternative locus ID: NATL2_03001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1608"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59096"
FT                   /db_xref="GOA:Q46HD2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD2"
FT                   /protein_id="AAZ59096.1"
FT                   /translation="MIDKSNSDTVIGSRQKIFLVILSFFLVVSLFFFRTGFKANEMLNQ
FT                   LAKNSLEPEIALSNGKPTVFEFYADWCEACKEMAPDMVNAEKLNSNKIDIVLLNVDNSR
FT                   WFDLIDKYDVNGIPKLTFFDDQGEFKGFSLGVRKYSELNEIFLALINNSELPSFTKLSN
FT                   SSNLISKNNLKVLNNSIKSEGPRDHS"
FT   gene            complement(281108..281746)
FT                   /locus_tag="PMN2A_1609"
FT   CDS_pept        complement(281108..281746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1609"
FT                   /product="Thymidylate synthase complementing protein ThyX"
FT                   /EC_number="2.1.1.148"
FT                   /note="Alternative locus ID: NATL2_03011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1609"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59097"
FT                   /db_xref="GOA:Q46HD1"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD1"
FT                   /protein_id="AAZ59097.1"
FT                   /translation="MSSVQLITSTPNAEKSMAYIARVSNPKNQDNDDFTKLIGYCIKNE
FT                   HWSVFEQAYMTLQIETTRGIAAQILRHRSFTFQEFSQRYADSMQLGEIPIPELRRQDNK
FT                   NRQNSISDLPKEIINTFNKKIKHQFVQNKELYEEMLEAGIAKECARFVLPLATPTRIYM
FT                   TGSCRSWIHYINLRTGHGTQKEHMEIAQECKNIFSKEYPVVSSALNWLF"
FT   gene            complement(281749..282342)
FT                   /locus_tag="PMN2A_1610"
FT   CDS_pept        complement(281749..282342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1610"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="Alternative locus ID: NATL2_03021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1610"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59098"
FT                   /db_xref="GOA:Q46HD0"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HD0"
FT                   /protein_id="AAZ59098.1"
FT                   /translation="MLKNDLWIAEQASLGMLEPFQEKLIRHLEPESEKSPVLSFGCSSY
FT                   GYDLRLSSKEFLIFRHVPGTVMNPKKFNPANLEPTDLKEDEDGKYFILPAHSYGLGVAL
FT                   EKMKVPPNITVICLGKSTYARLGIIVNTTPAEASWEGHLTLEFSNSSGADCRIYADEGI
FT                   CQLLFFEGDPCETTYSDRKGKYQYQQEKVTLAKV"
FT   gene            complement(282343..282939)
FT                   /locus_tag="PMN2A_1611"
FT   CDS_pept        complement(282343..282939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1611"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="Alternative locus ID: NATL2_03031"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1611"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59099"
FT                   /db_xref="GOA:Q46HC9"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC9"
FT                   /protein_id="AAZ59099.1"
FT                   /translation="MNARVSINAQQRGSSPSKEASLRPTHIRKPLQLVATQGQVQIHTS
FT                   TFRGSFSVVLSEAIRSAGLGSQVLIAQFLRGGVNQGPNGAINLCGRLEWLRPAIETCLQ
FT                   EKILEEHLSLKRKYEEKAIKELWEFCKSRLIEKKIDKIVLDEIGIAISLGFIEENDLIF
FT                   MINNRPSSTDIILTGPSIPPKVIEMADQITELRCN"
FT   gene            283254..283985
FT                   /locus_tag="PMN2A_1612"
FT   CDS_pept        283254..283985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1612"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="Alternative locus ID: NATL2_03041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1612"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59100"
FT                   /db_xref="GOA:Q46HC8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC8"
FT                   /protein_id="AAZ59100.1"
FT                   /translation="MVTSYRGFTRFNQPKNSQMVGSSSTPLPPNKTLLDVIKSLEGVST
FT                   ETVDRSKTIFFPGDPAERVYLIRRGAVRLSRVYETGEEITVALLRENSLFGVLSLLTGH
FT                   RSDRFYHAVAFTRVELVSAPATSLRNAIEQDASVGLLLLQGLSSRVLQTETMIETLTHR
FT                   DMSSRLASFLLVLCRDFGVPGEKGVTIDLRLSHQAIAEAIGSTRVTITRLLGELKSSSL
FT                   LAIDRKKITIFDPIALAKRFN"
FT   gene            284041..284967
FT                   /locus_tag="PMN2A_1613"
FT   CDS_pept        284041..284967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1613"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="Alternative locus ID: NATL2_03051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1613"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59101"
FT                   /db_xref="GOA:Q46HC7"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC7"
FT                   /protein_id="AAZ59101.1"
FT                   /translation="MTAWLKILLVLILGGILSTLGDRLGTRVGKARLSIFKLRPKSTAV
FT                   LITVFTGSIISAISFATMVVFDRDLRVGLFQLEDIREKIIESEKELKKLEKNLYALRSG
FT                   NVVISSGQTLVTKTIKLNKTNDIKKIIESILQQANFYAFNLVKTNQSEYRRILLVRKDD
FT                   IEKLENKIADNRSWVVRIKSAGNILRGENYVYAFPEVTLNKMITKKGEVIAIENLSLSK
FT                   SDSESISKKINLLMASTLAEVRRRGSLSSELKINANQINNLGKYLVSIKKGEFQIIARA
FT                   LEDSQSAEKVSVSLELKSLEKSISNKS"
FT   gene            284968..285405
FT                   /locus_tag="PMN2A_1614"
FT   CDS_pept        284968..285405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1614"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1614"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59102"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC6"
FT                   /protein_id="AAZ59102.1"
FT                   /translation="MSLYISIDPGMKKCGLLLADMQSGEVIEAGVASLNKFSDLVSQWN
FT                   EDHEITKIIIGNGTNCKYIENKLKRNNSFNINYVNERGSTLRARFRYWEIWPPNYFIRW
FT                   LPKEILFPPANLDAIVALILLEDFLKYRLIWPSKVNIKTWP"
FT   gene            complement(285389..285646)
FT                   /locus_tag="PMN2A_1615"
FT   CDS_pept        complement(285389..285646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1615"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1615"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59103"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC5"
FT                   /protein_id="AAZ59103.1"
FT                   /translation="MYNKPSTIAYLQIHKQCFNQKKVEGIVRAGNFEWSFTWAFNQGQL
FT                   LIEPPLGRALIKDALERYLVKADYKLESGGDYIFTVRAKF"
FT   gene            complement(285660..286268)
FT                   /locus_tag="PMN2A_1616"
FT   CDS_pept        complement(285660..286268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1616"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Alternative locus ID: NATL2_03081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1616"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59104"
FT                   /db_xref="GOA:Q46HC4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HC4"
FT                   /protein_id="AAZ59104.1"
FT                   /translation="MLSDELKLLVGLGNPGTEYEKTRHNVGFMVLEEIARKNNCSFRES
FT                   KKLFGRTCEYGSGIEKTRLLMPNTYMNESGKSVRSAKDWFDFQNNQLIVLVDDMDLPLG
FT                   KIRVRSKGSSGGHNGLKSIINHLGTAEFKRLKIGIGAPSNDQQERKSKTVSHVLGRFSK
FT                   EEFIILNFIIQEIISCIESITSNNWEKISTRLNSYKPDN"
FT   gene            complement(286330..286545)
FT                   /locus_tag="PMN2A_1617"
FT   CDS_pept        complement(286330..286545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1617"
FT                   /product="Twin-arginine translocation protein TatA/E"
FT                   /note="Alternative locus ID: NATL2_03091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1617"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59105"
FT                   /db_xref="GOA:Q46HC3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC3"
FT                   /protein_id="AAZ59105.1"
FT                   /translation="MNIFGVGLPEIAVIAGLALVIFGPKRLPELGRTIGKTLKGLQSAS
FT                   TEFEREIKNAMTEEESANENIADKEN"
FT   gene            complement(286579..286776)
FT                   /locus_tag="PMN2A_1618"
FT   CDS_pept        complement(286579..286776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1618"
FT                   /product="photosystem II 10 kDa phosphoprotein PsbH"
FT                   /note="Alternative locus ID: NATL2_03101"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1618"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59106"
FT                   /db_xref="GOA:Q46HC2"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HC2"
FT                   /protein_id="AAZ59106.1"
FT                   /translation="MGQKTALGSLLKSIGNSGQGKVVPGWGAVPVMAFIGVLLLVFLVI
FT                   MLQIYNQSLLLQGFSVDWNG"
FT   gene            287134..287262
FT                   /locus_tag="PMN2A_1619"
FT   CDS_pept        287134..287262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1619"
FT                   /product="photosystem II reaction center PsbI protein"
FT                   /note="Alternative locus ID: NATL2_03111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1619"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59107"
FT                   /db_xref="GOA:Q46HC1"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HC1"
FT                   /protein_id="AAZ59107.1"
FT                   /translation="MLALKISVYTVVFFFVGIFLFGFLASDPTRTPNRKDLESPQD"
FT   gene            287403..289340
FT                   /locus_tag="PMN2A_1620"
FT   CDS_pept        287403..289340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1620"
FT                   /product="repeats containing protein"
FT                   /note="Alternative locus ID: NATL2_03121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1620"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59108"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HC0"
FT                   /protein_id="AAZ59108.1"
FT                   /translation="MLSLFETSKGKEHFLGKSFNPKHYIFSVGNLEENDKRLSSRKLEQ
FT                   NEVTSLTLKIFADKQYDYDQNIYLAEGNVKALINGGILRSDLLSYNKSTGILSAEGNIR
FT                   FRKGGQYFRAKEFKFNLLKKEGSIKDAYGILDLKNVVNDLKIDAISNQAKALKSTNDKE
FT                   INTYDDGIEFSFGNIKLPDNKITRSNKSIGLINNWRFKSNSISIEENGWKSNRIVFTND
FT                   PLDPNQISFEGIDVIAEEEEDGRLLITSSKTNLILENRSKIFIGKRIFGEKKKKRSKFQ
FT                   LILDGKDRDGLVLVRNSNATNITDNIKLELQPQFLINRAILGKTNSYKNSKDKNINLSD
FT                   LFGLNINLNANNSNWSFDSLNDLSTLNTSRLFNGLRHSSSFRIPVLEESTFNIFTAYRS
FT                   RAWNGTIGETEIKSAFGGFIEKSQYFTTGSLKNNLNIRIGTGRYEAEKFENSEMISLWR
FT                   SSIFSSLDSEYQIWKSNKKNLYKNYLTPLSPVLIDSELVLKTNIVSAYFNYLNDSDQGF
FT                   LKLTIGPEIRLGNLERDYFDYTKLSVMPGVKIKSGNSPFKFDNAIDLKTINISLMQQIY
FT                   GPLMLDIISNLNIDSSSKNYGEYYDTKLGLLWHKRAYECGIYYHPNNEAGGLFFRINGF
FT                   KFANSTKAVF"
FT   gene            complement(289337..289957)
FT                   /locus_tag="PMN2A_1621"
FT   CDS_pept        complement(289337..289957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1621"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="Alternative locus ID: NATL2_03131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1621"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59109"
FT                   /db_xref="GOA:Q46HB9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HB9"
FT                   /protein_id="AAZ59109.1"
FT                   /translation="MNQKFPKGEIKSIQGRSFTMKGDDIDTDRIIPARFLKCVSFSALG
FT                   EQVFADDRKELKGNHPFDLDQNKGANILVVNDNFGCGSSREHAPQALMRWGIRLIIGES
FT                   FAEIFFGNCLALGIPCLTASKEEIVNLQNLVEKNNNQIWDCNLKNLSISNQKETVKLIL
FT                   DEGPHNMLYSGKWDATSQLLDEEEKINKTFNNLPYLNNFKQQI"
FT   gene            complement(289982..291391)
FT                   /locus_tag="PMN2A_1622"
FT   CDS_pept        complement(289982..291391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1622"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="Alternative locus ID: NATL2_03141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1622"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59110"
FT                   /db_xref="GOA:Q46HB8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HB8"
FT                   /protein_id="AAZ59110.1"
FT                   /translation="MSSRTLYDKVWNFHQVKELPGGSTQLFIGLHLIHEVTSPQAFSAL
FT                   NEKKLGVKFPNLTVATVDHIVPTSNQQRPFSDPLAEEMLATLEKNCKTHGIKFHGIGSN
FT                   SQGVVHVMAPELGLTQPGMTVACGDSHTSTHGAFGAIAFGIGTSQVRDVLASQSLAMNK
FT                   LKVRRIWVEGELQKGVYAKDLILHIIRHLGVKGGVGFAYEFAGPAIEKLSMEGRMTICN
FT                   MAIEGGARCGYINPDETTFKYIKGKEHAPKGQEWDKAISWWKSLASDSKATFDDEIQLD
FT                   GSSIEPTVTWGITPGQGISIKETIPNPEFLPKNEQQIAKDACKYMNLKPDEPIEGQSID
FT                   VCFIGSCTNGRLSDLEEASKIVKGNTVADGIRAFVVPGSQKVAKEAKEKGLDKIFLKAG
FT                   FEWREPGCSMCLAMNPDKLEGRQISASSSNRNFKGRQGSANGRTLLMSPAMVAAAAING
FT                   KVTDVRKFLKE"
FT   gene            complement(291415..292707)
FT                   /locus_tag="PMN2A_1623"
FT   CDS_pept        complement(291415..292707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1623"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="Alternative locus ID: NATL2_03151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1623"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59111"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HB7"
FT                   /protein_id="AAZ59111.1"
FT                   /translation="MKTSKEITINKKNKFGAEILCIGSEILLGNIVNTNSQWIAAQLAI
FT                   LGIPHFRQTVIGDNPARLEEAILEASNRSEILITTGGLGPTPDDIKTKVIADTFKTPLE
FT                   QRNDILIDLRNKSKDKVSKLSESQKKQSLVPKGAKIINNYSGTAPGIFWSPKENFTILT
FT                   FPGVPSELKEMWAKEASKLLISNNLSKEVISSKVLHFAGITESLLADKIQHLLISKNPT
FT                   VATYASTGSVKVRITARGKSSEKTNRLIEPIKKELTQITGLKCFGLDNETLEEIVFKLL
FT                   LKRKETIAVAESCTGGGIGSKLTKIPGSSQIFHGGVIAYNNSIKQRLLGVPEEIINTHG
FT                   AVSKQVVESMARGVQIKFKVNWAISVSGIAGPTGGSKSKPVGLVNFCIKGPKTLITWEE
FT                   NFGSNKTREDIQKLSVLNALDRLRLSIIMAN"
FT   gene            complement(292694..293929)
FT                   /locus_tag="PMN2A_1624"
FT   CDS_pept        complement(292694..293929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1624"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="Alternative locus ID: NATL2_03161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1624"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59112"
FT                   /db_xref="GOA:Q46HB6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HB6"
FT                   /protein_id="AAZ59112.1"
FT                   /translation="MKCDPSIAKLINNELSRQETHLELIASENFASKAVMEAQGSVLTN
FT                   KYAEGLPNKRYYGGCEYVDGVEQLAIDRAKNLFGANWANVQPHSGAQANFAVFLSLLKP
FT                   GDTIMGMDLSHGGHLTHGSPVNVSGKWFKTCHYEVDKKTEMLDMDAIRKKAIENQPKLI
FT                   ICGFSAYPRKIDFKAFRSIADEVNAYLLADIAHIAGLVASGLHPSPIPYCDVVTTTTHK
FT                   TLRGPRGGLILSKDKEIGKKLDKAVFPGTQGGPLEHVIAAKAVAFKEASAPEFKIYSQK
FT                   VISNAKVLSNQLQKRGISIVSKGTDNHIVLLDLRSIGMTGKVADQLVSDIKITANKNTV
FT                   PFDPESPFVTSGLRLGSAALTTRGFNEQAFGDVGNVIADRLLNPNDEDIKEKSINKVSE
FT                   LCNKFPLYSENI"
FT   gene            complement(294054..294127)
FT                   /locus_tag="PMN2A_R0032"
FT   tRNA            complement(294054..294127)
FT                   /locus_tag="PMN2A_R0032"
FT                   /product="tRNA-Arg"
FT   gene            294309..294605
FT                   /locus_tag="PMN2A_1625"
FT   CDS_pept        294309..294605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1625"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1625"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59113"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HB5"
FT                   /protein_id="AAZ59113.1"
FT                   /translation="MSTSIDSSQINELAMSIADRLFIQVGNWNLYLGDAGLAKDLAIEC
FT                   QANFDQGANVAARKGLEGIQVKLGGGITRLPLSKLIPPNQFFDLEEILEPYCR"
FT   gene            294646..294894
FT                   /locus_tag="PMN2A_1626"
FT   CDS_pept        294646..294894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1626"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1626"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59114"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HB4"
FT                   /protein_id="AAZ59114.1"
FT                   /translation="MTNAREVVRQRIGRLGERLIGKVADADAQVEKELMKEMEIAFQEF
FT                   GIEARILSVSGVKTDEMNCLEIPLKVRSEKDVFLKDE"
FT   gene            complement(294881..296488)
FT                   /locus_tag="PMN2A_1627"
FT   CDS_pept        complement(294881..296488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1627"
FT                   /product="virulence factor MVIN-like protein"
FT                   /note="Alternative locus ID: NATL2_03191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1627"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59115"
FT                   /db_xref="GOA:Q46HB3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HB3"
FT                   /protein_id="AAZ59115.1"
FT                   /translation="MSKSIKEIAFFVSLGTLLSKFGGLARQLVIAGAFGINAAYDAYNY
FT                   AYIIPGFFLVLLGGINGPLHNSMVTLLADKNKVESRLFISSINNILSIILLIISLFIFF
FT                   SSDFLINLVGPSLTPEIKEIASYQLKIMSPIIFLSGLIGLGFGSLNAKKEFFIPSISPL
FT                   ISSLIIIISISNFWINKGNTTDLDTLNMRGGIILAKATFIGALSQYLIQIPFLIKKGIF
FT                   AISFSIQTKYSEIKRALSMIAPASLSSGMIQINVFTDLFFASKIVGAAAALSYANFLVQ
FT                   APLGIVSNTILIPLLPVFVSLRARENHLKLIKKIHQGLILSSTSMVFLGSIFISLSTPI
FT                   VILIYGRGSFNQNAVDVVSQLLIAYGIGMPFYLCRDLLVRVFYGIEDAKTPFRISIIAI
FT                   LLNLFFDWFFIGGSSPWGELSPLNLGVNGLVFSTTFVNFFACTLLLFKLNHKLDKLDLP
FT                   NLLAQNLRIILIGLISGICSFFIFKIIFLPYSFINLLLKLIISSGISLIIFYCLAIILK
FT                   IDEIDNLNKFLKEKFIRL"
FT   gene            296563..297339
FT                   /locus_tag="PMN2A_1628"
FT   CDS_pept        296563..297339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1628"
FT                   /product="Sugar fermentation stimulation protein"
FT                   /note="Alternative locus ID: NATL2_03201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1628"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59116"
FT                   /db_xref="GOA:Q46HB2"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HB2"
FT                   /protein_id="AAZ59116.1"
FT                   /translation="MIEIGETIIKFPPLKEGILIKRYKRFLADIELDDGEVVTAHCANT
FT                   GPMKGVLWPGRRVRLKYSPSPKRKLDWSWEQAEVPSHNENKKCWVGINTSLPNKLIKHL
FT                   IEANCLERQFGQISSIKPEVVYGLERKSRIDLLLYPSIQNEDSRKIFVEVKNTTWCEDS
FT                   LALFPDTVTTRGQKHLKELMSVYPDSRAVLIPCISRSDIELFAPGEIADPEYGRLFREA
FT                   LTKGVEVIPCAFGFFIDHITWEGIRPFQKSRENKQF"
FT   gene            297593..299083
FT                   /locus_tag="PMN2A_1629"
FT   CDS_pept        297593..299083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1629"
FT                   /product="ammonium transporter"
FT                   /note="Alternative locus ID: NATL2_03211; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1629"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59117"
FT                   /db_xref="GOA:Q46HB1"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HB1"
FT                   /protein_id="AAZ59117.1"
FT                   /translation="MTTALQSPPRRTTSRLQDASLLNGPMLLLRSIKGFRRSQSWAWLA
FT                   SIPLALLGLGVFTFSARAEVALSDLTGPQAASFLADNLWLFIATILVIFMNAGFAMVEA
FT                   GMCRQKNAVNILAKNLFVFALAVTAYWVIGYSLMYGGSVIDGWLYFQGLFVDPDPSGAL
FT                   ECAAAGDTGCLVPAVDFLFQSAFAGTAATIVSGLVAERVKFGEFVVFSIVLTAFIYPIA
FT                   GSWQWNGGWLAELGFIDFAGSSIVHSVGGWAGLVGAMLLGPRIGKFVDGKAQAMPGHNM
FT                   AIATLGALILWIGWYGFNPGSELAMDQYVAYVAVTTTLAAAGGAIAATVLSTITSGKPD
FT                   LTMIINGILAGLVSITAGCGNMTFAGSWLAGAVGGLIVVVAVAALDSAGIDDPVGAFSV
FT                   HGVCGVWGTVVIGLWGVDGMDPGAAGIGLLNGGGINQFFIQALGAAAYGIWTVVTCWIA
FT                   WQIIGGFFGGIRVSEAEETQGLDIGEHGMEAYPDFASS"
FT   sig_peptide     297593..297784
FT                   /locus_tag="PMN2A_1629"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.977 at
FT                   residue 64"
FT   gene            299203..300408
FT                   /locus_tag="PMN2A_1630"
FT   CDS_pept        299203..300408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1630"
FT                   /product="LytB protein"
FT                   /EC_number="1.17.1.2"
FT                   /note="Alternative locus ID: NATL2_03221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1630"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59118"
FT                   /db_xref="GOA:Q46HB0"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HB0"
FT                   /protein_id="AAZ59118.1"
FT                   /translation="MDTQAFKQTLHKSDRYNRRGFGSANKRAQALAEAYQSGLIGSIRE
FT                   NGNLLEHGRLKVKLAEAFGFCWGVERSVAMAYETRKHYPNERIWITNEIIHNPSVNDHL
FT                   RKMNVLFISEEKGVKDFSVVKDGDVVILPAFGATVQDMKLLHDRGCHIIDTTCPWVSKV
FT                   WHTVEKHKKHTFTSIIHGKYKHEETLATSSFAGTYLVLFDLEEANYVSDYILGKGNRED
FT                   FLKRFSKASSAGFDPDKDLQKVGVANQTTMLKSETEEIGRLFEKTMLQRFGPAQLNEHF
FT                   LAINTICDATEERQGAMFSLVDEPLDLMVVIGGFNSSNTTHLQEIAISRGIRSFHIDTP
FT                   ERIGEETNTITHMPLEGGELLTEENFLQNGNISVGITSGASTPDRVVEDVIHKLMKIGE
FT                   NF"
FT   gene            300471..301004
FT                   /locus_tag="PMN2A_1631"
FT   CDS_pept        300471..301004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1631"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="Alternative locus ID: NATL2_03231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1631"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59119"
FT                   /db_xref="GOA:Q46HA9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA9"
FT                   /protein_id="AAZ59119.1"
FT                   /translation="MTQANKSNLKDPDSQKVEVVVQSPEGEVNIFGELSIFVLRVSFSL
FT                   FMVHHGLEKLSDPGGFAEFVVGKYFSFLPGDPVIWTYLAAVTQIVCPIGLATGVLARLS
FT                   SLGLLSTMVFALYFHFIDTGLEGFPFAVVENHNYIFELSAIYAAISFYFLCAGPGRLSL
FT                   LRKSNKITYYPKGS"
FT   gene            complement(301066..302622)
FT                   /locus_tag="PMN2A_1632"
FT   CDS_pept        complement(301066..302622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1632"
FT                   /product="IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="Alternative locus ID: NATL2_03241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1632"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59120"
FT                   /db_xref="GOA:Q46HA8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HA8"
FT                   /protein_id="AAZ59120.1"
FT                   /translation="MSPIALLSVSDKTGLIPLAKALVNDLGFKIISSGGTAKLIESENL
FT                   PVTRVADYTGFPEILGGRVKTLNPKIHGGILARRDKQSHLDDLDKQNINPIDLVVVNLY
FT                   PFVKTISKENVSWEEAIENIDIGGPTMIRAAAKNHQDVLVVTDPSQYSNLIDAYKSKKI
FT                   TTELRKKYSQQAFEHTATYDLTISNWIANQSSSKKVSWLQSLPLKQELRYGENPHQKAS
FT                   WYGEPEKGWSGANQLQGKELSTNNLLDLEAALSTLREFGYKNNISNPSYQKAAVVIKHT
FT                   NPCGVAIGDSPSSALKRALDGDRVSAFGGIIAINCPVDEAAAKEIENIFIECVVAPYFD
FT                   ETAKEILSKKKNLRLLELKAESVQKADKNHIRSILGGLLIQDLDEPSIDQKKWKSVTEL
FT                   IPTDEEMNDLSFAWKIVKHIRSNAIAVASNQQSLGIGAGQMNRVGSAKLALEAAGTKSK
FT                   GAVLASDGFFPFDDTVKMASDYGISSIIQPGGSIRDEDSIKACNELGIKMILTGKRHFL
FT                   H"
FT   gene            302687..303292
FT                   /locus_tag="PMN2A_1633"
FT   CDS_pept        302687..303292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1633"
FT                   /product="esterase"
FT                   /note="Alternative locus ID: NATL2_03251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1633"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59121"
FT                   /db_xref="GOA:Q46HA7"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA7"
FT                   /protein_id="AAZ59121.1"
FT                   /translation="MTELISLNSESATNRLVLLHGWGADAHDLMPIGKLLTDGLKDPFE
FT                   IISLSAPQPHPSGSGRQWYPLYPHEWEQVPNAVLDLEKRLNNLCTKQIPLEKTVLLGFS
FT                   QGGAMALDLATRIKFQGVFALSSYPHPDWEPMKNMSPIFLCHGEMDDVVPKAASNKSLD
FT                   MLLKNGIKAELYFFDGGHEINNDLIHYCRGKIEQQFLS"
FT   gene            complement(303289..303657)
FT                   /locus_tag="PMN2A_1634"
FT   CDS_pept        complement(303289..303657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1634"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1634"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59122"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA6"
FT                   /protein_id="AAZ59122.1"
FT                   /translation="MSKKRKRISRRRLAGQRVMSHVPIFHLGTGQHKPVTAARRFIAEE
FT                   GLYAPAILNVRRNEHTTDRFFWGEKGLFSAQYAEENHFLFPSLRVIVEFLGEDKIFAGL
FT                   ELTADDWEEIEEYEYAFV"
FT   gene            complement(303857..303982)
FT                   /locus_tag="PMN2A_1917"
FT   CDS_pept        complement(303857..303982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1917"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1917"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23855"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB7"
FT                   /protein_id="ABU23855.1"
FT                   /translation="MKSFCNFRQGKRNIQKLEKIEKSIKMLIKNLDYLTRRLSQI"
FT   gene            303973..305094
FT                   /locus_tag="PMN2A_1635"
FT   CDS_pept        303973..305094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1635"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="Alternative locus ID: NATL2_03281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1635"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59123"
FT                   /db_xref="GOA:Q46HA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA5"
FT                   /protein_id="AAZ59123.1"
FT                   /translation="MTSTQYSERFLNFVQQQLMSFQADQELEHVVVYVARSGESGSPTL
FT                   EVVGQWPKSEKFLQPVETDTALRTPSSNRRWYPLQEGSILLGVIRAERFATEEEWRESL
FT                   DQRLQSMSILMANSLASELDRKRLLDQLDDQKEQISLMVHQLRNPLAALGTYAKLLLRK
FT                   IGPESENENLVKGLMNEQAQVNKYLSALDQLSQVKLPQADDGSNRLLLPPLLPSETYIS
FT                   VKSLIEPLIERAKARANLQGRNWYGPSKWPLWMEAKSISEGVIAEIVANLLENAFRYSP
FT                   PKASIGIEVIEEGICIWDEGTPIKEEEREKIFQKGFRGESGSKMSGSGIGLALARDLAR
FT                   QLGGDLQLLVDPSKFKNSLPESGNAFVFNLEPK"
FT   gene            complement(305075..305656)
FT                   /locus_tag="PMN2A_1636"
FT   CDS_pept        complement(305075..305656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1636"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /note="Alternative locus ID: NATL2_03291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1636"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59124"
FT                   /db_xref="GOA:Q46HA4"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA4"
FT                   /protein_id="AAZ59124.1"
FT                   /translation="MISIAISICITGGLHIDGLMDTADGIGAGPSKQIEAMKDSRVGAI
FT                   GVQSLVIILVLQIAAIIKLGFYAPFAFPIAAFWGRFSQIFAIENYEYILNKEFGSIHQK
FT                   YWRGISQEIRPSLIIICIGIIFFLSTTNLNLSNTLLLVYCIFSGLTTSILIPHFINKLL
FT                   GGHNGDSYGAGLVITETTNLLLLSIILVPN"
FT   gene            305931..307061
FT                   /locus_tag="PMN2A_1637"
FT   CDS_pept        305931..307061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1637"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="Alternative locus ID: NATL2_03301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1637"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59125"
FT                   /db_xref="GOA:Q46HA3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA3"
FT                   /protein_id="AAZ59125.1"
FT                   /translation="MKKPLFDFQIKSRCKTTLARVCSFKTPNGIVNTPKFMPVGTLGTV
FT                   KGVTSQQLEKTGAEMILANTFHLHLQPGEKIVQDAGGLHKFMSWNKPILTDSGGFQVFS
FT                   LAKLNKIDDEGVSFQSPRDGKHIYLTPEKAIEIQMALGSDVAMAFDQCPPYPASESDVE
FT                   EACKRTHHWLERCLNAHKKNDQAVFGIVQGGCFPHLRELSAKIVSGFGLPGIAIGGVSV
FT                   GEPINQMHKIVRETCPLLPQDRPRYLMGIGTLREMAIAVANGVDMFDCVIPTRLGRHGS
FT                   ALVNGETWNLRNSRFKDDYSSLDPTCTCEACTGYSRAYIHHLIRNKELLGLTLLSIHNL
FT                   THLIRFTGAMRQAITEGCFSEDFAPWQSDSKARHTW"
FT   gene            307096..307239
FT                   /locus_tag="PMN2A_1638"
FT   CDS_pept        307096..307239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1638"
FT                   /product="photosystem II protein PsbK"
FT                   /note="Alternative locus ID: NATL2_03311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1638"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59126"
FT                   /db_xref="GOA:Q46HA2"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46HA2"
FT                   /protein_id="AAZ59126.1"
FT                   /translation="MALINFDLLAELPLAYQAFAPTVDVLPLIPLFFFLLVFVWQAAVG
FT                   FR"
FT   gene            complement(307106..307300)
FT                   /locus_tag="PMN2A_1918"
FT   CDS_pept        complement(307106..307300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1918"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1918"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23856"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB8"
FT                   /protein_id="ABU23856.1"
FT                   /translation="MLRISNRLVNFLKIQQKNFAFNESQLPLAKQKQAEKRKEVLAEVH
FT                   PLLVQKLGMQVEVQQASRN"
FT   gene            complement(307372..308394)
FT                   /locus_tag="PMN2A_1639"
FT   CDS_pept        complement(307372..308394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1639"
FT                   /product="dehydrogenase"
FT                   /note="Alternative locus ID: NATL2_03331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1639"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59127"
FT                   /db_xref="GOA:Q46HA1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA1"
FT                   /protein_id="AAZ59127.1"
FT                   /translation="MKTISKIKENIIPVKVGVIGIGNMGWHHARVLSLLKDAELIGVAD
FT                   LDEERGKLAMEQFNCNWFGNYKDLLHQVEAVCIAVPTLFHHEVGLECLKAGKHVLIEKP
FT                   IAANKEEASSLINASNNAKKLLQVGHIERFNPAFRELTKVVANEEVVVLEARRHSPHPE
FT                   RANDVSVVLDLMIHDIDLVIELANSKVIRLAAVGGCSGDGPMDYVNATLGFQNGVVASL
FT                   TASKMSHKKIRSLSAHCKESLIETDFLNHNIHIHRKAHEWYSADHGELLYRNDGFIEEV
FT                   STTSIEPLYAELEHFLQCVRGEEKPAVDGLQASRALHLADLIEKAVSTSSEDILLSKGI
FT                   "
FT   gene            complement(308432..309700)
FT                   /locus_tag="PMN2A_1640"
FT   CDS_pept        complement(308432..309700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1640"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1640"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59128"
FT                   /db_xref="GOA:Q46HA0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q46HA0"
FT                   /protein_id="AAZ59128.1"
FT                   /translation="MSLLLLCILLVIPAFFNAGQFAILRLRSTKVQRLVEDGLPGSNSI
FT                   IRLQKRLRRTLLIAELGITISLISIGWICKNFASQWWGNNASINYLLDLGLFITVVLLA
FT                   TLISGLLPKALVLNQPETSALKLSPLIEAAIKWMSPFLSLLEGLALLILRLFGLNTQSE
FT                   SLTTAAFSAGELEKLIETGGVTGLKPDERNILEGVFALRDTQVREVMVPRSGMVTLPRE
FT                   VSFTQMMEEVHKTRHARYLVIDDSLDNVLGVLDLRQLADPIAKGKMQANSSLEPYIKPV
FT                   VRVLETSTLAELLPLIKNGNPLLLVVDEYGGTEGLITSADLTGEIVGDEIQFDNKESEL
FT                   RSLDDLKKIWLTSGEIEVIELNRELNLKLPEADDHYTLAGFVLEKLQEIPSSGETFIHN
FT                   EIVFEIISMKGPRINKVKIILPK"
FT   sig_peptide     complement(309632..309700)
FT                   /locus_tag="PMN2A_1640"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.770) with cleavage site probability 0.565 at
FT                   residue 23"
FT   gene            complement(309715..309787)
FT                   /locus_tag="PMN2A_R0033"
FT   tRNA            complement(309715..309787)
FT                   /locus_tag="PMN2A_R0033"
FT                   /product="tRNA-Met"
FT   gene            309831..310478
FT                   /locus_tag="PMN2A_1641"
FT   CDS_pept        309831..310478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1641"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="Alternative locus ID: NATL2_03351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1641"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59129"
FT                   /db_xref="GOA:Q46H99"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H99"
FT                   /protein_id="AAZ59129.1"
FT                   /translation="MPKVNIYLIPPRCLIIKLAYKDMNPLNPSSDGIKENLLTLLAQKA
FT                   YRFGDFSLASGKKSSHYVNCKPVSLSGPGLLSISSLFLKQINESDSGVAGLTLGADPLV
FT                   SGVVILAAQSGIDLNGLIVRKEAKGHGTGAWLEGPLPPKGSVITVLEDVVTTGGSSLKA
FT                   VEQLRNQGYLVKQVLAIVDREEGGLDAMSKADLELNSLFFLKEIVERANSLQ"
FT   gene            310475..311323
FT                   /locus_tag="PMN2A_1642"
FT   CDS_pept        310475..311323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1642"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1642"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59130"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H98"
FT                   /protein_id="AAZ59130.1"
FT                   /translation="MTESQALIWDETFPSLLLKGQGTTSFLHGQTTADVFAQKELDRIF
FT                   MCCWLSTKGALKAVLEIRLSDDMAEIVIICGEINSIRDGFESVIFPADKVKLEVIDPIR
FT                   RRQEINNNSSWKDSDFSWIDDNTFSIDGITKYKKATKEELEGWKIRQGIPSFDKEMNGE
FT                   TNPYELGLADTINLDKGCYLGQEAMAKFFRSKSLKYQLRYWEAYGENDNFQIGKKFFNT
FT                   NKNEGYKKNVGVVTSSIRVDDNFFNGLALIKKTFLDHDFCFSENGDSITIKKPISFTNP
FT                   F"
FT   gene            complement(311342..312793)
FT                   /locus_tag="PMN2A_1643"
FT   CDS_pept        complement(311342..312793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1643"
FT                   /product="DNA repair enzyme, contains HhH domain and
FT                   nuclease of RecB family"
FT                   /note="Alternative locus ID: NATL2_03371"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1643"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59131"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H97"
FT                   /protein_id="AAZ59131.1"
FT                   /translation="MKCNKSKPINDHLLRSWIRCRRKAWLDIYGDKQKKLWTAHSTLQL
FT                   NHQIDCFHNLSQKSYGIGIRACEEGKNIAYGVRIKYPLIKNRLIKANLPILRKTSGESI
FT                   WGNFAYQPILARQGKKITREHKLTLALTGLLINNLQKFQVKKGLILHKENEVIKVEKIK
FT                   LSDNINTDLIGSLLHLEKDIESRTPPPITSNRKKCTICSWRKECDAVAIKEGSLSEVSG
FT                   IGAKREVLLNKIGINNIEELAKIKHYKLQEKLEIFGTQHSDISKQIILQSQSQSTNRAI
FT                   KLNPEIELNNLKKAKGLYIYDIESDPDIRHDFLHGFIRLPKNIKNEISLEKTKYSPLLN
FT                   IEKNTESFLWKRITKKLSINQDYPIIHYGETEPISLLKLGIRQGANPHEIEELKNRFID
FT                   IHLLIREYWCLPVRNYGLKSIAEWIGFEWKQSNADGARALLWWRQWKKSRKINKMYSRN
FT                   LNSIFEYNRDDCIATLMIAKWLIDH"
FT   gene            312846..314306
FT                   /locus_tag="PMN2A_1644"
FT   CDS_pept        312846..314306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1644"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="Alternative locus ID: NATL2_03381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1644"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59132"
FT                   /db_xref="GOA:Q46H96"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H96"
FT                   /protein_id="AAZ59132.1"
FT                   /translation="MKKKKLNLTKEKISFGTDGWRGILGVEFTLERLLKVAAAAAQELA
FT                   YVKEKKNNKIIIGYDRRFLAEEMAEAVASAVRGVDLVPLLASSALPTPSCSWGIVEENA
FT                   LGALVITASHNPCEWLGLKIKGPFGGSVDSSFTDSVQKRLDAGGISIPIEGVTERVDFR
FT                   KQHLLGISQKFDMHLISDGLRKLGVKIFVDPMHGSAAGCMSELFGVDSEDLIYEIRTEI
FT                   DPCFGGNPPEPLKAYLSQLIQEVQDESQAGELSMGLVFDGDGDRIAAIDEKGRYCNTQL
FT                   LMPVLIDHLARVRNMPGCVVKTVSGSDLMRLVAEDLGREVLEKPVGFKYIAEEMLSREV
FT                   LIGGEESGGVGFGHHLPERDALFTALLLMESIVADGKCLGEKIDSLHARFGKSHFERID
FT                   LTLKDMEMRRSLEDFLKQKTPSSIGHKSVLEVISTDGIKLILDKSHWLMFRFSGTEPLL
FT                   RIYCEAPSSAEVTSTLYYAKQLIDNSFG"
FT   gene            314299..314889
FT                   /locus_tag="PMN2A_1645"
FT   CDS_pept        314299..314889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1645"
FT                   /product="Ham1-like protein"
FT                   /note="Alternative locus ID: NATL2_03391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1645"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59133"
FT                   /db_xref="GOA:Q46H95"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H95"
FT                   /protein_id="AAZ59133.1"
FT                   /translation="MDNVPLVIASGNKGKIGEFKKLLDDFPIDLLTQPVGFEIEETGST
FT                   FMENARIKAIAVSQATGNLSLADDSGLSVEALGGAPGIYSSRYASSDKQRIEKLLAELK
FT                   PFSNRKAKFECALCIASGEKVLIEVSGFCEGLITFFPKGQNGFGYDPIFEVSGLGETYA
FT                   EMDHEKKKHIGHRGNAFKLLIPKLKQLLGSMKK"
FT   gene            complement(314916..316409)
FT                   /locus_tag="PMN2A_1646"
FT   CDS_pept        complement(314916..316409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1646"
FT                   /product="lignostilbene-alpha, beta-dioxygenase"
FT                   /note="Alternative locus ID: NATL2_03401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1646"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59134"
FT                   /db_xref="GOA:Q46H94"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H94"
FT                   /protein_id="AAZ59134.1"
FT                   /translation="MAVSYLKRETSPKQTIFNKEDWSSAYCNVEKELDNVQLKLVKGSI
FT                   PEQISGTFYRNGPGRLERGGRWVHHPFDGDGMIAAFKFDNGKINLTNRFVRTKEWTEEE
FT                   KSQKFLYRGVFGTQKEGGVLANAFDVRLKNIANTHVIKLGDDLLALWEASSPYSLNPNT
FT                   LETKGLSNLKGVLKKGEAFSAHPRFDPGHHQSQRMVTFGVSTGPKSTIRLMEFSTEGEN
FT                   IGSLLSDRKDSFNGFAFLHDFAITPNWAIFLQNAISFNPLPFLLGQKGAAQCLASKSDG
FT                   TPKFLLIPRDSGKFAGQPPKSVNAPKGFVFHHLNAWEDNEKINIESIFYDDFPSIGPED
FT                   NFREIDFDLLPEGILKRSEINPIENTFTCSTISNQCCEFAMVNPHFEGLKARFSWMATA
FT                   EEKEGNGPLQAIKKIDLSNNKEISWSAAPRGFVSEPIFIPSQESKSEEDNGWVVALVWN
FT                   SIRSGTDLIILDSKDLTEKAILEVPISIPHGLHGSWVEN"
FT   gene            complement(316498..317109)
FT                   /locus_tag="PMN2A_1647"
FT   CDS_pept        complement(316498..317109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1647"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="Alternative locus ID: NATL2_03411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1647"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59135"
FT                   /db_xref="GOA:Q46H93"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H93"
FT                   /protein_id="AAZ59135.1"
FT                   /translation="MEKTREGEIRRETKETDVFVKIDLDGSGKCSANTGIGFLDHMIQQ
FT                   LSSHGLFDIEVRANGDTHIDDHHTNEDVGIAIGQALSKALGDRVGIKRFGHFLAPLDEA
FT                   LIQVVVDCSGRPHLSFSLDIPSQKVGTYDTELVKEFFGAVVSNGGLTLHIRQLAGNNTH
FT                   HIIEATFKSFARALRMATEIDPRRSSQIPSSKGVLEQAGQ"
FT   gene            complement(317141..317923)
FT                   /locus_tag="PMN2A_1648"
FT   CDS_pept        complement(317141..317923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1648"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase [NADH]"
FT                   /EC_number="1.3.1.9"
FT                   /note="Alternative locus ID: NATL2_03421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1648"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59136"
FT                   /db_xref="GOA:Q46H92"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H92"
FT                   /protein_id="AAZ59136.1"
FT                   /translation="MLLDLSGKKILVTGIANNRSIAWGIAQQLKAAGAELGITYLPDEK
FT                   GRFETKVKELTSPLNPSLFLPLNVQNSSQIEEVFEAIKNQWGQLDGLVHCLAFAGKEEL
FT                   VGNYSATSSEGFSRALEISAYSLAPLCKYAKPLFSKGAGVVTLTYLGAERAIPNYNVMG
FT                   VAKAALEASVRYLSEELGPENQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRR
FT                   TVTQIEVGNTAAFLLSDLSSGISGQTVYVDAGYCINGM"
FT   gene            318044..318664
FT                   /locus_tag="PMN2A_1649"
FT   CDS_pept        318044..318664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1649"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1649"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59137"
FT                   /db_xref="GOA:Q46H91"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H91"
FT                   /protein_id="AAZ59137.1"
FT                   /translation="MVRTASTMLPLGTQLPNFELGVVSGVNSAPDDPLKGLSHIRSVDL
FT                   TKRPLFLMVICAHCPFVKHVESGITNLFNSFGNDIQFLAISSNSLITHPQDAPEFLASQ
FT                   ANKLGWKFPYLFDSDQKLAKALRAACTPDFYVFWPSPDGNLTLRYRGQMDGSRPGNETP
FT                   VSGDDIRLVFKSLLKGEVISANQKPSIGCNIKWHPGMEPEWFG"
FT   gene            318716..319885
FT                   /locus_tag="PMN2A_1650"
FT   CDS_pept        318716..319885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1650"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   enzyme"
FT                   /note="Alternative locus ID: NATL2_03441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1650"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59138"
FT                   /db_xref="GOA:Q46H90"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H90"
FT                   /protein_id="AAZ59138.1"
FT                   /translation="MQIPPFSLEAQISEIGDEIEEALIKVFRSGKYIGGEEVASFEKAF
FT                   ALATETSYSVSCNSGTDALILALRALNIGQGDEVITSSFSFFATAEAITSVGARPVFVD
FT                   IDSKNYLMDLDLIEKAITPRTKAILPVHLFGHPLDMDKIMAIAESNNLKVVEDCAQAAG
FT                   AYWRGKPVGSYGDIGCFSFFPTKNLGAAGDGGAITTNDFDLAKTIRELAIHGMPKRYFH
FT                   TNIGYNSRLDSLQAAILNVKLIRLNKWIEQRKEIAINYMNQLSAIDSIELPSNTFVNNS
FT                   GHSWNQFVIRIMDNSFIKNIKSNSDDVFDNLNRDLFKTELHRLGVNTIIYYPIPIHLQP
FT                   AYKNLEYKEGSLPVTEKVCSQVISLPIFPELKSIQQSYVIDKIKELFKK"
FT   gene            complement(319887..321368)
FT                   /locus_tag="PMN2A_1651"
FT   CDS_pept        complement(319887..321368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1651"
FT                   /product="deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /note="Alternative locus ID: NATL2_03451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1651"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59139"
FT                   /db_xref="GOA:Q46H89"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H89"
FT                   /protein_id="AAZ59139.1"
FT                   /translation="MTKFQSIFWHRRDLRFGDNIGLFEASKNSKSLIGVYVLDPKLLDL
FT                   NRTTSEAKNWFLGESLIELQKNWEIRGSRLLILNGDPIELISKLAELVHAECIYWNENI
FT                   EPYEINRDKQIAEKLSKEKRKVYTFLDQLIVNPSNIKTNNDEPYKVYGPFYRKWIDLIN
FT                   ITKSSENNLIQTSETAKQLTGLNERELSSIKNSDLNYCITNKSKSIYELLSLNRFNKTN
FT                   LCPCKPGESESIKQLNSFIHSGVINSYNKARDIPSLENTSHLSAALSLGTISCRVVWNG
FT                   AQVSKNATDDEYKINSIDTWIKELAWREFYQNALINFPELEKGPYREKWLDFPWQNRPD
FT                   WFEAWGDGLTGIPIIDAAMRQLKCSGWMHNRCRMIVASFLVKDLLIDWRLGELFFMKSL
FT                   VDGDLAANNGGWQWSASSGMDPKPMRIFNPFRQASKFDEDGEYIRKWIPELSHISTPNL
FT                   LSGEISSAERNSYPKPIISHKNQTSIFKELYSNIK"
FT   gene            complement(321365..321925)
FT                   /locus_tag="PMN2A_1652"
FT   CDS_pept        complement(321365..321925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1652"
FT                   /product="NUDIX hydrolase"
FT                   /note="Alternative locus ID: NATL2_03461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1652"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59140"
FT                   /db_xref="GOA:Q46H88"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H88"
FT                   /protein_id="AAZ59140.1"
FT                   /translation="MSIPGPEPSKIIETKACLDAKKIRFEINKFLLPNSMEGEFGIIRH
FT                   PGAALAVPITDSGEVVILRQYRFACSRRILEFPAGTLELGESPLESIKREVQEESGYSA
FT                   KRWDKLGEMLPCPGYSDETIHIFLARDLTKLEKKPEGDADEDIEVLKISPRKLNEIIAS
FT                   GEESLDGKTITAWFRACQLLNIR"
FT   gene            complement(321994..322575)
FT                   /locus_tag="PMN2A_1653"
FT   CDS_pept        complement(321994..322575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1653"
FT                   /product="7,
FT                   8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /note="Alternative locus ID: NATL2_03471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1653"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59141"
FT                   /db_xref="GOA:Q46H87"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H87"
FT                   /protein_id="AAZ59141.1"
FT                   /translation="MTYAKQKPELKLVISIGANIPGILGDPIRTIAAMRPHIEKSIIEW
FT                   NIALNHPKIDSQNFDKSLSFQWAPLFETDPLGGPIDQPKFINTVLVVEGEGFASVTPNE
FT                   KAAKCLMKKFLELEKIAGRERENIEIIWGPRSLDIDFISWGGLQINTDTLILPHPRFSE
FT                   RNFVLIPLAEVLSKTQGKTKRISSQNIWPE"
FT   gene            322622..324775
FT                   /locus_tag="PMN2A_1654"
FT   CDS_pept        322622..324775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1654"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="Alternative locus ID: NATL2_03481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1654"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59142"
FT                   /db_xref="GOA:Q46H86"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H86"
FT                   /protein_id="AAZ59142.1"
FT                   /translation="MVSSGLNNNNMSSTSKDIAVKDRANLAFPLAAITGHGTLKLALML
FT                   AAVDPGLGGVIIAGGRGTGKSVLARGLHALLPPIEIIDLDELANTEDGDDSFIYPAGRN
FT                   LDPSFSGEWDDLTKKLFTKKIGSYENTDDLENIPTKVVSAPFIQVPLGVTEDRLVGAVD
FT                   VAASLSSGTPVFQPGLLAEAHRGVLYIDELNLLDDGIVNLLLASVGAGENRVEREGLSL
FT                   SHPCRPLLIATYNPEEGGLRDHLLDRFAIVLSADQLITNEQRVEITQSAISHGQSSEAF
FT                   SKKWSEDTESLSTQLLLARQWLPDVQISEDQIEYLVVEAIRGGVEGHRSELYSVRVAKA
FT                   HAALCGRDSVDAEDLKAAVRLVIAPRAMQMPSEEEMEPPAPEDQQPPPPPPEDSDDNND
FT                   QEEDQEEDQEEEQDEESSPPIPEEFMLDPEACAVDPDLLLFSSTKSKSGNSGSRSAVLS
FT                   DNRGRYVKPIIPRGPVRRIAVDATLRAAAPYQKARREREPNRKVIVEEGDLRAKLLQRK
FT                   AGALVIFLVDASGSMALNRMQSAKGAVIRLLTEAYENRDEVSLIPFRGDQAEVLLPPTR
FT                   SITAAKRRLEAMPCGGGSPLAHGLTQAARVGANALATGDLGQVVVVAITDGRGNVPLST
FT                   SLGQPILEGETPPDLKQEVLDVASRYRALGIKLLVIDTERKFIASGMGKDLADASGGKY
FT                   VQLPKASDKAIASIAMDAINSVT"
FT   gene            complement(324785..325630)
FT                   /locus_tag="PMN2A_1655"
FT   CDS_pept        complement(324785..325630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1655"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents periplasmic component"
FT                   /note="Alternative locus ID: NATL2_03491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1655"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59143"
FT                   /db_xref="GOA:Q46H85"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H85"
FT                   /protein_id="AAZ59143.1"
FT                   /translation="MRRSLRDAFVGFSLLGGLVIFSGAMLWLRDFRLGSKTWEISASFK
FT                   DASGLAKMSPVTYRGIIVGSVQNISFTPNTVETKIKINNDNLILPKPVIAKIVTSSMLG
FT                   GDAQLSLISLGKSLNKNELITVNKDCPQKRILCSGDKIKGVEMVSISSLTEGINGIIDE
FT                   ADKQAIVNKVSESIQQFDRTQANLDELVLLSKSELIRAKPIISELTKASFHLNNILESL
FT                   DNPETLKDIQELASTSSSLTKKIDQMSSDMGNIMEDKELINALKKVTIGLSKLFDDIYP
FT                   "
FT   sig_peptide     complement(325550..325630)
FT                   /locus_tag="PMN2A_1655"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.652) with cleavage site probability 0.485 at
FT                   residue 27"
FT   gene            complement(325635..326420)
FT                   /locus_tag="PMN2A_1656"
FT   CDS_pept        complement(325635..326420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1656"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_03501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1656"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59144"
FT                   /db_xref="GOA:Q46H84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H84"
FT                   /protein_id="AAZ59144.1"
FT                   /translation="MPKNTQVMLMKDLSVELGSNKVLDSVNLAMMAGERLAIVGPSGSG
FT                   KSTILRLLAGLLLPSEGSLKISGIDQNYLRLDQNSPPDVRLVFQNPALLASLTVKENVG
FT                   FLLEKQKVLPEEIINKKVINCLQKVGLYDVADKFPNQLSGGMQKRVSFARALISDSKKG
FT                   KGSIPLLLYDEPTAGLDPIACTRIEDLIIKTTEAAEGCSIVVSHVSSTIERTANRVLLL
FT                   YGGKFQWDGSIDQFKQSENAYVKQFRTGNLQGPMQPEDS"
FT   gene            326548..327945
FT                   /locus_tag="PMN2A_1657"
FT   CDS_pept        326548..327945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1657"
FT                   /product="Conserved hypothetical protein CofD related
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_03511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1657"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59145"
FT                   /db_xref="GOA:Q46H83"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H83"
FT                   /protein_id="AAZ59145.1"
FT                   /translation="MNKRRKRKLRRATLRKSLLASLSFHLYSRFKRAIRWLLPGLVVKR
FT                   WMMTSGLGLLIALIGASIWADLRPIYWVVEILFWFLGFITTFLPRTISGPIVFLIGISL
FT                   LIWGQGRSFESIRQALGPKKDTFLVDALRAKQKLNRGPNIVAIGGGTGLSSLLKGLKRY
FT                   SSRITAIVTVADDGGSSGVLRRELGVQPPGDIRNCLAALATEEPLIKGLFQYRFPSGSG
FT                   LEGHSFGNLFLSALTAITGSLETAITASSRVLAVQGQVVPATNVDVRLWAELENGDRID
FT                   GESAIGKAPLPIVRIGCYPSRPPALPRALEAIRNAEIILIGPGSLYTSILPNLLVPEIV
FT                   EAIEKSKAPKLYVCNLMTQPGETDGLDVTGHVRAIEAQLASRGISRKIFSSILAQDELK
FT                   PSPLVDYYKSKGAEPVKCNKIDLLSRGYNVYLASLQGSKVTPTLRHDPRSLALAIMRFY
FT                   RRYKKGK"
FT   sig_peptide     326548..326733
FT                   /locus_tag="PMN2A_1657"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.453 at
FT                   residue 62"
FT   gene            complement(327947..328468)
FT                   /locus_tag="PMN2A_1658"
FT   CDS_pept        complement(327947..328468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1658"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_03521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1658"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59146"
FT                   /db_xref="GOA:Q46H82"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H82"
FT                   /protein_id="AAZ59146.1"
FT                   /translation="MTNDSEIVVEEKISGPISDWLSNNGFENIPLKEDHLGIEVIKISP
FT                   NNLLTIVEALKNDGFNYLQCQGGYDEGPGLNIVCFYNLIEMNELKEDISPREVRLKVFL
FT                   DRNGDLTVPSLYSLFRGADWQERETFDMYGVNFQGHPHPKRLLMPEDWKGWPLRKDYVQ
FT                   PDFYEMQDAY"
FT   gene            complement(328486..329235)
FT                   /locus_tag="PMN2A_1659"
FT   CDS_pept        complement(328486..329235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1659"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_03531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1659"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59147"
FT                   /db_xref="GOA:Q46M05"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46M05"
FT                   /protein_id="AAZ59147.1"
FT                   /translation="MELNPLKKSPSSEAVRNLREASCGPVGTPTVTNDLSENIILTSLE
FT                   DLHNWARLSSLWPLLYGTACCFIEFAALIGSRFDFDRFGLVPRSSPRQADLLIVAGTVT
FT                   MKMAPALVRLYEQMPDPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPP
FT                   RPEAIFDAVIKLRKKVANESISERSKITQTHRYLTIPHKMKRVESKVNGQYLKAKTQLI
FT                   ALNPSLSEEFDQSLKEVQKISEELSSN"
FT   gene            complement(329226..329588)
FT                   /locus_tag="PMN2A_1660"
FT   CDS_pept        complement(329226..329588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1660"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_03541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1660"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59148"
FT                   /db_xref="GOA:Q46M04"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46M04"
FT                   /protein_id="AAZ59148.1"
FT                   /translation="MFSLQGYEYFLGFLLISGAVPILALTTNKLIAPKSKAGERQLTYE
FT                   SGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALVFITIL
FT                   VVALAYAWRKGALEWS"
FT   gene            329673..330098
FT                   /locus_tag="PMN2A_1661"
FT   CDS_pept        329673..330098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1661"
FT                   /product="rubredoxin"
FT                   /note="Alternative locus ID: NATL2_03551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1661"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59149"
FT                   /db_xref="GOA:Q46M03"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q46M03"
FT                   /protein_id="AAZ59149.1"
FT                   /translation="MSEDKKTESNPLGDLNLDAQQNQVISFEPKNSNEEFDPKGNRFEC
FT                   MSCGFIYDPDEGIKKLNIEPGTAFLDIDREKFRCPVCRVGFGGYKDIGPKSKPSGFEEN
FT                   LTYGFGFNKLPSGQKNVLIFGSLALAAACFLSLYSLK"
FT   gene            330095..331111
FT                   /locus_tag="PMN2A_1662"
FT   CDS_pept        330095..331111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1662"
FT                   /product="photosystem II stability/assembly factor"
FT                   /note="Alternative locus ID: NATL2_03561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1662"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59150"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46M02"
FT                   /protein_id="AAZ59150.1"
FT                   /translation="MKRLFSNVINLTLVLIVGVALSGCTVSNASIGSSSPWSLVDLDTE
FT                   ANPLDVDFVDDKNGFLVGTNRLILETNDGGITWKERNLDIPSEGNFRLISVDFKGQEGW
FT                   IAGQPGLILHTTDGGKNWTRLDLGNKLPGDPYLITTIDTDIAELATTAGAIYKTTDAGT
FT                   NWEAIVVDTSGSGGIRELRRTNNGGYISVSSLGNFFSVLRPGEEIWSPHQRASSKRVQS
FT                   VGEQPNGDLWMLSRGAEIRFNADPDDIDSWSKPIIPIVNGYNYQDLVWDPSKSIWAAGG
FT                   NGTLLVSNDEGKTWEKDPVGESVPTNFIRILFLDDLNSESPKGFVFGERGNLLRWQG"
FT   sig_peptide     330095..330184
FT                   /locus_tag="PMN2A_1662"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 30"
FT   gene            331219..331467
FT                   /locus_tag="PMN2A_1663"
FT   CDS_pept        331219..331467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1663"
FT                   /product="cytochrome b559, alpha subunit"
FT                   /note="Alternative locus ID: NATL2_03571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1663"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59151"
FT                   /db_xref="GOA:Q46H81"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H81"
FT                   /protein_id="AAZ59151.1"
FT                   /translation="MAAGSTGERPFFEIITSVRYWIIHAVALPAIFVAGFLFVSSGLAY
FT                   DAFGTPRPDTYFQAGESKAPVVVQRFDSKAELDTRLK"
FT   gene            331497..331616
FT                   /locus_tag="PMN2A_1664"
FT   CDS_pept        331497..331616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1664"
FT                   /product="photosystem II protein L PsbL"
FT                   /note="Alternative locus ID: NATL2_03581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1664"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59152"
FT                   /db_xref="GOA:Q46H80"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H80"
FT                   /protein_id="AAZ59152.1"
FT                   /translation="MQVNPNPNKVPVELNRTSLYLGLLLVFVMGILFSSYFFN"
FT   gene            331628..331825
FT                   /locus_tag="PMN2A_1665"
FT   CDS_pept        331628..331825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1665"
FT                   /product="photosystem II protein J PsbJ"
FT                   /note="Alternative locus ID: NATL2_03591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1665"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59153"
FT                   /db_xref="GOA:Q46H79"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H79"
FT                   /protein_id="AAZ59153.1"
FT                   /translation="MSKLKGPDGRAGDRLPNGMPAVSWERRWTEGALPLWLVATAGGTA
FT                   VIFVLGIFFYGSYTGIGNAG"
FT   gene            complement(331897..332808)
FT                   /locus_tag="PMN2A_1666"
FT   CDS_pept        complement(331897..332808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1666"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="Alternative locus ID: NATL2_03601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1666"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59154"
FT                   /db_xref="GOA:Q46H78"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H78"
FT                   /protein_id="AAZ59154.1"
FT                   /translation="MNISGTQSDAYDFKQARLGIIGGSGLYRIENLKDIVELSLDTPYG
FT                   KPSNKLLIGNLFGIEIVFLARHGEKHTLNPSEIPYKANIWAMRSLNVRWLISASAVGSL
FT                   KENIKPCDIVIPDQFIDRTHQRPLTFFNNGVVAHISMANPFCDILSQILSKEIEKLLTK
FT                   DKKMHIGGTYLAMEGPAFSTRAESNLYRDWGCSIIGMTNHTEARLAKEAEIAYSSLSMV
FT                   TDYDCWNQNCENVSVEMVIENLQENANFAKSIISAVAKRVSSLRPPSSFHSALKDALVT
FT                   PEEHVPEKTKSKIKLFTDKYWH"
FT   gene            332815..334995
FT                   /locus_tag="PMN2A_1667"
FT   CDS_pept        332815..334995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1667"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="Alternative locus ID: NATL2_03611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1667"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59155"
FT                   /db_xref="GOA:Q46H77"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H77"
FT                   /protein_id="AAZ59155.1"
FT                   /translation="MFSDHLVLAGGGHTHALVLLQWAMNPKLKPAGMITLVNKASTTVY
FT                   SGMFPGVIAGKYKIDEILIDLRKLALKAGVSFVMAEIEGINLKEKKLLLEGRPEIEYSL
FT                   LSLNIGTKTNINSKLFNRGDKDLAVPIKPFSESYKFIVDQDIHKNDSSAKPFVIIGGGF
FT                   AGIEIAFSLRKRWPKRPILLKVKSGRNINKNLLRNLKALDIEITQKQPSILYPKLICTG
FT                   NKSFNWLKDSGLPIDENGRVLTKKTLQVLNYPELFAVGDCGVIKDYPRPSSGVWAVRAA
FT                   KSLANNLEFITKGLKLEEWKPQRKAIQLLDINIRKKKSKAFISWGEVIIGPFDFLSSLK
FT                   ELIDKQFISKFDLVKDINSDMSSEEDMIKCRGCAAKLAFTPLSSALKKVDLIESSKDDS
FT                   INIGILNSDKTLIQSVDGFPSLISDPWLNGRLLAFHSCSDIWACGGSVISAQSLINLPS
FT                   ISNNLQQELLYQVLEGINSALTIQGANLIGGHTLESRKISEEPFSLGIESSLTVNGVID
FT                   DKKYFWPKGGMRNGDEILISRSLGTGIIFSAFMNGQVKPYILDNVLKEMNKSQHEIVNY
FT                   INQLTNLNPRSKIVNACTDITGFGLLGHLSEMLESTNSDQLKMNSEPFKVNLELDKIPL
FT                   YDGVKELLDKGFESTLAPANQIFLKNIDGDKNLRFELTSNDSCSNRSFYNAMLKILVDP
FT                   QTCGPLVVCCSSIYSEKLIQQGPWIKIGFISK"
FT   gene            complement(335011..336267)
FT                   /locus_tag="PMN2A_1668"
FT   CDS_pept        complement(335011..336267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1668"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /note="Alternative locus ID: NATL2_03621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1668"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59156"
FT                   /db_xref="GOA:Q46H76"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H76"
FT                   /protein_id="AAZ59156.1"
FT                   /translation="MELFDKSTIEKEIKELPRGILTIILEAACSVNITSIAIVGGVVRD
FT                   LIKKSKNQNYEIIFNDLDLIIEGETSTYIKELQKVLGAERVKVIRDNRNYKTSEVIING
FT                   IKVDIASARKETYPIPGENPIVELSTIKKDLIRRDFNINAMAIELKDNRLIDLFSGSDA
FT                   IENMKMDFLHKSSVLDDPTRVIRASRYSAKLDFDLSNQALKQIKDTINLWPWNWHIGDN
FT                   TDLAPSALSIRLKMELELLLEDKYWKNALKNLQVCGGLKIVDSKLQNDKRLIEKIFIAK
FT                   KSNIEPLTAFVYESKSPIYLANRLHLNQQQKEIIEGACRLNKYLKNITANHLYKNWSPS
FT                   KWTINLEKINANESSFMLEICRNNPLKEYLKSWLFNWKNIESPIKGDDLIAKGWEPGPE
FT                   IGIEIKRQRMKLIDENIAF"
FT   gene            complement(336311..338728)
FT                   /locus_tag="PMN2A_1669"
FT   CDS_pept        complement(336311..338728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1669"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /note="Alternative locus ID: NATL2_03631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1669"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59157"
FT                   /db_xref="GOA:Q46H75"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H75"
FT                   /protein_id="AAZ59157.1"
FT                   /translation="MKQSNSIFLNGLNEAQSHAVDHFHGPLLVVAGAGSGKTRALTHRI
FT                   AHLITEYKVDPSSILAVTFTNKAAREMKDRLELLLAKRLSSLTHGKPWTALQVAEQREI
FT                   RNRIHREISRELWIGTFHALFSRLLRFDIDKFKDPEGLTWTKQFSIYDETDAQSLIKEI
FT                   VTQDLQLDPKRFEPKKVRWAISNAKNQCLLPDDLSNNQEGQRGKLVAETYRLYRKALAA
FT                   NNALDFDDLLLIPVQLLQQNEKIRTYWHSRFKHVLVDEYQDTNWTQYELIKQLVTNGKD
FT                   PSSFQDWNNRSVFVVGDADQSIYSFRAADFRILMGFQEDFGKKSLDNKYDSTLVKLEEN
FT                   YRSTSTILEAANSLISNNKERIDKVLRATRGEGEPIRLTRCDDEIAEAEAVIHRLRILD
FT                   ASNPELNWGDMAILYRTNAQSRAIEDSLVRWSIPYIVVGGLRFYDRREIKDLLAYLRLL
FT                   INPSDSVSLLRVLNVPKRGIGKTTVQRLSDAASQLKIPLWEVVNDPEAVRSLAGRSAKG
FT                   LLIFSELINELQSHLLSSSPAELVQLVLEKSGYLSELIATGTDEAEERRRNLQELVNAA
FT                   LQYQEESEDANLEGFLSTAALSSDADNKDTASNRVTLMTLHSSKGLEFPVVCLVGMEQG
FT                   LFPSYRSLDDPSSLEEERRLCYVGLTRAKEKLFLFHASERRMWGGMREPAIASIFLSEI
FT                   PEELVKGDIPLSGGATLRREKNLDRLTRIDRQSNKKSFPSEAENAVRKTYSGPSPGKRW
FT                   SVNDRVEHSSFGEGIITHVFGSGEKISLAIKFSGMGPKILDPRLAPLKLIDE"
FT   gene            complement(338817..339041)
FT                   /locus_tag="PMN2A_1670"
FT   CDS_pept        complement(338817..339041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1670"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1670"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59158"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H74"
FT                   /protein_id="AAZ59158.1"
FT                   /translation="MKSPTEEELEESIKELSEYKNRLEKEVVTISQKLKMPQRKIESII
FT                   NSHQELNKIKIILSKLYKQKENATSNLLL"
FT   gene            339285..339833
FT                   /locus_tag="PMN2A_1671"
FT   CDS_pept        339285..339833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1671"
FT                   /product="phycoerythrin class III beta chain CpeB"
FT                   /note="Alternative locus ID: NATL2_03651"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1671"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59159"
FT                   /db_xref="GOA:Q46H73"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H73"
FT                   /protein_id="AAZ59159.1"
FT                   /translation="MLDAFSRTVVSADAKGAAIGSEDLADLRKYVADANKRIDATLAIT
FT                   QNVSCIAADAVAGMVCENTGLTQPGGHCYPTRRMAACLRDGEIILRYVSYALLAGDPSV
FT                   LEDRCLNGLKETYLALGVPTSNAIRAVEIMKIATVAIMTETNTGRKMFKGINSGSGAQC
FT                   QDIASEAASYFDLVIEALR"
FT   gene            339890..340357
FT                   /locus_tag="PMN2A_1672"
FT   CDS_pept        339890..340357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1672"
FT                   /product="phycoerythrin class III alpha chain CpeA"
FT                   /note="Alternative locus ID: NATL2_03661"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1672"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59160"
FT                   /db_xref="GOA:Q46H72"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H72"
FT                   /protein_id="AAZ59160.1"
FT                   /translation="MKSAVTTVVSAADAAGRFPSMSDFESVKGSFDRAKARLEAAEKLA
FT                   SCLDKFTNLAVDAVYQNGSYEQANKDKCVRDIHHYLRLINYCLVTGGTGPLDEWGISGM
FT                   REIIRIQLLPTAAYIEAFIFIRDEIKINDVMGQQAETEFKGLLDYLINALA"
FT   gene            340428..341024
FT                   /locus_tag="PMN2A_1673"
FT   CDS_pept        340428..341024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1673"
FT                   /product="putative bilin biosynthesis protein cpeZ"
FT                   /note="Alternative locus ID: NATL2_03671"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1673"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59161"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H71"
FT                   /protein_id="AAZ59161.1"
FT                   /translation="MINSLDLNKYIELYQDFLHPNPNINSQAFLILKKEFEVKFMNNLL
FT                   ANLKEEDLFIRRKSILALGRFGEKALKSIVQLYMDTNNKTVKVSCLKTIIKVVVNFNLE
FT                   ELTQDEMLVVDLALKDSSPEMILTVISLLRQLGRTGRNILMKTCRDKDLLRAKASISAL
FT                   LEMKDHTIDDLFEDLLNDKSIDQMIKEDILRDKII"
FT   gene            complement(341050..341913)
FT                   /locus_tag="PMN2A_1674"
FT   CDS_pept        complement(341050..341913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1674"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /note="Alternative locus ID: NATL2_03681"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1674"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59162"
FT                   /db_xref="GOA:Q46H70"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H70"
FT                   /protein_id="AAZ59162.1"
FT                   /translation="MDNYLNSEITTEEESEKAEGDKQNIVSKKKSSQKDIKLLIKGLSD
FT                   ENGLVRRNYAIALAEVGSAALPELIKALLNSKNVIQRRAAAKTLKLVNDPSALPHLIKA
FT                   LTSDSDSVVQFSAAGAIAIFGEAAVNHLIIVLENQEYTEMQYGLAAWCLEFIGAKASNA
FT                   IKKAAKSKNTNVKSAAISALEEHIRQSQDQEAIQIVERAINDTAENVQIEAIKLVGKLY
FT                   RIESLIPTLILKLKHKNPDIRKSSILSLIQLNINEAINPLRDLLKIEQDKNVIAIIKLA
FT                   IKKINN"
FT   gene            342080..343384
FT                   /locus_tag="PMN2A_1675"
FT   CDS_pept        342080..343384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1675"
FT                   /product="possible bilin biosynthesis protein CpeY"
FT                   /note="Alternative locus ID: NATL2_03691"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1675"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59163"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H69"
FT                   /protein_id="AAZ59163.1"
FT                   /translation="MQSNPFNNLPKINKIDAINILRRPISEVKLLADYYKAVFHLANFP
FT                   CEESEVALLDFIKHDCEKLEYKIAKRKAIEVLANFGCKKAIQTIAEFLENDDDYLVETV
FT                   IWSLAKLKCNDIDIINKICSKLYKQFNNKRVVIQTLTHLGVRKEIDMIRSLSRDKQTSN
FT                   GVKGASFAALIKLAGEEDKLTDLKKFLRLSNQNDRHCAVQDIINAGHLSVLPDLIKAPL
FT                   SPSFKLQAIDSLWINEVVLCENINLLNCIDSVVFDDPRNIDTLEVNNFNKDLSFLIEQL
FT                   FHTDFNRCYHSIKELLKFPLDKVLYYLNNNWDRAKSDYGAIYFFINVYKLLLDQQLYDD
FT                   LLLDKVGFLLSNNWPDYMKFKSSAIQILGCLNENKFYNNMIYFSDESHTPYWKNRYTAL
FT                   LVLQNKQINIKNKFAKLFLNDSHRFVRFKAKEIST"
FT   gene            complement(343418..344017)
FT                   /locus_tag="PMN2A_1676"
FT   CDS_pept        complement(343418..344017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1676"
FT                   /product="CpeT protein-like protein"
FT                   /note="Alternative locus ID: NATL2_03701"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1676"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59164"
FT                   /db_xref="GOA:Q46H68"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H68"
FT                   /protein_id="AAZ59164.1"
FT                   /translation="MKKNPTIEFAKIVSGVFSNKEQALNNPKKFAHIQIHIRPLFFKTY
FT                   NCFAFYSEQRYQHDIWNPYRQSINKLSQKEEIFIFSNYKIEDKERFTGGALDISLLDNI
FT                   SKYKLYKKPGCSMYFKEKKPGNFLGTIESGCKCYIEYGSDKTYVKSKVTVNKNILISED
FT                   SGYAIETDKKVWGSEFGPLIFKKIVNFDCFINEYWK"
FT   gene            complement(344032..344565)
FT                   /locus_tag="PMN2A_1677"
FT   CDS_pept        complement(344032..344565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1677"
FT                   /product="CpeS-like protein"
FT                   /note="Alternative locus ID: NATL2_03711"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1677"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59165"
FT                   /db_xref="GOA:Q46H67"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H67"
FT                   /protein_id="AAZ59165.1"
FT                   /translation="MNIKEFFLKSVGEWNSMRSGHSLAFQEFEEIRSKIKISPSKPNDA
FT                   RVIKFLKDNLITTKAVNRAFLISWEAKSEWGEENQNGNSSGESILVPIEVSKTEGKIVR
FT                   SVGYTEAIQVVSLYKILVDGTLIIYSEYSHISTEERIWFISNNLRSRSSVTRSLDSLAI
FT                   LQTSYASEIRSLKN"
FT   gene            complement(344605..345396)
FT                   /locus_tag="PMN2A_1678"
FT   CDS_pept        complement(344605..345396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1678"
FT                   /product="phycoerythrin class III gamma chain"
FT                   /note="Alternative locus ID: NATL2_03721"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1678"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59166"
FT                   /db_xref="GOA:Q46H66"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H66"
FT                   /protein_id="AAZ59166.1"
FT                   /translation="MSSIPFKALKIGAEAINKDPVKFNKSRVSGSKKTMYGLHIRGASM
FT                   PGEKEKFTVTSKTKPKQLENLIHNNVMSSYRRDKIESYKYKILNKESAGINMLQINEFV
FT                   PNDDDALLVAINALYKHIFGNLSLMQSERPIDIERKLRNGDLTVREFTRKICKSTIYRN
FT                   FYFDGISQYKSIKLIYKHILGRPIKSKGEVTQSSNIINNLGFEEHIDFLIDSNEYNNIF
FT                   GEDIVPYMRSWNSPTGFKTKSFLETSYLTKAFATSDICKII"
FT   gene            complement(345501..346160)
FT                   /locus_tag="PMN2A_1679"
FT   CDS_pept        complement(345501..346160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1679"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03731"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1679"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59167"
FT                   /db_xref="GOA:Q46H65"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H65"
FT                   /protein_id="AAZ59167.1"
FT                   /translation="MKKEKLQKYLTIAFFVGAFILLVFLIQTYGIEPLRSAVKEMGIWA
FT                   PLGILILRGISVILPALPSSVYSLLAGSLLGFKTGYLTIFISDLIFCQIAFFIARNFGR
FT                   APVRKLVGIKAMKRIESFNQNQLEGNFFLMTGLLMTGLFDFLSYALGIGGTRWRLFTPA
FT                   LIISLLISDSIIVAVGAGVSQGAGLMLGGALLGMFALATITGFNKNKVSETQKKSQ"
FT   sig_peptide     complement(346068..346160)
FT                   /locus_tag="PMN2A_1679"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.708) with cleavage site probability 0.512 at
FT                   residue 31"
FT   gene            346330..347286
FT                   /locus_tag="PMN2A_1680"
FT   CDS_pept        346330..347286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1680"
FT                   /product="putative nucleoside-diphosphate sugar epimerase"
FT                   /note="Alternative locus ID: NATL2_03741"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1680"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59168"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H64"
FT                   /protein_id="AAZ59168.1"
FT                   /translation="MPSSPVKNLVTGGAGFVGSHLIDRLMKSGEKVICLDNFFTGSKEN
FT                   IEHWIGHPSFELIDHDVIEPIKLDVDRIWHLACPASPIHYQFNPIKTAKTSFLGTYNML
FT                   GLARKVGARILLASTSEVYGNPEIHPQPEKYNGNVNPVGIRSCYDEGKRVAESLCYDYM
FT                   RMHGLEIRIARIFNTYGPRMLLNDGRLISNLLVQSIHGNDLTIYGNGKQTRSFCFVDDL
FT                   IDGLTLFMNSLNVGPMNLGNPEELSILQITNLIRNISIEKVNLKFLKALDDDPLRRKPD
FT                   IYLAKKELNWEPKIMFKEGLAITREYFEKKLIFEKSK"
FT   gene            347376..348422
FT                   /locus_tag="PMN2A_1681"
FT   CDS_pept        347376..348422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1681"
FT                   /product="putative nucleotide sugar epimerase"
FT                   /note="Alternative locus ID: NATL2_03751"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1681"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59169"
FT                   /db_xref="GOA:Q46H63"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H63"
FT                   /protein_id="AAZ59169.1"
FT                   /translation="MNSKASNETILVTGAAGFIGAALVKALLNLNFKVIGIDNLNDYYS
FT                   TSLKRSRLTEIEKVSTVNGEWFFYEIPIEDNKVLQDIINRYNPQVFVHLAAQAGVRYSI
FT                   TNPAAYIQSNLVGFANVLEGCRQNQIPHLIYASSSSVYGGNKNLPFYEEQAVNHPVSLY
FT                   AATKKSNELMAHTYSHLYDLPTTGLRFFTVYGPWGRPDMAPMIFARSILNNEPIQVFNY
FT                   GKMQRDFTYIDDVVEGIIRCCFKKASIDDDFNPLVPNPSTSSAPYRIFNIGNSRPTQLT
FT                   YFIELLEKNLGKKAIKNFQPMQPGDVVSTAARMDLLNSWVDYKPITSIENGIKLFSEWY
FT                   LDYFKNTF"
FT   sig_peptide     347376..347450
FT                   /locus_tag="PMN2A_1681"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.732) with cleavage site probability 0.552 at
FT                   residue 25"
FT   gene            complement(348456..348686)
FT                   /locus_tag="PMN2A_1682"
FT   CDS_pept        complement(348456..348686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1682"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03761"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1682"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59170"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H62"
FT                   /protein_id="AAZ59170.1"
FT                   /translation="MNLETSSENLYNNADSFAMAFDAAWKDCDLGNNKDIKIDEKIEIA
FT                   FEKIKNHPFLISNPIQSKNVARFRIKLLGLA"
FT   gene            complement(349103..349270)
FT                   /locus_tag="PMN2A_1919"
FT   CDS_pept        complement(349103..349270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1919"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03771"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1919"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23857"
FT                   /db_xref="GOA:A7MDB9"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDB9"
FT                   /protein_id="ABU23857.1"
FT                   /translation="MMNLLIGVQSTFDLSKVDFSSGLGINSPDLAGISFLMVIFAGVLA
FT                   LRLGTTLRDS"
FT   gene            350084..351172
FT                   /locus_tag="PMN2A_1683"
FT   CDS_pept        350084..351172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1683"
FT                   /product="TPR repeat"
FT                   /note="Alternative locus ID: NATL2_03781"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1683"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59171"
FT                   /db_xref="GOA:Q46H61"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H61"
FT                   /protein_id="AAZ59171.1"
FT                   /translation="MDSSSQEREGKKKIIEIKTFAVPFALGEKQENLTIKTNTPSKPSK
FT                   EQIINQAIQFHLKGNIQEAAKYYQLFVEQGFKDHIVFSNYGVVLKNLAQTQDAELSYRK
FT                   AIEIKPDYADAHYNLGNLLKELGKLQDAELSYRKAIEIKPDYADAHYNLGIILNDLGKS
FT                   QEAELSYRKAIKIKPDYAEAHYNLGIILNDLGKSDQAELSYRRAIEIKSDYADAHYNLG
FT                   NLLNDLGKSQEAELSYRKAIKIKPDYAEAHYNLGIILNDLGKSDQAELSYRRAIEIKSD
FT                   YADAHLNLGNILRDLGELQDAELSTRKAIEIKPDNTDAHLNLGNILRDLGKLKDARLCS
FT                   EKIMSLRSWSLAGSYSFNYEMI"
FT   gene            complement(351153..352148)
FT                   /locus_tag="PMN2A_1684"
FT   CDS_pept        complement(351153..352148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1684"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03791"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1684"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59172"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H60"
FT                   /protein_id="AAZ59172.1"
FT                   /translation="MDDNWNFLLSEFRRLGGVADNVFQKEGEYGRGIFSVNPSLRARIF
FT                   TPSKLMIKKDDIYLEDNKLRIKKDKEYNQEIRNFFNFYQDNFSWGSGGKETTELFERGL
FT                   SLFNSNLKELIKKYALVDIDERHKGTWNNVIKKQFLNARVFKFKNSSVVVPIVELVNHK
FT                   VRSFPFITNKDGISTPNYPAVNGELRHSYSRISPLSRFFYQGFFSEESIIFSIPLSINI
FT                   EDLGIHIVCKGMSINDDSMKIERSGKKIILEGLPIADVNHPRLPYEYFDEILRKIDHIN
FT                   IPQDFLLKIFQLNISIRNKVINESKLIDNEVSKILTKLMHYEINLISSHN"
FT   gene            complement(352470..352545)
FT                   /locus_tag="PMN2A_R0034"
FT   tRNA            complement(352470..352545)
FT                   /locus_tag="PMN2A_R0034"
FT                   /product="tRNA-Phe"
FT   gene            complement(352690..352959)
FT                   /locus_tag="PMN2A_1685"
FT   CDS_pept        complement(352690..352959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1685"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03801"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1685"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59173"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H59"
FT                   /protein_id="AAZ59173.1"
FT                   /translation="MNSEPITQESSTRICNHMNKDHEDAVNAYAKYYGKIKTFKSAKMI
FT                   SLSPEAVQLKIDDETLEIKFDHILQDCSDAHKTLVRMIKAIPKL"
FT   gene            complement(353057..354292)
FT                   /locus_tag="PMN2A_1686"
FT   CDS_pept        complement(353057..354292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1686"
FT                   /product="sugar kinase"
FT                   /note="Alternative locus ID: NATL2_03811"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1686"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59174"
FT                   /db_xref="GOA:Q46H58"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H58"
FT                   /protein_id="AAZ59174.1"
FT                   /translation="MLNNSLVLGIDLGTSGVRIAIINVKKKILFTSSTKYSKGLEISGD
FT                   WINSLKTLIQQIPRDLKEKLVSCSVAGTSGTLLACNRDGVPLGKALPYFLPFSEYSYEI
FT                   RNLFTKECAGSSVSGSVGRALKLLALYGNEIILRHQADWISGWLINNWEYGEEGNNIRM
FT                   GWEISNSSWPENFQNLKWLKCLPKIIPSGQIMGNVCTKKADELSLPKNLKVIAGTTDSN
FT                   AGVLATFPNKNDGITILGSTIVIKKFVNNPLEGKGISNHKLLGNWLSGGASNTGASILL
FT                   DFFNLEYIAELSKQINPNKSSGLNLLPLSSQGERFPIDDPNLQPKLDPRPVSDSLYLHA
FT                   LFEGLAKIEARGWQKLNELGADLPRQIITIGGGAKNITWKKIREREIGIPIKICNTPPA
FT                   AGVASIALQGLL"
FT   gene            complement(354312..355541)
FT                   /locus_tag="PMN2A_1687"
FT   CDS_pept        complement(354312..355541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1687"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="Alternative locus ID: NATL2_03821"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1687"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59175"
FT                   /db_xref="GOA:Q46H57"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H57"
FT                   /protein_id="AAZ59175.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAV
FT                   VNTGLCLITGEITSKAEVDFNKLVREVIKNIGYRSASDGGFDANSCAVLVALDQQSSDI
FT                   AQGVNEAEDHSTDPLDQVGAGDQGIMFGFACDETPELMPLPISLAHRLARRLALVRHQQ
FT                   LIDYLLPDGKTQVSVSYENGVPCSIDTILISTQHKSEVDGITLEEEIQKRIAKDLWKFV
FT                   VEPATEDLPLKPAKGSTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISILVDSFGTGKVS
FT                   DSELTQLVQDQFDLRPGAIIKAFDLQNLPSIRGGRFYRDTAAYGHFGRTDILLPWEDVS
FT                   QKAKELSLLK"
FT   gene            complement(355565..356353)
FT                   /locus_tag="PMN2A_1688"
FT   CDS_pept        complement(355565..356353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1688"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family"
FT                   /note="Alternative locus ID: NATL2_03831"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1688"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59176"
FT                   /db_xref="GOA:Q46H56"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H56"
FT                   /protein_id="AAZ59176.1"
FT                   /translation="MAELLIKNSSVGFIKAVIFDKDGTLSNSEECLLELAKTRINFFED
FT                   KLKKLKLNNIKIWLLKKLLISVYGLKKNYLSANASLAIASREQNIISTATIFTLFGFDW
FT                   FQSLSIGKEIFDEVDIYLFNQKGNAQKHRNLISGALDLLVSLKKEGVSIALMTNDTQVG
FT                   IEEFICRNKLEGIFDYHWSAENKPSKPNPEAVIELCKKMNFNPSDCALISDADTDLRMA
FT                   KEAGITIVVGFNGGWQTPPVLTEKKFLIEKLNELKIHSSY"
FT   gene            complement(356372..357481)
FT                   /locus_tag="PMN2A_1689"
FT   CDS_pept        complement(356372..357481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1689"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="Alternative locus ID: NATL2_03841"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1689"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59177"
FT                   /db_xref="GOA:Q46H55"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H55"
FT                   /protein_id="AAZ59177.1"
FT                   /translation="MSENPASKIEEKNPEKETSIPEETVSNATIAEFEENSITELKEDD
FT                   IPKNIPAADDSSSRINKSDLETAGFTLDEFASLLSKYDYNFKPGDIVNGTVFALESKGA
FT                   MIDIGAKTAAFMPMQEVSINRVEGLSDVLQPSEIREFFIMTEENEDGQLSLSIRRIEYQ
FT                   RAWERVRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISTRKAKEELVADFLP
FT                   LKFLEVDEERNRLVLSHRRALVERKMNRLEVGEVVVGAVRGIKPYGAFIDIGGVSGLLH
FT                   ISEISHEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKALEPEPGDMLTDPQKVFD
FT                   KAEEMAARYKQMLLEQAEEGEDPIAVMTI"
FT   gene            complement(357585..358064)
FT                   /locus_tag="PMN2A_1690"
FT   CDS_pept        complement(357585..358064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1690"
FT                   /product="Protein of unknown function DUF193"
FT                   /note="Alternative locus ID: NATL2_03851"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1690"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59178"
FT                   /db_xref="GOA:Q46H54"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H54"
FT                   /protein_id="AAZ59178.1"
FT                   /translation="MQCPSCQNTDSRVLESRSADSGRSVRRRRECLNCDFRFTTYERVE
FT                   TTPINVLKRSGAKELFNRSKIINGLNRACEKTLIHGSKIEFIVDEIELELHQGVCKEIK
FT                   SIEIGEMVLTHLKDINEVAYIRFASVYRQFNGINDFMKTLEALKPIKKEQLASVI"
FT   gene            complement(358224..358319)
FT                   /locus_tag="PMN2A_1691"
FT   CDS_pept        complement(358224..358319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1691"
FT                   /product="photosystem II PsbT protein"
FT                   /note="Alternative locus ID: NATL2_03861"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1691"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59179"
FT                   /db_xref="GOA:Q46H53"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H53"
FT                   /protein_id="AAZ59179.1"
FT                   /translation="MEAFSYVLILTLALVTLFFAVAFRDPPKYDK"
FT   sig_peptide     complement(358251..358319)
FT                   /locus_tag="PMN2A_1691"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.855) with cleavage site probability 0.855 at
FT                   residue 23"
FT   gene            complement(358358..359881)
FT                   /locus_tag="PMN2A_1692"
FT   CDS_pept        complement(358358..359881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1692"
FT                   /product="photosystem II PsbB protein (CP47)"
FT                   /note="Alternative locus ID: NATL2_03871"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1692"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59180"
FT                   /db_xref="GOA:Q46H52"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H52"
FT                   /protein_id="AAZ59180.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGSMALYELAIF
FT                   DPSDPVLNPMWRQGMYVMPFMARLGITGSWNGWDITGATGVDPGFWSFEGVAAAHIVFS
FT                   GLLMLAAVWHWTYWDLELWEDSRTGEPALDLPRIFGIHLFLAGLTCFGFGAFHCSSVGI
FT                   WVSDPYGLTGHVEKVAPVWGAEGFNPFNAGGIVANHVGAGLLGIIGGIFHITNRPGERL
FT                   YRALKLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPVELFGPTRYQWDSGYFKTEI
FT                   NRRVQESMNDGASKAEAYASIPEQLAFYDYVGNSPAKGGLFRVGAMVNGDGVPSGWQGH
FT                   ISFTDSDGNDLEVRRIPNFFENFPVILEDKDGNVKADIPFRRAEAKYSIEQTGVTATVY
FT                   GGELNGQTFTDPVIVKRLARKSQLGEAFKFDRDRYKSDGVFRSSPRAWFTYAHLCFGLL
FT                   FLFGHWWHAARTLFGDRFSGIDPELGDQVEFGLFKKLGDESTRRVPGRA"
FT   gene            360031..360153
FT                   /locus_tag="PMN2A_1920"
FT   CDS_pept        360031..360153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1920"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_03881"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1920"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23858"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC0"
FT                   /protein_id="ABU23858.1"
FT                   /translation="MRIDSRRLEKIKKKRKRRIFRISIDFVILRRFLTKLILKN"
FT   gene            360362..360520
FT                   /locus_tag="PMN2A_1693"
FT   CDS_pept        360362..360520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1693"
FT                   /product="possible photosystem II reaction center M protein
FT                   (PsbM)"
FT                   /note="Alternative locus ID: NATL2_03891"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1693"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59181"
FT                   /db_xref="GOA:Q46H51"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H51"
FT                   /protein_id="AAZ59181.1"
FT                   /translation="METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGR
FT                   LSPEPKK"
FT   gene            360655..361095
FT                   /locus_tag="PMN2A_1694"
FT   CDS_pept        360655..361095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1694"
FT                   /product="thioesterase"
FT                   /note="Alternative locus ID: NATL2_03901"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1694"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59182"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H50"
FT                   /protein_id="AAZ59182.1"
FT                   /translation="MSSKNNRWILTKTVLPQHTDHAGVMWHGSYLNFLEEGRIDALDKI
FT                   GHSYTKLSEKGFEIPVVSIQLRYKISFIHGEKILLASQFKLENKIRLTCKTLFLKSNGD
FT                   IGAEAIIGLVVVRKTNESIKLVRELPVQIKNILLMLEEGPKL"
FT   gene            361162..361983
FT                   /locus_tag="PMN2A_1695"
FT   CDS_pept        361162..361983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1695"
FT                   /product="modification methylase HemK"
FT                   /note="Alternative locus ID: NATL2_03911"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1695"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59183"
FT                   /db_xref="GOA:Q46H49"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H49"
FT                   /protein_id="AAZ59183.1"
FT                   /translation="MILIGGRKVDFDWLLDMVAGVSWAKLQSIILNPEKFISLDISTDE
FT                   LEVIWKSHLKDQTPLQYLISKCPWRDVELEVSAEALIPRQETEFLIDIALKKIINFDSG
FT                   RWADLGTGSGAIAVSLAKSLPNWNGYATDISNEALELAKRNLKAIVPNANVRFSLGDWW
FT                   EPLKRWRGRFDLVLSNPPYIPSYLVEELEPVVKNHEPIIALDGGEDGMNASRKIILGAL
FT                   NGLAKGGWLILEHHYDQSEKITSFMKNIGMEEVSFEKDLSGIKRYAICRRK"
FT   gene            361985..362560
FT                   /locus_tag="PMN2A_1696"
FT   CDS_pept        361985..362560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1696"
FT                   /product="putative translation factor (SUA5)"
FT                   /note="Alternative locus ID: NATL2_03921"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1696"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59184"
FT                   /db_xref="GOA:Q46H48"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H48"
FT                   /protein_id="AAZ59184.1"
FT                   /translation="MITQQFGIFDLALKLKKGSLALFPTDTLPALCSYPKYSKKIWTIK
FT                   KRPSSKPLILMGGCSDDLFEFVHPCALEESLQLAKIYWPGALTMVLPTIGNFSKYLNAN
FT                   SNAVGFRVPALRIARDLLMQTGPLATTSANISGETPVKDAMEASIQFPEIPILAPIPWP
FT                   SSSGMASTVVEWKNGKWNLLRPGSVVLK"
FT   gene            362569..362727
FT                   /pseudo
FT                   /locus_tag="PMN2A_1921"
FT                   /note="similar to NATL1_04111"
FT   gene            complement(362751..362822)
FT                   /locus_tag="PMN2A_R0035"
FT   tRNA            complement(362751..362822)
FT                   /locus_tag="PMN2A_R0035"
FT                   /product="tRNA-Thr"
FT   gene            complement(362931..363278)
FT                   /locus_tag="PMN2A_1697"
FT   CDS_pept        complement(362931..363278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1697"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="Alternative locus ID: NATL2_03931"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1697"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59185"
FT                   /db_xref="GOA:Q46H47"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H47"
FT                   /protein_id="AAZ59185.1"
FT                   /translation="MAMTLRDIINKLLRRQPASASTARERLQLVLAHDRSDLSTELLDQ
FT                   MRKEILEVVAKYVEIDVDEGAVSLETEDRMTALVANLPIKRTMTGQIQLKEPKNQSEVD
FT                   SPETEGKDQNS"
FT   gene            complement(363283..364098)
FT                   /locus_tag="PMN2A_1698"
FT   CDS_pept        complement(363283..364098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1698"
FT                   /product="septum site-determining protein MinD"
FT                   /note="Alternative locus ID: NATL2_03941"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1698"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59186"
FT                   /db_xref="GOA:Q46H46"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H46"
FT                   /protein_id="AAZ59186.1"
FT                   /translation="MATDTRVILICSGKGGVGKTTLTANLGISLARQGLTTAVLDADFG
FT                   LRNLDLLLGLENRIVYTAQEVLEEECRLDQALVKHKQESNLSLLPAGNPRMLDWLKPDD
FT                   MKCIVDMLKEQFNYVLIDCPAGVEDGFKNAMAASQEAIVVTNPEVSAVRDADRVIGLLN
FT                   TNSIKPVQLVLNRVRPKMMANQEMLSIDDVTDILALPLLGLVLEDEQVIVSTNRGEPLT
FT                   LNSVNSPAAKCYLNIAKRLQGEDIPLIDPAEEISGFGAKFRRLMQTKIF"
FT   gene            complement(364262..364906)
FT                   /locus_tag="PMN2A_1699"
FT   CDS_pept        complement(364262..364906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1699"
FT                   /product="septum site-determining protein MinC"
FT                   /note="Alternative locus ID: NATL2_03951"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1699"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59187"
FT                   /db_xref="GOA:Q46H45"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H45"
FT                   /protein_id="AAZ59187.1"
FT                   /translation="MNSKSQKIIINIEGRNYPNWKIDLKNKLNTLKSNNLEIDAENIDL
FT                   SCKEISEIIEIANQYNCKIICFCSSSPKTIVSSQSLGYKSQFIESSSKNTSEINKRNPT
FT                   FLKTHFHQGTVRSGEYIESPGDLLILGDVNPGANVSAEGNIIIWGRLLGIAHAGNKGNS
FT                   KAKISALQLSPVQLRIANKVARGPKEKPQFGLAEQARIDSEEIIISPLETT"
FT   gene            complement(364909..366168)
FT                   /locus_tag="PMN2A_1700"
FT   CDS_pept        complement(364909..366168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1700"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="Alternative locus ID: NATL2_03961"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1700"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59188"
FT                   /db_xref="GOA:Q46H44"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H44"
FT                   /protein_id="AAZ59188.1"
FT                   /translation="MSSRTYYDPLHQSITLNSSIPEEKMVMELIDSSPFQRLRRIKQLG
FT                   PAYLTFHGAESSRFTHSLGVFHLARRAINHLLSIDSGLKEHKFIIYGAALLHDLGHGPL
FT                   SHTSEEIFKIKHEYWTAKLINSCKEITTILNKYGKGNAKAISDLIQSGKAEKKSIISLI
FT                   SSQLDCDRLDYLMRDSYTTGARYGQLDIDRIISAMTISPDGDLAIHPKGLMAVEHYLVI
FT                   RNLMYRSVYNHRLNEVCNWLLEQIIKTARKIGPQSLWADKSMSEWLWNHEKMSLESFLS
FT                   NDDTVTGYHIHKWQDCSSNNLSNLCKRFIHRNLLKALNISSFTLETRLESLAKARKLSE
FT                   KYYLEPDISCGLREQVVKSYHPYKHGLRLWDGDKLQALERVSPLVDRLIQPNQSSWLIY
FT                   PKEIEIELKIEIENLKMKHN"
FT   gene            complement(366172..367482)
FT                   /locus_tag="PMN2A_1701"
FT   CDS_pept        complement(366172..367482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1701"
FT                   /product="C-terminal processing peptidase-2, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /note="Alternative locus ID: NATL2_03971"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1701"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59189"
FT                   /db_xref="GOA:Q46H43"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H43"
FT                   /protein_id="AAZ59189.1"
FT                   /translation="MLSSVKSLTKPLQRLFAVLISFGILFQVFTQPAFALNDGQLLVIE
FT                   AWNQVNAGYLDPKKFDEIQWKKLRQKALEKPINNSQQAYSAIEAMLLPLGDPYTRLLRP
FT                   VDYEAMKKSNIGSEINGVGLQLGARKEDGDIVVISPLEGSPASDAGITSGTIIKKVNGQ
FT                   SPKQLGLEATAAKLRGQTGTQVIVELEQPDNEIKEISLERRSVDLRPVRTKRIRNESHT
FT                   FGYLRITQFSEGVPEQVKEALEELSGKDIDGLILDLRNNSGGLVSSGLAVADDFLSDMP
FT                   IVETKKRDSINDPISSGLETIYDGPMVTLVNEGTASASEILAGALQDNKRSELIGNKTF
FT                   GKGLIQSLTNLSDGSGLAVTVASYLTPSGRDIQNLGIDPDRLLEMPEPLNPGSDEDRWL
FT                   LDAELIMQATLDKEEVSEKLSKETLVKEEQLISQEIE"
FT   sig_peptide     complement(367375..367482)
FT                   /locus_tag="PMN2A_1701"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.964 at
FT                   residue 36"
FT   gene            367552..368208
FT                   /locus_tag="PMN2A_1702"
FT   CDS_pept        367552..368208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1702"
FT                   /product="cytochrome b6"
FT                   /note="Alternative locus ID: NATL2_03981"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1702"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59190"
FT                   /db_xref="GOA:Q46H42"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H42"
FT                   /protein_id="AAZ59190.1"
FT                   /translation="MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLV
FT                   CFLIQFATGFAMTFYYKPTVTEAYSSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHV
FT                   FRVYLTGGFKRPRELTWITGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPV
FT                   IGDFMVELLRGGESVGQSTLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL"
FT   gene            368268..368750
FT                   /locus_tag="PMN2A_1703"
FT   CDS_pept        368268..368750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1703"
FT                   /product="PetD protein"
FT                   /note="Alternative locus ID: NATL2_03991; subunit IV of the
FT                   Cytochrome b6f complex"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1703"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59191"
FT                   /db_xref="GOA:Q46M01"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46M01"
FT                   /protein_id="AAZ59191.1"
FT                   /translation="MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACVVGLAVLDPAFLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLI
FT                   PLGLMILPFIENINKFANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF"
FT   gene            complement(368747..370198)
FT                   /locus_tag="PMN2A_1704"
FT   CDS_pept        complement(368747..370198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1704"
FT                   /product="putative neutral/alkaline invertase protein"
FT                   /note="Alternative locus ID: NATL2_04001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1704"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59192"
FT                   /db_xref="GOA:Q46M00"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:Q46M00"
FT                   /protein_id="AAZ59192.1"
FT                   /translation="MPARFSQQNQRVRPNSNEDKVVARAKEHFEKTLIQISGDIAGSVA
FT                   ALEHPTKNDALNYGEIFLRDNVPVMIYLLTQKRYDIVKKFLTVSLDLQSTTYQTRGVFP
FT                   TSFVEEKGKLIADYGQRSIGRITSADASLWWPILCWLYVRKSGDQSFGTSQQVQRGVQL
FT                   LLDLVLHPTFEGNPVLFVPDCSFMIDRPMDVWGAPLEVEVLLHASLKSCIQLMELSRKH
FT                   QKSRLLDQRLVLTRQWVHDLRQFLLKHYWVTSKTMQVLRRRPTEQYGEDQHQNEFNVQP
FT                   QVVPSWLQDWLENRGGYLIGNIRTGRPDFRFYSLGNSLACMFGVLTAPQQRALFRLVLH
FT                   NREHLMAQMPMRICHPPMDIEEWQNKTGSDPKNWPWSYHNGGHWPSLLWFFGASILLHE
FT                   KRYPKADVLLMGQMRALIEECYWSQLNQLPRQKWAEYFDGPTGTWVGQQSRTYQTWTIV
FT                   GFLLMHHLLRAEPDDVLMLDLEEEF"
FT   gene            370879..372272
FT                   /locus_tag="PMN2A_R0036"
FT   rRNA            370879..372272
FT                   /locus_tag="PMN2A_R0036"
FT                   /product="16S ribosomal RNA"
FT   gene            372497..372570
FT                   /locus_tag="PMN2A_R0037"
FT   tRNA            372497..372570
FT                   /locus_tag="PMN2A_R0037"
FT                   /product="tRNA-Ile"
FT   gene            372580..372652
FT                   /locus_tag="PMN2A_R0038"
FT   tRNA            372580..372652
FT                   /locus_tag="PMN2A_R0038"
FT                   /product="tRNA-Ala"
FT   gene            372962..375836
FT                   /locus_tag="PMN2A_R0039"
FT   rRNA            372962..375836
FT                   /locus_tag="PMN2A_R0039"
FT                   /product="23S ribosomal RNA"
FT   gene            375928..376044
FT                   /locus_tag="PMN2A_R0040"
FT   rRNA            375928..376044
FT                   /locus_tag="PMN2A_R0040"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(376092..376940)
FT                   /locus_tag="PMN2A_1705"
FT   CDS_pept        complement(376092..376940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1705"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="Alternative locus ID: NATL2_04011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1705"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59193"
FT                   /db_xref="GOA:Q46H41"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H41"
FT                   /protein_id="AAZ59193.1"
FT                   /translation="MPELPEVETVRKGLEKLLNDFYIERIEVLKERSIASNGGSKSFIV
FT                   SVKNSYLGSWERRGKYLIGSLLTKEKFSKGFLVVHLRMTGQFKLLEKEVLACKHTRVRF
FT                   FDERGRELRFIDIRNFGQMWHVPSSRSIPEIVSGIKRLGPEPFSDDFNSHYLEEYLKKK
FT                   TRSIKSALLDQETVAGVGNIYADETLFDAGINPKKESRNLKSTELKRLCNSLVKILNIS
FT                   IGEGGTTFSDFRDLEGINGNYGGQAWVYRRSGKNCKKCGEKILREKICGRSTHWCPNCQ
FT                   K"
FT   gene            complement(376955..377173)
FT                   /locus_tag="PMN2A_1706"
FT   CDS_pept        complement(376955..377173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1706"
FT                   /product="photosystem I subunit IV psaE"
FT                   /note="Alternative locus ID: NATL2_04021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1706"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59194"
FT                   /db_xref="GOA:Q46H40"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H40"
FT                   /protein_id="AAZ59194.1"
FT                   /translation="MSFARKDKVRILRQESYWFNQIGEIVSIDKSPLMRYPVTVKFDKC
FT                   DFKAFSGVDGGANTSQFSVKELEAAAS"
FT   gene            377376..378425
FT                   /locus_tag="PMN2A_1707"
FT   CDS_pept        377376..378425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1707"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04031"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1707"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59195"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H39"
FT                   /protein_id="AAZ59195.1"
FT                   /translation="MIPQPSLDPSSLSFDLPDPDQDDLSNIDFIKRLENAWSICEQFDL
FT                   QTEIWRGRILRVVRDREKRGGDGRGTGFLQWLREMDISKSKAYSLIQLADSSDNLVVDG
FT                   ILEEASVNNFSKRAFIETAQAEPEIQHMISEAANEGRDITRRQVKSLTDQFMAATSTLL
FT                   PDEIREKTQSNLLPAKFVAPLVRELSKLTPIQQEEICETLRENPEIESVKDMTNTAKWM
FT                   GKSLDASLALRAFQNKNLNLDKATQEALRLDSLGLLSDAFGQAKTIESSILKFHSAWKR
FT                   LEGLQERLWVESGSSTPYLRELLDTLQTLTGSTIRVSLGELSGGKRLRLQLVEEDSERL
FT                   EPPSLEINK"
FT   gene            complement(378427..379287)
FT                   /locus_tag="PMN2A_1708"
FT   CDS_pept        complement(378427..379287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1708"
FT                   /product="peptidoglycan-binding LysM"
FT                   /note="Alternative locus ID: NATL2_04041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1708"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59196"
FT                   /db_xref="GOA:Q46H38"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H38"
FT                   /protein_id="AAZ59196.1"
FT                   /translation="MIKNIKTPIGLFYINSIIFLLSIFPLKVSSETKIVAKSGDTLFKI
FT                   SKQYGVTLKELMYKNNLNDATKIIEGEVIIIPHTGIDKHKKNEHLTYKVIEGDTLYKIS
FT                   RDYNVSLNDIISVNNLRKDSYLKLNQIILLPKGAKYKKEINIENIKVASKKVFYHKTTK
FT                   TEDLSTIAYLHKIPIEQLKTLNKLTDPIKIKPNIKLRLRKDKPLKWIKYGSLMINWSDW
FT                   TYFDGNYIAQSKTKKNKTFYLALSCKKRVLNNTLINSYWTSWYFPETDFEFKLINDFCD
FT                   QDFNF"
FT   gene            complement(379332..380711)
FT                   /locus_tag="PMN2A_1709"
FT   CDS_pept        complement(379332..380711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1709"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Alternative locus ID: NATL2_04051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1709"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59197"
FT                   /db_xref="GOA:Q46H37"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H37"
FT                   /protein_id="AAZ59197.1"
FT                   /translation="MSLENFVLHQLQDLVLSGKTRNEKWRRAQLKSLSTLLENHQQEIL
FT                   KALSQDLGKPATEAFFEIIAVKQEIKLAQKSLSNWMKTRQINVPVSLKPAQALVQPDPL
FT                   GCILIIGPWNYPFSLTLQPLVGALAAGNTAVLKPSEHAPNVSNLIKKLIEKYFPPEIVQ
FT                   VFEGDGNIAADLMTRQFDHVFFTGGENIGKKVMEAASKNLTPVTLELGGKSPAVVIDGA
FT                   NLEVTSKRVIWGKSLNAGQTCIAPDHLLVEDKLFDSLISNLINSINDFYGNTPLDSKHL
FT                   GSIINEKQFNRLNNLLTQAKKNNQIIYGGDSNEKEKRISPTLIKIDNRNDPLMKEELFG
FT                   PLLPILSIKNLDQAISDFKLLPKPLALYLFGGGEKEQGKVLSMTSSGGVCFNDVVLQAG
FT                   IPELPFGGVGTSGMGKYHGKAGFDNFTHYKSVLKRPFWLDLNFRYPPYKLDLSLLNKLI
FT                   G"
FT   gene            380919..381242
FT                   /locus_tag="PMN2A_1710"
FT   CDS_pept        380919..381242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1710"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1710"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59198"
FT                   /db_xref="GOA:Q46H36"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H36"
FT                   /protein_id="AAZ59198.1"
FT                   /translation="MSIIYELLFLYIGPKIAILTSERLINHLLVVIIFSLAFIGVAEVM
FT                   YWLYKKEYLRAKAKYLRELIDQKNDLSSLNEPFYACVYEKWNSGEMPLTEANTMCSLKF
FT                   EHN"
FT   gene            381321..382070
FT                   /locus_tag="PMN2A_1711"
FT   CDS_pept        381321..382070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1711"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="Alternative locus ID: NATL2_04071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1711"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59199"
FT                   /db_xref="GOA:Q46H35"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H35"
FT                   /protein_id="AAZ59199.1"
FT                   /translation="MTNKFIISKYFSYVIIIFFVVILSITFIHLDVNIIADFFYDIVSS
FT                   LNTNNFFSLILIFLLFILRSTSIIIPVLPGTIFSAAAGFQFGFTQGLVIIFFADFFSCS
FT                   ISFLLARKLGRKFITRLLGSRQMRRVESISQDYLENNYFLMTALLMSGFFDFVCYAIGL
FT                   TKITWKRFMPALIFSIIISDSPFVASGVAARKIKDIGLKNFLQKILNGELDTISGNYLF
FT                   LFITSFLIIFSLAMINIYLQKRPNIIK"
FT   gene            complement(382587..382820)
FT                   /locus_tag="PMN2A_1922"
FT   CDS_pept        complement(382587..382820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1922"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1922"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23859"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC1"
FT                   /protein_id="ABU23859.1"
FT                   /translation="MTKRRQILLMPLLLKGANNSPTCINFGRKDMIKKKEKFNVTQGIT
FT                   LLLLKKISLPSNLVFQMILFITNPENNIGYEH"
FT   gene            complement(382978..383233)
FT                   /pseudo
FT                   /locus_tag="PMN2A_1923"
FT                   /note="frameshift; similar to NATL1_04281"
FT   gene            384308..384583
FT                   /locus_tag="PMN2A_1712"
FT   CDS_pept        384308..384583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1712"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1712"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59200"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H34"
FT                   /protein_id="AAZ59200.1"
FT                   /translation="MNQPVREVLPTPAGWLVAPARDFCLFFIRDPKSVMVAPTVLTQLW
FT                   YCTEQGIPIQLKNTRRLDYESAHETWNELLSNDWELVEHQINDAAA"
FT   gene            384815..385264
FT                   /locus_tag="PMN2A_1713"
FT   CDS_pept        384815..385264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1713"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04101"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1713"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59201"
FT                   /db_xref="InterPro:IPR024525"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H33"
FT                   /protein_id="AAZ59201.1"
FT                   /translation="MPQITHPDSLSCSDHIHFRKLSSDSQQLEALIQSFADRSQNKTFL
FT                   LANTTNDFLAIRPSCNPIIAKGLAGMYDSDDLVIELSELVKIHRLEADSDWGFTAFTLK
FT                   EVFSYKGDLNNDLSIYSLIFKKIDGIWKIVWMQRSQGTTDISTWD"
FT   gene            complement(385298..385657)
FT                   /locus_tag="PMN2A_1714"
FT   CDS_pept        complement(385298..385657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1714"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1714"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59202"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H32"
FT                   /protein_id="AAZ59202.1"
FT                   /translation="MSLPTIDILFRGYISIIKSRPNKSLFMSFEPDNLQTLISKYRTMD
FT                   IYELEANIDNWDKENDCPIQTQSLAIAKTELEIKYKERQEQIELLTKSLTSSSRAGRWI
FT                   FSVKAVIKQLLKFKK"
FT   gene            385851..386066
FT                   /locus_tag="PMN2A_1715"
FT   CDS_pept        385851..386066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1715"
FT                   /product="high light inducible protein hli7"
FT                   /note="Alternative locus ID: NATL2_04121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1715"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59203"
FT                   /db_xref="UniProtKB/TrEMBL:Q46KD4"
FT                   /protein_id="AAZ59203.1"
FT                   /translation="MTTSSNAASSQVITEYGKQNIFGRETQPQLVEDYTSYPEEAEKTN
FT                   GRWAMIGMVSLLVSYFTTGQIIPGIF"
FT   gene            complement(386025..386138)
FT                   /locus_tag="PMN2A_1924"
FT   CDS_pept        complement(386025..386138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1924"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1924"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23860"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC2"
FT                   /protein_id="ABU23860.1"
FT                   /translation="MLLSRIVLLDGCIVFNSYLLVVIGLENSRNDLTCCEV"
FT   gene            386101..386220
FT                   /locus_tag="PMN2A_1925"
FT   CDS_pept        386101..386220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1925"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1925"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23861"
FT                   /db_xref="GOA:A7MDC3"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC3"
FT                   /protein_id="ABU23861.1"
FT                   /translation="MQPSNKTILERSIGRPAMMAFVLLTGIYLTTGQLIPGVV"
FT   gene            386220..386366
FT                   /locus_tag="PMN2A_1716"
FT   CDS_pept        386220..386366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1716"
FT                   /product="possible high light inducible protein"
FT                   /note="Alternative locus ID: NATL2_04151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1716"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59204"
FT                   /db_xref="GOA:Q46H30"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H30"
FT                   /protein_id="AAZ59204.1"
FT                   /translation="MKNQTTETPRVEEGKVIAERLNGLAASIGCLALVGAYLTTGQIIP
FT                   GVV"
FT   gene            386366..386515
FT                   /locus_tag="PMN2A_1717"
FT   CDS_pept        386366..386515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1717"
FT                   /product="possible high light inducible protein"
FT                   /note="Alternative locus ID: NATL2_04161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1717"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59205"
FT                   /db_xref="GOA:Q46K84"
FT                   /db_xref="UniProtKB/TrEMBL:Q46K84"
FT                   /protein_id="AAZ59205.1"
FT                   /translation="MTTQNNNNRRNIDPEKVTAERLNGYAALFGCIALVGAYATTGQII
FT                   PGFV"
FT   gene            386515..386640
FT                   /locus_tag="PMN2A_1718"
FT   CDS_pept        386515..386640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1718"
FT                   /product="possible high light inducible protein"
FT                   /note="Alternative locus ID: NATL2_04171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1718"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59206"
FT                   /db_xref="GOA:Q46H28"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H28"
FT                   /protein_id="AAZ59206.1"
FT                   /translation="MNKETNYWKTAEQMNGRLAMMGFFAAVINYGLTGWIIPGIV"
FT   gene            387079..387192
FT                   /locus_tag="PMN2A_1926"
FT   CDS_pept        387079..387192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1926"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1926"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23862"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC4"
FT                   /protein_id="ABU23862.1"
FT                   /translation="MIFPPPQVVFGLLLLSIAATLIFNVRYNPFVNSEDDI"
FT   gene            387664..389415
FT                   /locus_tag="PMN2A_1719"
FT   CDS_pept        387664..389415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1719"
FT                   /product="TPR repeat"
FT                   /note="Alternative locus ID: NATL2_04191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1719"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59207"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H27"
FT                   /protein_id="AAZ59207.1"
FT                   /translation="MESSDKDQGKKNIPKIQTFTVPFALGEIQENITITTNTPAKPSKP
FT                   SKPSKPSKPSKPSKEQIINQAIQFHLRGNIPEAIKYYEYLIQQGFKNHNVFSNYGLILK
FT                   DLGKLKEAEISTRKAIELNPNYAIAFSNLGTILKDLGNLQEAEVSTRKAIELNTNYAEA
FT                   YLNLGTILKDLGNLKEAEISTRKAIELNPNSAMAFSNLGTIFIDLGNLQEAEVSTRKAI
FT                   ELDPNYAEAYSNLGNILKDLGNLQEAELSLRKAIEINPDFAEAYSNLSLLELLKGNYES
FT                   GLENYEFRSQTKKPAITHANIKLKKINNEKLDKGNKLLVVSEQGLGDTLQYMRYIPYLR
FT                   KKDFDISFCAQTKLHSLIQSSCIDLNPLTPEQASLVSEGEWVPLLSLPKYLKVRPENPI
FT                   VSEPYISSNDELNKKWKDILSKEKRPIIGINWQGSPEIEKSVYQGRSIPLDIFSILLKE
FT                   NDITMLSLQKGFGSEQLNDCSFKNEFVECQPQIDATWDFLENAAIIENCDLIITCDTSI
FT                   AHLAGGMGKKVWLLLKDIPFWTWGLERENTFWYPSMKLFRQKERHNWQEVMDRVSIAIT
FT                   KEMKKND"
FT   gene            389408..389782
FT                   /locus_tag="PMN2A_1720"
FT   CDS_pept        389408..389782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1720"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1720"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59208"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H26"
FT                   /protein_id="AAZ59208.1"
FT                   /translation="MTKKLKSLSSILAPVSLGELIDKITILEIKQIHMTGIKLKNVDKE
FT                   LKLLRKILQDENLEIDIDLINNLKEVNNNLWEIEDKIRIKESNQKFDKEFIQIARSVYK
FT                   ENDKRASIKKRPHSGVFDST"
FT   sig_peptide     389408..389464
FT                   /locus_tag="PMN2A_1720"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.747) with cleavage site probability 0.732 at
FT                   residue 19"
FT   gene            complement(389806..389877)
FT                   /locus_tag="PMN2A_R0041"
FT   tRNA            complement(389806..389877)
FT                   /locus_tag="PMN2A_R0041"
FT                   /product="tRNA-Thr"
FT   gene            complement(389889..389970)
FT                   /locus_tag="PMN2A_R0042"
FT   tRNA            complement(389889..389970)
FT                   /locus_tag="PMN2A_R0042"
FT                   /product="tRNA-Tyr"
FT   gene            390079..390516
FT                   /locus_tag="PMN2A_1721"
FT   CDS_pept        390079..390516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1721"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="Alternative locus ID: NATL2_04211"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1721"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59209"
FT                   /db_xref="GOA:Q46H25"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H25"
FT                   /protein_id="AAZ59209.1"
FT                   /translation="MDLLLINGPNLNLVGKREPSIYGSQTLEDIQAELLTLASELDAKL
FT                   KFFQSNSEGEMIDCIQKSVGSIDGILINAGAYTHTSIALRDALLGVAIPYVEVHLSNIY
FT                   SREEFRHKSFLSDKALGLVCGFGANSYQLALEGIVSYLKRV"
FT   gene            390524..391138
FT                   /locus_tag="PMN2A_1722"
FT   CDS_pept        390524..391138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1722"
FT                   /product="probable hydroxylase for synthesis of
FT                   2-methylthio-cis-ribozeatin in tRNA"
FT                   /note="Alternative locus ID: NATL2_04221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1722"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59210"
FT                   /db_xref="GOA:Q46H24"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H24"
FT                   /protein_id="AAZ59210.1"
FT                   /translation="MNNSKSQVAGPSKIRWLINKTSEDWIDLAISNPMEILLDHAHCER
FT                   KAAGVALQLMFRYVSEPGLSEVLSPLAREELEHFERVLSILNARGQKLQKLASPPYGLT
FT                   LAKNICKDEPLRMLDSFLVAGLIEARSHERMKLLSIHSPDVELRDLYADLLKSEARHFG
FT                   IYWKLADERFERNLLTSRLEELAKVESDALLEMHHQPRMHS"
FT   gene            391175..391903
FT                   /locus_tag="PMN2A_1723"
FT   CDS_pept        391175..391903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1723"
FT                   /product="cobalt-factor II C20-methyltransferase /
FT                   precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /EC_number="2.1.1.151"
FT                   /note="Alternative locus ID: NATL2_04231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1723"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59211"
FT                   /db_xref="GOA:Q46H23"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H23"
FT                   /protein_id="AAZ59211.1"
FT                   /translation="MKVLTIAGVGPGDPSLLTLAAVEAIRESTVVSYPVSTRGGDSLAE
FT                   KIASKWITKDKKKLPLYFPMVDDQNTLKSAWRVAGNDLMKMVDKGERVVFLAQGDISLF
FT                   STGSYLSKELEKYHPECVVKLIPGVTSFSAAAAKSKLPLAFQEEELLVLPVPDSYDELK
FT                   SILSDAASKKRVVVLLKLGKKWEWVKLLLEELDLIKISIFAERIGFSDQQILRASDLPS
FT                   GTRPYFSLLLIRQSWPLTMP"
FT   gene            complement(391910..392902)
FT                   /locus_tag="PMN2A_1724"
FT   CDS_pept        complement(391910..392902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1724"
FT                   /product="Dihydrouridine synthase TIM-barrel protein nifR3"
FT                   /note="Alternative locus ID: NATL2_04241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1724"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59212"
FT                   /db_xref="GOA:Q46H22"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H22"
FT                   /protein_id="AAZ59212.1"
FT                   /translation="MKEFSPICLSGNGTPRSLECLVIQSPLAGVSDQIFRNFVRRWSPK
FT                   ALLFTEMVNAKSLELGHGEEKVIELSEESGPIGVQLFDHRPDSMVDAAIKAESSGAFLI
FT                   DINMGCPVKKIARKGGGSALLKEPELAQLIVKKVSKAISIPVTVKIRLGWCETTSDPVS
FT                   FALGLQEAGAQLITVHGRTRRQGFSGHANWKAIAKIKKSLDIPVIANGDIKNSRDAIEC
FT                   LKITNADGVMIGRASMGAPWLVGQIDEEIKNQTTFKPPDAKMKVSLSLEHLKLLVSKKG
FT                   NHGLLIARKHMNWTCRGFEGASNLRHKLVRARTPNDAIKLLEDELLKFN"
FT   gene            392868..393023
FT                   /locus_tag="PMN2A_1927"
FT   CDS_pept        392868..393023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1927"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1927"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23863"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC5"
FT                   /protein_id="ABU23863.1"
FT                   /translation="MPDKQIGENSFIFRGKFDLFQSLQKEKVLSVSLISENKQKIFIDA
FT                   FKEIGT"
FT   gene            complement(392927..393205)
FT                   /locus_tag="PMN2A_1725"
FT   CDS_pept        complement(392927..393205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1725"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1725"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59213"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H21"
FT                   /protein_id="AAZ59213.1"
FT                   /translation="MTLYRSKLRLILHTTSMSKEFDSKMKFRNQTSLKRLTKKNRDSST
FT                   TKPSLIAILLVLLAFLQVPISLKASINIFCLFSEISETDKTFSFCND"
FT   sig_peptide     complement(393020..393205)
FT                   /locus_tag="PMN2A_1725"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.783 at
FT                   residue 62"
FT   gene            393230..394600
FT                   /locus_tag="PMN2A_1726"
FT   CDS_pept        393230..394600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1726"
FT                   /product="Small GTP-binding protein protein
FT                   domain:GTP-binding protein"
FT                   /note="Alternative locus ID: NATL2_04271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1726"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59214"
FT                   /db_xref="GOA:Q46H20"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H20"
FT                   /protein_id="AAZ59214.1"
FT                   /translation="MALPVVAIIGRPNVGKSTLVNRLCQSREAIVHDEPGVTRDRTYQD
FT                   GFWRDRDFKVVDTGGLVFDDDSEFLPEIREQANLALEEAVVALVIVDGQEGITTADESI
FT                   AEFLRSRSGKTLVVVNKCESPEQGLAMAAQFWKLGLGEPYPISAIHGVGTGDLLDQVVN
FT                   LFPSKDLDEVSDSPVQLAIIGRPNVGKSSLLNSICGETRAIVSSIRGTTRDTIDTRITH
FT                   QGKEWKLVDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDALDGVTEQDQRLA
FT                   GRIEQEGRACLIVINKWDAVEKDSHTMSAMEKDIRSKLYFLDWAQMIFTSAVTGQRVEG
FT                   IFALATLAVDQSRRRVTTSVVNEVLTEALKWRSPPTTRGGKQGRLYYGTQVAINPPSFT
FT                   LFVNEPKLFGETYRRYIERQIREGLGFEGTPIKLFWRGKQQRDVEKDMARQQKGVRN"
FT   gene            394610..395524
FT                   /locus_tag="PMN2A_1727"
FT   CDS_pept        394610..395524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1727"
FT                   /product="possible cobalt transport protein"
FT                   /note="Alternative locus ID: NATL2_04281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1727"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59215"
FT                   /db_xref="GOA:Q46H19"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H19"
FT                   /protein_id="AAZ59215.1"
FT                   /translation="MDWLKKIPIGQYVSGKSSWLRGIDPRIKLSWILLFLLTPILANSL
FT                   WRISIAFVLLLITFLSFLPPRIWWRSLVFLLAFSLVIGSLSIVLPASQSSFALPIRASD
FT                   EIPGAIILTRSWEIFRLGPIDFGGISLGPLIIDRRSAELGIKTSTLIFTVIHSVNLILI
FT                   TTPPEDLVWAIRWFFAPLTLLGFPLEKLSFQLLLALRFLPLVQEELQNLFRSIGVRAID
FT                   FKKLGLKSSLGLFVTLGERLLSNILLRAEQGADSLMSRQGLWLSSEQLRPNIVINPKYL
FT                   WINISSIFLLLIAISLRCLYGTS"
FT   gene            395540..395806
FT                   /locus_tag="PMN2A_1728"
FT   CDS_pept        395540..395806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1728"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1728"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59216"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H18"
FT                   /protein_id="AAZ59216.1"
FT                   /translation="MNAERYLNHPTFGMLYLVSPASNGRDVYATLYAQKIFFLVTLQPR
FT                   GATFEVIPYMDARHYSEMHMAKCRREKSSDMDVWQELFNQTFM"
FT   gene            395818..396459
FT                   /locus_tag="PMN2A_1729"
FT   CDS_pept        395818..396459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1729"
FT                   /product="Protein of unknown function UPF0001"
FT                   /note="Alternative locus ID: NATL2_04301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1729"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59217"
FT                   /db_xref="GOA:Q46H17"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H17"
FT                   /protein_id="AAZ59217.1"
FT                   /translation="MILTGSNEFKKIKDSIPLGVNLLAVSKGHKHDSIRKLSGYGQLDF
FT                   GESRLQEAILKKIDLSDLTQLRWHFVGTLQKNKVRRVIKEFDFIHSVDSLPLLERISRI
FT                   SQEEQKSPNIFLQVKFIEDPNKGGFLKEELLKSWSNIISLKNINLIGLMTIPPIVLNAY
FT                   QRKDLFCECRNFANHLGLKDCSMGMSNDWQEAIQGGATWIRLGSLLFGKR"
FT   gene            396621..397196
FT                   /locus_tag="PMN2A_1730"
FT   CDS_pept        396621..397196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1730"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1730"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59218"
FT                   /db_xref="GOA:Q46H16"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H16"
FT                   /protein_id="AAZ59218.1"
FT                   /translation="MSLISRLRAVVAGDDFLDSDFDELDYETSDDFENFNRGKKEGSTE
FT                   MATISQANPFDGRSGFPPSNVIGMPGISTNDSEVSLMEPRSFDEMPRVIQALRERKTVI
FT                   LNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNSFQEEASPSNM
FT                   SNKGNDLISKETSPAPEPAWGETVATAL"
FT   gene            397250..398050
FT                   /locus_tag="PMN2A_1731"
FT   CDS_pept        397250..398050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1731"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Alternative locus ID: NATL2_04321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1731"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59219"
FT                   /db_xref="GOA:Q46H15"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H15"
FT                   /protein_id="AAZ59219.1"
FT                   /translation="MAKAIVSPLLERGEYNPQQVLGIVGRSSSIASALNDLPKEVKVVS
FT                   SKDSLSKEVWKAPIKILAVKPQQLSKIKESVSSFQSNDQFPKPLLISVLAGITLKSLKK
FT                   AFPRHTCVRAVPNTPSLVGQGLTGLAWPDDMTLDQKKVVRKIFEPISEIYELEEPKLDS
FT                   FLALTSSGPAYIALVVEAMADGAVAAGLPRLLSNQLAHKTLSGTASLLREKSLHPAELK
FT                   DMVASPAGTTISALRHLELAGLRSALIEAVVLAAQKSRQLAEEV"
FT   gene            complement(397947..399221)
FT                   /locus_tag="PMN2A_1732"
FT   CDS_pept        complement(397947..399221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1732"
FT                   /product="glycosyl transferases group 1"
FT                   /note="Alternative locus ID: NATL2_04331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1732"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59220"
FT                   /db_xref="GOA:Q46H14"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H14"
FT                   /protein_id="AAZ59220.1"
FT                   /translation="MTHIAWLGKKTPFCGNVCYGLSTTEELKERGYQTSFIHFDNPMRD
FT                   GNNKTSLLANDPDVSLPYLIKSQVYTIPSLNAQRELRESLSRLKPDLVHASLTLSPLDF
FT                   RLPELCHQLNLPLIATFHPAFDSKLRNLTANTQQLTYQLYAPSLAKYDKVIVFSDLQAE
FT                   VLAKLGVKESRLEVIPNGIDIKKWNTLKPHNSQNELHFEIRKKLGSERIFIYMGRIASE
FT                   KNVEALLRAWRFVQPKGCRLVIVGDGPLRPTLENHSISNKEDNVFWWGYEADQNKRVAL
FT                   LQIAEVFLLPSLVEGLSIALLEAMATGTACVATDAGADGEVLENGAGIILNTEGVTSQL
FT                   RTLLPVLHDQPVLTHELGRRARLRVEEKYTLQQNIDSLENLYTNVLRSSSSKLPQPIDD
FT                   SSALPKQLLQLRRISSQQVQGVEEH"
FT   gene            complement(399338..400138)
FT                   /locus_tag="PMN2A_1733"
FT   CDS_pept        complement(399338..400138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1733"
FT                   /product="DNA replication and repair protein RecO"
FT                   /note="Alternative locus ID: NATL2_04341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1733"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59221"
FT                   /db_xref="GOA:Q46H13"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H13"
FT                   /protein_id="AAZ59221.1"
FT                   /translation="MSLNQRMKGLSLKVGPLGESDRLLTILSEENGISRFAIPGARKPK
FT                   SRLGATSPFNFLDLHIVGKKNLRRVTQIKILKSYGDLGRNIETLSAAQAISELIMVMVG
FT                   NEDPQKDLLKLVLIHLNRLNDLHKTEFNSLEALAISVQSCVHLLALGGYCLPLQNCCHS
FT                   GSRLIPPIGEWSWKCSFIPEEGFAIGTIPNASAELNPSELALLQRLLLEKLPFHSNGKL
FT                   LGPKNVWLKLLRIVETWIETHLQKKITSLEMMREVIISNELNTK"
FT   gene            complement(400138..400821)
FT                   /locus_tag="PMN2A_1734"
FT   CDS_pept        complement(400138..400821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1734"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="Alternative locus ID: NATL2_04351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1734"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59222"
FT                   /db_xref="GOA:Q46H12"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H12"
FT                   /protein_id="AAZ59222.1"
FT                   /translation="MSKNSVEEAHVNISNVIYQAVLNPHFDKEMIVQICDASKQNGFAG
FT                   LCTSLSNLPIARERLGSKSTTKLISVIAFPFGFIPTSIKRKEAEYALDKGAEELDLVPN
FT                   YFALKEGNIELFAEEINQISELGIPVRVIIDANTLSNFSRLSVAIDALIDAGAIGIQIG
FT                   NGFGPSASKDQTNHVSKLVKNRCSIKTVGGIKTFDQAIEIIEAGSTFIGTSFGFEITQE
FT                   QKKKE"
FT   gene            complement(400836..401420)
FT                   /locus_tag="PMN2A_1735"
FT   CDS_pept        complement(400836..401420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1735"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /note="Alternative locus ID: NATL2_04361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1735"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59223"
FT                   /db_xref="GOA:Q46H11"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H11"
FT                   /protein_id="AAZ59223.1"
FT                   /translation="MKLLIHGRNLELTQSLRDYTKTKIDKATHNFQEMVQEADVHLSVA
FT                   RNPRVPQQTAEVTVFANGTVIRAQERSENLYASIDLVANKLARQLRKYKERHNSHNVHH
FT                   NQSTKSVQNEDTQNFSSSDHSLTEGKEPHLPSPGVRRKYFEMTPMNIEQARVQLDLIDH
FT                   DFYLFREEEGSALRVIYKRNHGGYGVIQEKI"
FT   gene            401403..402122
FT                   /locus_tag="PMN2A_1736"
FT   CDS_pept        401403..402122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1736"
FT                   /product="Lipoate-protein ligase B"
FT                   /note="Alternative locus ID: NATL2_04371"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1736"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59224"
FT                   /db_xref="GOA:Q46H10"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H10"
FT                   /protein_id="AAZ59224.1"
FT                   /translation="MDKKLHFVSPETGPNSNLDLTPQLAQSSSAFLFEPKNIVPFETAL
FT                   GWQKNFQKNLIEQPFSPQAVWLLEHFSCFTMGRGSDKKNLLFEENNSPLPVFSIERGGE
FT                   VTHHMPGQIVGYLVLNLSLHKKDLSWYLRELEQVLIDVLDLLGMEGKRVDGLTGVWCED
FT                   KKVGSIGIGCKRWVTQHGFSLNVDCDLIGFEKIIPCGLDKVKVGKLSDWIPGIKVCDVT
FT                   PLLRESVKRRFKLNWEK"
FT   gene            402172..404145
FT                   /locus_tag="PMN2A_1737"
FT   CDS_pept        402172..404145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1737"
FT                   /product="long-chain acyl-CoA synthetase"
FT                   /note="Alternative locus ID: NATL2_04381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1737"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59225"
FT                   /db_xref="GOA:Q46H09"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H09"
FT                   /protein_id="AAZ59225.1"
FT                   /translation="MTKTNSQKNIFSSEDALAFWIPNRKEEQAINRRSHLNKITQVDQI
FT                   WELLKVQLSDVLAVDSPHTFHPESFTYKELAENISKAAFSFTKLGVGPDDVVALFAENS
FT                   PRWLIADQGLMRIGATDSVRGATAPPSELRYILEDSNAVGLIVQNSDVWERLSLNDDQI
FT                   NSLKFVLQLEGKACDGVFEWESFLKKGLNIENVSKQEKIIDRQPKRIATILYTSGTTGK
FT                   PKGVPLTHSNLLHQIRSLACVANPSPGAPVLSVLPIWHSYERSAEYYFFSCGCTQTYTS
FT                   IRHLKEDLPRVKPIVMATVPRLWESIKLGFEDAVDKMPRLRKTLIKSAISNSKAYKLAR
FT                   RKLYFLTIESVSSFEQISSFIEILLRYPMHRISSIYLWPKILTKICGGRLRFPISGGGA
FT                   IAPHIDSFFEALGVELLVGYGLTETSPVLTCRRPWRNIRGGAGQPLPETEIKIVDPETF
FT                   QIKKLRQKGLVLARGPQIMSGYLGKRSESKKVLDATGWFNTGDLGMLLSDGSLILTGRA
FT                   KDTIVLSSGENIEPGPLEECLIASSLIEQAFLLGQDQKYLAALIVPRIDHVKEWLAERG
FT                   VNSKVVLGISPENYELRQSLKLEMNQALANRLGSRREERLFSIALVEPFTIENGLLTQT
FT                   LKQKREQIIQRDLKLINEIYGL"
FT   gene            404226..404660
FT                   /locus_tag="PMN2A_1738"
FT   CDS_pept        404226..404660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1738"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1738"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59226"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H08"
FT                   /protein_id="AAZ59226.1"
FT                   /translation="MDSISIKRSITVRAVVTPSWKEEAERELSNAISAIDQQLGELEKE
FT                   GQQIVDGIRRQSANPLDPRVQEQVAQVQNQVASKRSEFEEQKRNLLSQQSQVRELEMEQ
FT                   IVEQGQIDSFCDLKVGDNLVSKMGVSILVRDGVVEAIDQD"
FT   gene            404851..406221
FT                   /locus_tag="PMN2A_1739"
FT   CDS_pept        404851..406221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1739"
FT                   /product="dihydrolipoamide S-acetyltransferase"
FT                   /note="Alternative locus ID: NATL2_04401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1739"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59227"
FT                   /db_xref="GOA:Q46H07"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H07"
FT                   /protein_id="AAZ59227.1"
FT                   /translation="MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKA
FT                   DMDVESFQDGFLASIVMPAGSSAPVGETIGLIVETSDEIAEAQANAPSPSPQSGSQEKE
FT                   SSSPQVQEKQASVDSPKATVVTKTSLAPLVSESSVNQDQFLNDGRIVASPRAKKLASQM
FT                   GVDLATVRGSGPHGRIQAEDVQSAKGQPISVPWIAESNAPAKIISDVPRIEKKSVDSGK
FT                   PPAPGKSFGSRGETISFNTLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKSDG
FT                   VTMTALLAKAVGLTLARHPQVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADK
FT                   TSLTDLSLQWADLVKRARNKQLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAV
FT                   GASLSKVVASKDGSISIKKQMQVNLTADHRVIYGADGALFLKDLAYLIENNPCSLSS"
FT   gene            406275..407372
FT                   /locus_tag="PMN2A_1740"
FT   CDS_pept        406275..407372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1740"
FT                   /product="S-adenosylmethionine:tRNA-ribosyltransferase-isomerase"
FT                   /note="Alternative locus ID: NATL2_04411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1740"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59228"
FT                   /db_xref="GOA:Q46H06"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46H06"
FT                   /protein_id="AAZ59228.1"
FT                   /translation="MLDQKDNLLSSYNYDLPNELIAQSPTKSRHDAKLMIVKDGLDDSL
FT                   NLVHAKVWDIKDILKPADLLVVNNTRVVKARLKIRLSGGGAGELLLMEPRGDGRWLCLG
FT                   RPARRMRGGDQLWLDMSRDNSLILKVIDKDERTGGRIIQFSNEFTSWTEMENILDLCGE
FT                   VPLPPYIDKDKSSDHEESYQTRFASKPGAIAAPTAGLHLSDELIENLKTRGIKIAQITL
FT                   HVGLGTFRPLEKEDLSQLHLHSEWIEVTEETIKAITNCKEDGGKVFAVGTTSVRALEAA
FT                   YLSGRGALKPYEGKVDLVIKPGFKFSVIDGLLTNFHLPKSSLLLLVSALIGRKRMLKLY
FT                   KQAISNKYRFFSYGDAMLITPESVI"
FT   gene            complement(407382..408368)
FT                   /locus_tag="PMN2A_1741"
FT   CDS_pept        complement(407382..408368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1741"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="Alternative locus ID: NATL2_04421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1741"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59229"
FT                   /db_xref="GOA:Q46H05"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H05"
FT                   /protein_id="AAZ59229.1"
FT                   /translation="MSRIYEDNSFAIGHTPLVKLNSITKNAKATVLAKIEGRNPAYSVK
FT                   CRIGANMIWDAEKKGLLNKDKVIIEPTSGNTGIALAYTAAARGYKLILTMPESMSIERR
FT                   RMMAVLGAELILTEAAKGMPGAIAKAKEIADSDPKKYFMPGQFDNPANPEIHFKTTGPE
FT                   IWDDTDGQIDVLVSGVGTGGTITGVSRFIKQEKNHSLLSVAVEPTHSPVITQTLNGEEV
FT                   KPGPHKIQGIGAGFIPQNLDLSVVDQVEQVSNDESIAMALRLAQEEGLLVGISCGAAAA
FT                   VALRLAEKEEFSGKTIVVVLPDLAERYISSVMFENVPTGVIKEPSLA"
FT   gene            complement(408457..409923)
FT                   /locus_tag="PMN2A_1742"
FT   CDS_pept        complement(408457..409923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1742"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="Alternative locus ID: NATL2_04431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1742"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59230"
FT                   /db_xref="GOA:Q46H04"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H04"
FT                   /protein_id="AAZ59230.1"
FT                   /translation="MTERNLLIDPCWSAKDLGEPLPSRPHAVSVALPRWEDVIAYEEKV
FT                   PACINSLKAIYPRFGFNPFVAEIARKSLEFHGESKKSSWPYPNRASALSAQEYCLRKNS
FT                   DCFSKIEDFLGVSCLIIDQKNTSSAKAFWQHTGLGLSSREAAIALGKEKKPLTSDGDCA
FT                   REALIKRLANIYNCDNSLIRLHRSGMAALTTIISAINCIKGTSSTLQIGFPYVDVLKLP
FT                   QIIFQGSDLIIKTKLNHIKEELDKKNPAALIIEIPSNPLLQCVDLISISKLAKEKNIPV
FT                   IVDDTIGSSLNVHLTPYADVIFSSLTKSFAGRGDILAGSTVISPYSKWKKEIAEIIPKV
FT                   ALSTLSDSDAIELELTSRDVKDRLKRLNISCLKLKEKLETKKEISKVLHPQYCKNFNSL
FT                   LKKGGGYGCLLSFELKGGIEESKRVYDSLRVNKGPSLGTNFTLVCPYVQLAHFKELKWA
FT                   ESCGVSEHLLRVSVGLENEDELWSRFNSAI"
FT   gene            complement(409920..411089)
FT                   /locus_tag="PMN2A_1743"
FT   CDS_pept        complement(409920..411089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1743"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="Alternative locus ID: NATL2_04441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1743"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59231"
FT                   /db_xref="GOA:Q46H03"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H03"
FT                   /protein_id="AAZ59231.1"
FT                   /translation="MGSVKREKEFSTGVNTRVIHHKDNFSEGTGSIMPPIFPTSTFVHG
FT                   NEGGFDYTRSGNPNFRILESVLSDLEECKFASVFSSGVAAITAIVSTLKAGDLILCEEN
FT                   LYGCTVRLFEQVFNRFGLKTQWIDFTKPNFQEVISNHKPAMIWIESPTNPLLKIIDIEG
FT                   ICHFANKMKIPVVVDNTFATPLLQRPLQLGATLSLTSTTKFINGHSDALGGAVCTESAI
FT                   WRDKLNFAQKALGLNPSPFDCWLITRGIKTLPLRLERQVNNASKIANQLADNPAIKYVR
FT                   YPFRNDHPQCKLAKRQMAMGGAIVTATVNATQAQTYSFCKSLHYFKMAESLGGIESLVC
FT                   HPATMTHASVSKETKIKIGITDSLIRFSIGCEDIEDLSADLNQALGTIS"
FT   gene            complement(411191..411799)
FT                   /locus_tag="PMN2A_1744"
FT   CDS_pept        complement(411191..411799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1744"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="Alternative locus ID: NATL2_04451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1744"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59232"
FT                   /db_xref="GOA:Q46LZ9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LZ9"
FT                   /protein_id="AAZ59232.1"
FT                   /translation="MSRYRGPRLRITRRLGDLPGLTRKAAKRSHPPGQHGQARRKRSEY
FT                   AIRLEEKQKLRFNYGISERQLVRYVKKARAQEGSTGTNLLKLLENRLDNVCFRLGFGPT
FT                   IPGSRQLVNHGHVTVNGRITDIASYQCKAGDVIAIRDNKASKQLAQANLEFPGLANVPP
FT                   HLELDKTKLSAKISAKTDREWVAIEINELLVVEYYSRKV"
FT   gene            411891..412130
FT                   /locus_tag="PMN2A_1745"
FT   CDS_pept        411891..412130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1745"
FT                   /product="Protein of unknown function DUF37"
FT                   /note="Alternative locus ID: NATL2_04461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1745"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59233"
FT                   /db_xref="GOA:Q46LZ8"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LZ8"
FT                   /protein_id="AAZ59233.1"
FT                   /translation="MLTKINKAIALVFVSLISFYQKWISPLFGPSCRFIPSCSAYGIEA
FT                   VNKHGPWRGGWLTLKRLSKCHPLTPCGCDPVPEK"
FT   gene            412127..412438
FT                   /locus_tag="PMN2A_1746"
FT   CDS_pept        412127..412438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1746"
FT                   /product="thioredoxin family protein"
FT                   /note="Alternative locus ID: NATL2_04471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1746"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59234"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LZ7"
FT                   /protein_id="AAZ59234.1"
FT                   /translation="MNSDVLILYSRKGCCLCQTLEKKLSRICLDNLNPSIELSIVDIDS
FT                   KTVSLDIQMKYTNEVPVIVLDSTRLLKNIEFPRVSPRLKEDMLLSWIQKNLNILYKKV"
FT   gene            412655..414184
FT                   /locus_tag="PMN2A_1747"
FT   CDS_pept        412655..414184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1747"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Alternative locus ID: NATL2_04481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1747"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59235"
FT                   /db_xref="GOA:Q46LZ6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LZ6"
FT                   /protein_id="AAZ59235.1"
FT                   /translation="MSRYLHTLLKAIDLQVRSGLANPEIKNLSTDSREIEKGDLFLGLD
FT                   GEKVDGGNFWAKAIERGACAAIISKKASLLNPPTNEDPVVILPEPVSLFMGKLAADFWG
FT                   KPSSEICLIGITGTNGKTTTSFLIEFLTTSLGHPSALFGTLINRWPNHEETSKYTTTFA
FT                   VPLQAKLRKAVQAGVEYGAMEVSSHALSQNRVAGCDFNGAVFTNLSRDHLDYHDSMESY
FT                   FEAKASLFRSHLIEDGGPRSVINIDDKWGAKLAKELNKKCWTCSLKENSQTREKADLYI
FT                   SNLQIMQDGYKGKLHTPFGVENFISPLIGEFNLMNMLQAVGILVQRGLPLNDLLAALNK
FT                   FPGVPGRMQLINMDGFKVKEGYPLVIVDYAHTPDGLQNALIASRSLTKRRLICVFGCGG
FT                   DRDKGKRSKMGEVAAKFADYIVVTSDNPRQEDPIEIIKDIGKGITIDSEISVEPERSIA
FT                   IQLAIAKAKKNDVVLIAGKGHEDYQILKDQTIYFDDREQARKALSLKTDFI"
FT   gene            complement(414185..415387)
FT                   /locus_tag="PMN2A_1748"
FT   CDS_pept        complement(414185..415387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1748"
FT                   /product="L-cysteine/cystine lyase-like protein"
FT                   /note="Alternative locus ID: NATL2_04491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1748"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59236"
FT                   /db_xref="GOA:Q46H02"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H02"
FT                   /protein_id="AAZ59236.1"
FT                   /translation="MSPILFKDNMPALQNKAYFNYGGQGPLPTQSLNAITSSWQTIQKL
FT                   GPFTNHVWPYITKEVITTKNLIAEICSIHPKRIAFTENVTSGCVLPLLGLPFSDGDNLL
FT                   LSDCEHPGIVAACKELARKKNLTIAILPVSKLCNGNDKKDETYNSVLKLIDEYLQKNTK
FT                   LVVLSHLLWNTGQIMPIELISKRLKEHSSKPYLLVDAAQSFCHIPSKGACDTADIYAFT
FT                   GHKWAYGPEGLGAVVLSARVLEESSPTLIGWKSLKAEEGIHINNKAPFHSDARRFEIAT
FT                   SCIPLLAGLRSSLAMLKNEGNETERFFKIKSLSCVLWEKLNQIKNIELVLNSPPPSGII
FT                   SFTINGNHSPEEVVNYLGKENLWIRVLEDPKWLRACVHITTDSNEINNLVIGLENFIST
FT                   K"
FT   gene            415532..415693
FT                   /locus_tag="PMN2A_1928"
FT   CDS_pept        415532..415693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1928"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1928"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23864"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC6"
FT                   /protein_id="ABU23864.1"
FT                   /translation="MMVLIFYWFMNIKKEQKIKAQEWVVMFDGQIKKSEKQIDSDEHHL
FT                   EVNNQKSD"
FT   gene            416203..416406
FT                   /locus_tag="PMN2A_1749"
FT   CDS_pept        416203..416406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1749"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1749"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59237"
FT                   /db_xref="GOA:Q46H01"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H01"
FT                   /protein_id="AAZ59237.1"
FT                   /translation="MLIGGIVVLLAGSVAYGVYSTFGSGSKELRDTIDEHAKMHELGIA
FT                   HGHGGSSEAYEMSGKLQKDQIS"
FT   gene            416578..417246
FT                   /locus_tag="PMN2A_1750"
FT   CDS_pept        416578..417246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1750"
FT                   /product="hydrogenase accessory protein or high-affinity
FT                   nickel-transport protein-like protein, membrane protein"
FT                   /note="Alternative locus ID: NATL2_04521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1750"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59238"
FT                   /db_xref="GOA:Q46H00"
FT                   /db_xref="UniProtKB/TrEMBL:Q46H00"
FT                   /protein_id="AAZ59238.1"
FT                   /translation="MLISVLTGFSAGAVHVVSGADHIVAMAPSSVRKPRVALINGLAWG
FT                   IGHSAGVLILSILGILAKDLINIELMSSYAEFLVGISLLIVGGVAIRTSLKVNIHMHQH
FT                   MHGEEATHKHFHFHSLGNKLHRSHTHAATGLGVLHGFAGASHLVAVIPALALPLFGALA
FT                   YLFAYLLGSIFAMGCVVLGISFATSKVNKMFYPFLMRSIGALSIVTGIFWLQKTSILTF
FT                   "
FT   sig_peptide     416578..416637
FT                   /locus_tag="PMN2A_1750"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.633) with cleavage site probability 0.526 at
FT                   residue 20"
FT   gene            417259..417393
FT                   /locus_tag="PMN2A_1929"
FT   CDS_pept        417259..417393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1929"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1929"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23865"
FT                   /db_xref="GOA:A7MDC7"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC7"
FT                   /protein_id="ABU23865.1"
FT                   /translation="MNYTASLFALGGFFLWVVIATLIWARRMRKLKKEYSLNKSKFKN"
FT   gene            417483..417743
FT                   /locus_tag="PMN2A_1751"
FT   CDS_pept        417483..417743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1751"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1751"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59239"
FT                   /db_xref="GOA:Q46GZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ9"
FT                   /protein_id="AAZ59239.1"
FT                   /translation="MKGVLFFLGSIFRWPVQNSKEFLILHVYLLGIYGITFLLRNLGLE
FT                   VSNLIFTVGLMAPIGYLIYNGLPLDCLDYKSAIKRELSSLN"
FT   gene            complement(417771..418016)
FT                   /locus_tag="PMN2A_1752"
FT   CDS_pept        complement(417771..418016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1752"
FT                   /product="NifU-like protein"
FT                   /note="Alternative locus ID: NATL2_04551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1752"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59240"
FT                   /db_xref="GOA:Q46GZ8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ8"
FT                   /protein_id="AAZ59240.1"
FT                   /translation="MSDETLALTTENVEKVLDELRPFLMADGGNVEIAEIDGPIVKVRL
FT                   QGACGSCPSSTMTLKMGIERKLREMIPEVSEVIQVL"
FT   gene            418079..419581
FT                   /locus_tag="PMN2A_1753"
FT   CDS_pept        418079..419581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1753"
FT                   /product="malate:quinone-oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="Alternative locus ID: NATL2_04561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1753"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59241"
FT                   /db_xref="GOA:Q46GZ7"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GZ7"
FT                   /protein_id="AAZ59241.1"
FT                   /translation="MIKILFNTGTPDSENTYDAILVGAGIMSSTLAVLLHELEPDLRLL
FT                   VVEKLSSAGLESSCAKNNAGTGHAANCELNYTPIQEDGHLSTTKAFEINKSFEQSLEFW
FT                   ASLAEKGKLIPKTFLNKLPHISLVFGDEDISLLKKRFSKLSSHAAFAKMEFTMDHGELQ
FT                   DWIPLIMDGRKQSEKIAATRIKRGTDIDFGNLTRSYINQIEGAKSIDINYSTNVENLQQ
FT                   DSEGDWYLSLEGAKKNRIVRSKFVFLGAGGGALSLLQKSRIPEGLLYAGFPVSGKWLIC
FT                   DEEKSTKTHNAKVYGKAAVGAPPMSVPHLDTRWIDKKKSLLFGPFAGFSSNFLKYGSKL
FT                   DLFRSIKTTNLFSMLQAGLDNIDLGKYLLNQLIQTNEDRIDTLKRFLPQVSPNDWKLST
FT                   AGQRVQIIKQTSKGGVLKMGTEVVTSSDGSLAALLGASPGASTAVTIMIEVLNRCWQEK
FT                   MKSSKWKNKMLELFPSIGTDINSDQEALLAIRKRNDFLLKLI"
FT   gene            complement(419606..419725)
FT                   /locus_tag="PMN2A_1930"
FT   CDS_pept        complement(419606..419725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1930"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1930"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23866"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC8"
FT                   /protein_id="ABU23866.1"
FT                   /translation="MVNMSNYAEVPQTRNGHISHTKAIKGARSSSINSTLNKN"
FT   gene            419666..421477
FT                   /locus_tag="PMN2A_1754"
FT   CDS_pept        419666..421477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1754"
FT                   /product="GTP-binding protein LepA"
FT                   /note="Alternative locus ID: NATL2_04581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1754"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59242"
FT                   /db_xref="GOA:Q46GZ6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GZ6"
FT                   /protein_id="AAZ59242.1"
FT                   /translation="MTNVPISRLRNFCIIAHIDHGKSTLADRLLQDTGTVSSRDMQEQF
FT                   LDNMDLERERGITIKLQAARMNYKADDGEEYVLNLIDTPGHVDFSYEVSRSLQACEGAL
FT                   LVVDASQGVEAQTLANVYLALENDLEIIPVLNKVDLPGADPEKIKNEIESIIGLDTSKA
FT                   ISCSAKTGVGIPEILQAVVDRIPSPKDNTDQATKALIFDSYYDPYRGVIVYFRIMSGGI
FT                   SKKDKVLLMSSKKSYELDEIGVMAPDQVKVNSLHAGEVGYLAASIKAVADARVGDTITL
FT                   VDRPAQDALPGYAEAKPMVFCGLFPTDADQYPDLRDALDKLQLSDAALKYEPETSSAMG
FT                   FGFRCGFLGLLHMEIVQERLEREYDLDLIVTAPSVIYKVKMIDGEIRMIDNPATLPDPQ
FT                   KRETIEEPYVRMEIYAPNDYNGTLMGLCQDRRGDFIDMKYITTDRVTLIYEIPLAEVVT
FT                   DFFDQMKSRTKGYASMEYHLIGYRENDLVRLDVLINSERADPLTTIVHKDNAYGVGKGL
FT                   VEKLKELIPKQQFKIPLQASIGSRIIASEGISALRKDVLSKCYGGDISRKKKLLKKQAK
FT                   GKKRMKSMGKVDVPQEAFMAVLKLNKD"
FT   gene            complement(421493..421660)
FT                   /pseudo
FT                   /locus_tag="PMN2A_1931"
FT                   /note="similar to NATL1_04751"
FT   gene            complement(421728..421907)
FT                   /locus_tag="PMN2A_1932"
FT   CDS_pept        complement(421728..421907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1932"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1932"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23867"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDC9"
FT                   /protein_id="ABU23867.1"
FT                   /translation="MPKPNSPLGTISKVINSGTKIEMPIYMDKIISPAKNNRVDKLFRL
FT                   KKPLKFNYQIIRPN"
FT   gene            421759..422610
FT                   /locus_tag="PMN2A_1755"
FT   CDS_pept        421759..422610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1755"
FT                   /product="putative ABC transporter, oligopeptides"
FT                   /note="Alternative locus ID: NATL2_04601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1755"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59243"
FT                   /db_xref="GOA:Q46GZ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ5"
FT                   /protein_id="AAZ59243.1"
FT                   /translation="MRGFLRRNNLSTRLFFAGLIILSIYIGISIFVPLLITLEIVPNGE
FT                   FGLGNPIFSAPSIDHWCGTDRLGRDVCIRTLAASGVALQVVFVAVSLAVLVGIPLGLLS
FT                   GYIGGLVDRVLVLFMDTLYTIPVLLLSVVMAFLLGRGILNASIALCVVYIPQYFRLVRN
FT                   QTSQVKSELYIEAAISMGASPLWVIRKYLLKNVLTSVPVVLTLNAADAVLVLGGLGFLG
FT                   LGLPENIPEWGSDLNMALVALPTGIWWTAIYPGMAMFVLVLGLSFIGEGLEKILSETSL
FT                   QN"
FT   gene            complement(422631..423320)
FT                   /locus_tag="PMN2A_1756"
FT   CDS_pept        complement(422631..423320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1756"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="Alternative locus ID: NATL2_04611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1756"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59244"
FT                   /db_xref="GOA:Q46GZ4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ4"
FT                   /protein_id="AAZ59244.1"
FT                   /translation="MPLLPRRFERIKSVLNRRISDLTVLIENVEKPHNLSAIIRSCDAV
FT                   GVLEAYAIFNKEKFLTFNSTAQGSQKWVKINQYKKTTEAIKVLKEKGFKLYGTNLNPRS
FT                   IDYRKCDFKGPTAFVLGAEKWGISEEASSLMDEHIHIPMRGMVESLNVSVAASALLFEA
FT                   LRQRQVANMVPESGEGMSQETYKEKLFEWAYPEVAQWCKSEGRKYPELNYKGEIIDNLP
FT                   RTEKMRY"
FT   gene            complement(423504..424502)
FT                   /locus_tag="PMN2A_1757"
FT   CDS_pept        complement(423504..424502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1757"
FT                   /product="porin-like protein"
FT                   /note="Alternative locus ID: NATL2_04621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1757"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59245"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ3"
FT                   /protein_id="AAZ59245.1"
FT                   /translation="MKLFSRLLVAPAALGLMAPVAANADTAFSSTTTLSGSAVFTTGSV
FT                   ADGGTADNQEELYMQYAYGLDLNSSFTGEDLFSAGLVAGNASGPLASMDSAESGDLTVT
FT                   SLFYNFPVGDLSVTVGPLVDQDDVVAATTSAYSDAFRLGSMPYSLAGNETGPGVGVAYS
FT                   NDNGVVASVSFVSVGGSDSTVGIGADDGDDVSTFTLGYNGDGFGGGLVIASNDGEAGEG
FT                   YDTFGGGIYYSPESIDATFSVAYDTTDPETGADATDLFIGVDYEVGPGTLSAAYNETDV
FT                   DGGSSDDVTGFEVSYTYAINDSVTITPGFFTVEDNTGDDDSGVVLETVFSF"
FT   sig_peptide     complement(424428..424502)
FT                   /locus_tag="PMN2A_1757"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.914 at
FT                   residue 25"
FT   gene            424727..426043
FT                   /locus_tag="PMN2A_1758"
FT   CDS_pept        424727..426043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1758"
FT                   /product="Fmu, rRNA SAM-dependent methyltransferase"
FT                   /note="Alternative locus ID: NATL2_04631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1758"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59246"
FT                   /db_xref="GOA:Q46GZ2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ2"
FT                   /protein_id="AAZ59246.1"
FT                   /translation="MKGLDARKAAWDVIQAVGGGAFADVALERIFNLYSFKSIDKGLIT
FT                   ELSYGAIRQRYYLDCWIDYLGKVPAKKQPPLLRWLLHLGLYQVLKMKRIPPAAAINTTV
FT                   ELAKTYHLKKLAPVVNGILRSALRSKERGLLLPKSNNPSLELAKNESLPLWLADELIKW
FT                   KGLEDAKKIAKAFNCISPIDIRVNRLRADLKEVKEIFDSCGIHNQAIPNCPYGLEVRAG
FT                   VGEPRKWPGYEEGKWSVQDRSSQLIAPSLGPLPGEKILDACAAPGGKSTHIAELINNEG
FT                   NLWSVDRSSRRSKKILANSERLGTKCLQILVADSNELLLKNPDWKGFFDRILIDAPCSG
FT                   LGTLARHPDARWRMNQDNIQQLVAVQSQLLNSLAPLLKNGGKLVYSTCTIHPEENSHQI
FT                   KNFLQSKSEFLLEYEKQIWPGEGDNGDGFYISVLNKLKN"
FT   gene            complement(426113..427063)
FT                   /locus_tag="PMN2A_1759"
FT   CDS_pept        complement(426113..427063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1759"
FT                   /product="chlorophyll synthase"
FT                   /EC_number="2.5.1.62"
FT                   /note="Alternative locus ID: NATL2_04641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1759"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59247"
FT                   /db_xref="GOA:Q46GZ1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ1"
FT                   /protein_id="AAZ59247.1"
FT                   /translation="MSDARQLLGIKGGSETTNIWKLRLQLMKPITWIPLLWGVICGAAA
FT                   SGNYHWELSNILASISCMFMSGPLLTGYTQTINDYFDREIDAINEPNRPIPSGAISLFQ
FT                   VKCQIWVLLIAGLGVAYLLDLWAHHTIPSVLLLALGGSFVSFIYSAPPLKLKQNGWLGN
FT                   YALGASYIALPWWAGQALFGHLTWTTALLTLAYSLSGLGIAVINDFKSVEGDKSLGLES
FT                   LPVVFGIKNASRISAGMIDIFQLAMVVVLIAIGQHFASVILVLLIIPQITFQDIWLLRD
FT                   PLKFDVKYQASAQPFLILGMLVTAIAIGHSSLISL"
FT   gene            complement(427079..427300)
FT                   /locus_tag="PMN2A_1760"
FT   CDS_pept        complement(427079..427300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1760"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04651"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1760"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59248"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GZ0"
FT                   /protein_id="AAZ59248.1"
FT                   /translation="MAKPTSLSRIGSKIKVNIERVQDRIPSYLIDQLSEDPRGTVIDYK
FT                   MTDGRGGIGVVIKMNDGSKHWFFEDEVS"
FT   gene            427353..428123
FT                   /locus_tag="PMN2A_1761"
FT   CDS_pept        427353..428123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1761"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="Alternative locus ID: NATL2_04661"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1761"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59249"
FT                   /db_xref="GOA:Q46GY9"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GY9"
FT                   /protein_id="AAZ59249.1"
FT                   /translation="MVALRLIPCLDVSNGRVVKGVNFVGLRDAGDPVELGCRYSKAGAD
FT                   ELVFLDITATYEKRSTLVDMVRRTSESVTIPFTVGGGISSLNGINELLRAGADKVSLNS
FT                   SAVKDPSLISKGANRFGSQCIVVAIDAKKNKNIPNKWDVYVSGGRNNTGLDAIEWAEKV
FT                   FEMGAGEILLTSMDGDGTQNGYDIELTKCIADKVPIPVIASGGAGCLRHIKEAFTLGKS
FT                   SAALLASLLHDGQLTIREIKEYLIKENLPIRPIE"
FT   gene            428206..428904
FT                   /locus_tag="PMN2A_1762"
FT   CDS_pept        428206..428904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1762"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Alternative locus ID: NATL2_04671"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1762"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59250"
FT                   /db_xref="GOA:Q46GY8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY8"
FT                   /protein_id="AAZ59250.1"
FT                   /translation="MRPGNTKAIEEMFNSISSKYDFLNDIFSFGLHRFWKTRLLDILNP
FT                   TFGEKWIDLCCGTGDMSILLARYIKSSKNITGIDSASQALVVARERSKQNYSSIEWING
FT                   DALETNLTSHQFDGLLMAYGLRNLSSPYSGLEEAFRILKPGGRAGILDFRSFEGTSIQG
FT                   LFQKIYLSFYVVPISSLFGLGKEYSYIKKSLVNFPSGEKQIHLALSAGFKKAKYQTLAM
FT                   GQMGILLLEA"
FT   gene            complement(428916..429398)
FT                   /locus_tag="PMN2A_1763"
FT   CDS_pept        complement(428916..429398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1763"
FT                   /product="uncharacterized Zn ribbon-containing conserved
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_04681"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1763"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59251"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY7"
FT                   /protein_id="AAZ59251.1"
FT                   /translation="MILEDLKHKKKEKKEQSIYTCLEEIKSSWKGNVGGLIQDWVAIAG
FT                   EQLAFNSTPLNIQNKILTIGASHPQWRQAIQYNRLELIASLKSYGYQIKEIRIRQHYPK
FT                   DLVTRESEKEIWEKHPSRTDKTGITNCPICKVPSPKGEVKLWGKCSFCRRKELRID"
FT   gene            429472..430248
FT                   /locus_tag="PMN2A_1764"
FT   CDS_pept        429472..430248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1764"
FT                   /product="putative chloroplast membrane-associated 30 kD
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_04691"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1764"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59252"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY6"
FT                   /protein_id="AAZ59252.1"
FT                   /translation="MGLFDRLSRLIRANLNAFVSDAEDPIKILDQSVADMQEDLVKLRQ
FT                   AVAMAIASQKRLENQANQAKEQIKNWFTRAELALKKEEDDLAREALSRKKTFQETYESL
FT                   STQFQTQNGQVEKLKKSLLLLERKIAEARTKKDMLKARAQAAKAQEQIQSAVGDLGSKS
FT                   AMAAFERMEDKVEALEASGQAALELAGEDLESKFAALEGGDDIEKELETLRTQLKSGVE
FT                   AIALPPSDLDVNEVKTVEIQEVEVELEEMKKSMDNS"
FT   gene            430364..431041
FT                   /locus_tag="PMN2A_1765"
FT   CDS_pept        430364..431041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1765"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="Alternative locus ID: NATL2_04701"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1765"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59253"
FT                   /db_xref="GOA:Q46GY5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY5"
FT                   /protein_id="AAZ59253.1"
FT                   /translation="MLKTICASTEIELSKWITEKPVKKNQPIAIFSSCQRFGKGQAGRI
FT                   WHAPKGGVWVSAAINREDSCENNSQLYGLAVALALVERIERIGVNVNIKWPNDLLVDGQ
FT                   KLAGILPRLFFRGGKLRLLRVGVGLNVFNNVPQEGISLKQIIGDKTMNINFWSSEVLLA
FT                   IERSLDLLDNKNFLCSQVEQRLWSRKYIDKETGLKWDIKGIDSSGGLNLSKEDKVKVLS
FT                   NYA"
FT   gene            complement(431051..431737)
FT                   /locus_tag="PMN2A_1766"
FT   CDS_pept        complement(431051..431737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1766"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_04711"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1766"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59254"
FT                   /db_xref="GOA:Q46GY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY4"
FT                   /protein_id="AAZ59254.1"
FT                   /translation="MKKSVARLTNINKFYGEGSVKVKALDELNLEVYQGDYLAVMGASG
FT                   SGKSTAMNILGCLDRPTNGTYELNGTAVEKLDDDLLADIRNKELGFVFQQFHLLQEVSA
FT                   LENVMLPMIYACVPSLEREKRAEEALKRVGLGNRMTNLPNQLSGGQQQRVAIARAIINK
FT                   PSLLLADEPTGALDSKTTEDVLNLFDQLHSQGITIVLVTHEDNVAQRAKKIARFRDGKV
FT                   IEITHN"
FT   gene            complement(431751..433313)
FT                   /locus_tag="PMN2A_1767"
FT   CDS_pept        complement(431751..433313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1767"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_04721"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1767"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59255"
FT                   /db_xref="GOA:Q46GY3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GY3"
FT                   /protein_id="AAZ59255.1"
FT                   /translation="MGELLSFQIFINEPVELLNLSLNAKAVLPEAAVLMAMLGTLLVDL
FT                   AGEKISARWSPPICYAGLGSALILLAMQWDGEIQESFLGAFIADNLAIAFRGVIVLSTL
FT                   ISLLISWRYADQNGSPIGEFAAILLAATLGAMLLCGSTDLVSVFVSLETLSVASYLLSG
FT                   YLKRDSRSSEAALKYLLVGSAAAAVFLYGASLLYGISGSTNLKEIGTTLLSAPTPLSAL
FT                   ALVFVLSTVAFKIAAVPFHQWTPDVYEGSPTPVVAFLSVGSKAAGFALAIRILVGCFSA
FT                   FDTQWKLLFTVLAVLSMSLGNVVALAQKSMKRMLAYSSIGQAGFVMIGLVCGTEDGFAA
FT                   MVLYMAAYLFMNLGAFACIILFSIRTGSDQISDYAGLYQKDPLITLGLSLCLLSLGGIP
FT                   PMLGFFGKIYLFFAGWADGQYLLVTVGLVTSVISIYYYISVIKMMVVTEPKEASDVVKA
FT                   YPSIEWSIPGMSSLKVALIFCVLVTAIGGIISNPLFNFADSAVNGTPLLREAITLASKS
FT                   SIG"
FT   gene            433444..436350
FT                   /locus_tag="PMN2A_1768"
FT   CDS_pept        433444..436350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1768"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="Alternative locus ID: NATL2_04731"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1768"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59256"
FT                   /db_xref="GOA:Q46GY2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY2"
FT                   /protein_id="AAZ59256.1"
FT                   /translation="MPTDHTLVIVESPTKAKTIRGFLPKDFQVLASMGHIRDLPNNASE
FT                   IPAKHKGEKWATIGVNTTADFDPLYVVPKDKKKIVKELKQSLKGASELLLATDEDREGE
FT                   SISWHLMNVLDPKIPVKRMVFHEITKEAISKALSKTRAIDMELVHAQETRRILDRLVGY
FT                   TLSPLLWKKVSWGLSAGRVQSVAVRLLVLRERARRAFKSGSYWDLKAKLEKEGSEFEVK
FT                   MTSIGGKRIATGSDFDESTGLLKSGRNVILLKEEESKELAQKLTTDKWKVVNVEEKPSI
FT                   RKPVPPFTTSTLQQEANRKLRLSARETMRCAQGLYERGFITYMRTDSVHLSDQAINASR
FT                   NCVESKYGVEYLSKKPRQFSNKTRNAQEAHEAIRPSGESFKTPKESNLQGRDLSLYELI
FT                   WKRTVASQMADARLTMLGVELKASDVSFRASGKRIDFPGFFRAYVEGTDDPDSALEGQE
FT                   VLLPKLEVGDSPTAKNVEALGHQTQPPARYSEASLVKTLEKEGIGRPSTYASIIGTIVD
FT                   RGYSVLNNNSLTPSFTAFAVTALLEEHFPDLVDTSFTARMESTLDEISTGKVSWLPYLK
FT                   GFYKGDTGLENQVQQREGDIDGGEFRAVSLEGLSSLVRLGKFGTYLESKQLGENGKPIT
FT                   ATLPQEITPADLDEDIAEMILKQKAEGPESLGVDPDSGQNLYLLNGRYGHFVQRGLVVE
FT                   LKDLGIPKGKKKLGNLRLFKSSQYGLYLKQDSSKVQLLLPENIKEEEIDVEKALEYLDD
FT                   KSLKKAPNPKRTSLPKSLKPEDLTFEEALGLIQLPRLLGEHPEGGRIQSSLGRFGPYVV
FT                   WSKNGGEKDYRSIKGDDDVLQVSLERALELLSIPKRGRGGRTALKELGIPEGEKETIQL
FT                   FDGPYGLYVKQGKVNASLPEGKTAEDITIEVAIELLAAKKSSKKTTSKKRKSTQKTTKS
FT                   TKKDLNSSASKKSSTQKAPSTTKTGRLRASKVRVIKTK"
FT   gene            436355..436843
FT                   /locus_tag="PMN2A_1769"
FT   CDS_pept        436355..436843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1769"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04741"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1769"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59257"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY1"
FT                   /protein_id="AAZ59257.1"
FT                   /translation="MNITRLVEKIFIRSFLIVTFFALQSCSNTLIGEKLESSFDSMEKP
FT                   RTPEKTNIKPQKPDEKTKIKSIPKDDKKENKNAFANTVKENSISNKDRLSKKITKSKKK
FT                   TIFNPQPYRIILRLSGANPSAPAETVTEALRTAGVQFEVEKIERFDEEDLSKDSSFKR"
FT   gene            436849..437535
FT                   /locus_tag="PMN2A_1770"
FT   CDS_pept        436849..437535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1770"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="Alternative locus ID: NATL2_04751"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1770"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59258"
FT                   /db_xref="GOA:Q46GY0"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GY0"
FT                   /protein_id="AAZ59258.1"
FT                   /translation="MNLDNKNSLKSRSLYKAPLSKRQALKIVESSYLAAATALIWIALY
FT                   YLPIGGAVFRLALPLPLALLQIRRGVKTGIEGVTICVMLLTVLMGPLRGPLVLFPYGLL
FT                   SLWLGYCWEKGWNWWLSWSVGVSIGTMGFLVRVFVLSLLVGENLWVILTRAGAGLLEKG
FT                   IDIFNLSFTPDMRQVQIVALCLIITQEIIYVLCLHALAYWIFPRLKSSIPEPPALLEKL
FT                   ISLESN"
FT   gene            437542..438738
FT                   /locus_tag="PMN2A_1771"
FT   CDS_pept        437542..438738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1771"
FT                   /product="Protein of unknown function DUF102"
FT                   /note="Alternative locus ID: NATL2_04761"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1771"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59259"
FT                   /db_xref="GOA:Q46GX9"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX9"
FT                   /protein_id="AAZ59259.1"
FT                   /translation="MTGDNYVLLPSRVLAFGEGLHEQNVEERVQRWQENITNMAFFLIL
FT                   AGSQTAEIEGISAAGSTAVSRRYTAVADAELLLRGPNVPKKWPLPPLPAGVSPALISYV
FT                   ASSFLKIKPTIISAGLLQTPPFTHVSLEPPEIGPARCLSSGNAMERARVKLLFEGGYEI
FT                   GKKLKKSLLLTECVPGGTSTAFAVLSGLGINVNGLISGSHRNPPSELKIKLVKQGLEAA
FT                   RLKKNPSSVELMAAVGDPFQPIAVGLLMGARESGQEILLGGGCQMLAVLALALNEIEPE
FT                   SRSEFVGKILIGTTSWLVDESLSSSENRNSFIHLMNHVANHFKVNILGLASGYRFNDSK
FT                   QKVLRDYEIGYVKEGVGAGALSLLAQIKGLTQKEMIQRCDIEVSNLFKFDNEKTCQGI"
FT   gene            438744..439745
FT                   /locus_tag="PMN2A_1772"
FT   CDS_pept        438744..439745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1772"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04771"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1772"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59260"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX8"
FT                   /protein_id="AAZ59260.1"
FT                   /translation="MNTNTLGRREFIKYGLSSSLVLLSGCSTSQKKLALRGVTNSFPSE
FT                   FVNSLSNGWEFFPIKDIEFKKSPYNSALNEKTDLLVLNDGWISDLPINSLQEIKANNIR
FT                   NNFSKQTSAFLDGLGKDYKNKLFPLAVSPWVILFRNEDSLALNNKNSWEVVFSSSLTKQ
FT                   IVFPKSPYLLISIAQKIDLVNDFSKIKSQAHSFDDMNALNWVVSGRANAAVLPLSSCVD
FT                   SLVKDPRLSVLLPQEGSPLNWTVLASPSASLESFPTDWFNSLWSSTYLRRVISKGFLPP
FT                   TNFLDLRRKNINVPKRYQSIFLPEESVWNKCWSLPILSFQEKKELALNWNNS"
FT   sig_peptide     438744..438839
FT                   /locus_tag="PMN2A_1772"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.501 at
FT                   residue 32"
FT   gene            439830..440483
FT                   /locus_tag="PMN2A_1773"
FT   CDS_pept        439830..440483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1773"
FT                   /product="Lumazine-binding protein"
FT                   /note="Alternative locus ID: NATL2_04781"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1773"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59261"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX7"
FT                   /protein_id="AAZ59261.1"
FT                   /translation="MFTGLIQAIGTIKKNNLGVIVDGCNPFSPLKLGDSVSVDGVCLTV
FT                   SELMNDSFFSNISEETLKRTNLAEKAQKNGYVNLEPALRLSDRLGGHIVSGHIDGLGKV
FT                   VSIENLKNSWNLRVSWDDLNFCRYMCDKASISLNGISLTIAEIYVDGCEFSVAVIPHTW
FT                   SNTCLKFLKIGEKVNLEVDLMAKYAEKLLKVNNNDSISKQSPVINSQWLSEQGW"
FT   gene            complement(440529..440885)
FT                   /locus_tag="PMN2A_1774"
FT   CDS_pept        complement(440529..440885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1774"
FT                   /product="transcriptional regulator AbrB"
FT                   /note="Alternative locus ID: NATL2_04791"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1774"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59262"
FT                   /db_xref="GOA:Q46GX6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX6"
FT                   /protein_id="AAZ59262.1"
FT                   /translation="MLVGKELLDKARSLSDRPEDEIAKGCGYVGPSGRVLRKSFYRALV
FT                   EAKGYKLRSNGPGRAGNRSSRGRQAEFRTKVHGNGNLLIGHAYTKKLGLEPGQEFRIDV
FT                   RKESGAISLLPLKK"
FT   gene            complement(440981..441586)
FT                   /locus_tag="PMN2A_1775"
FT   CDS_pept        complement(440981..441586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1775"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="Alternative locus ID: NATL2_04801"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1775"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59263"
FT                   /db_xref="GOA:Q46GX5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX5"
FT                   /protein_id="AAZ59263.1"
FT                   /translation="MTSIVPKEQSSGSKNELSTEEHEDFRLFGLIAFLIADGMTFAGFF
FT                   AAYLTFKAVNPIGPDAIYELELPLPTLNTILLLVSSFTFHRAGKFLEKNESKLCQKWLL
FT                   ITGVLGVAFLISQMFEYFTLPFGLTDNLFASTFYALTGFHGLHVTLGSIMIMIIWWQTR
FT                   VPSGRVNNQNKFPFEAVELYWHFVDGIWVVLFIILYLL"
FT   gene            complement(441583..443223)
FT                   /locus_tag="PMN2A_1776"
FT   CDS_pept        complement(441583..443223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1776"
FT                   /product="cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="Alternative locus ID: NATL2_04811"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1776"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59264"
FT                   /db_xref="GOA:Q46GX4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX4"
FT                   /protein_id="AAZ59264.1"
FT                   /translation="MTISLKPNNSSPEKLQPTGWLKYLSFSLDHKVIGLQYLVCGFLFY
FT                   LIGGSLAGAIRVELISPLSDFMPREVYNQVLTLHGTIMIFLWIVPVVNGAFGNYLIPFY
FT                   VGARDMAFPRLNAVAFWLIPPSGLMLITSYFINGAAQSGWTAYPPLSITTPAAGQIIWI
FT                   LSVLLLGGSSIFGGINFIATILKLRRPGLKLMQLPMYCWAMLGTSILVVLSTPVLAGTL
FT                   ILLSFDIVAHTGFFNPSLGGNVIVYQHLFWFYSHPAVYIMVLPAFGLVSEILPIHSRKP
FT                   LFGYTTMVFSIMGIVVLGLVVWAHHMFTSGTPPWMRLFFTIATAFIAVPTGIKFFNWVA
FT                   TLWGGKISLNAAMLFSCGFIINFVLGGITGVALAQVPFDVHVHDTYFVVAHFHYIVYGG
FT                   SVFVIFSSIYHWFPKFTGKMLNENLGRFHFIITFIGFNLCFAPQHWLGLNGMPRRVAEY
FT                   DPQFQLINQISSVGALLMALSTLPFLWNILQSSLFGEEAGDNPWNALTPEWLTSSPPPV
FT                   ENWDGEAPLVLEPYGYGKKDSNETQEAIR"
FT   gene            complement(443228..444040)
FT                   /locus_tag="PMN2A_1777"
FT   CDS_pept        complement(443228..444040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1777"
FT                   /product="putative cytochrome c oxidase, subunit II"
FT                   /note="Alternative locus ID: NATL2_04821"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1777"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59265"
FT                   /db_xref="GOA:Q46GX3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX3"
FT                   /protein_id="AAZ59265.1"
FT                   /translation="MPKLSAILTLTTSLILGIAGVWVAYNVDMLPVSASMNAPVYDELY
FT                   RVLFIIGAILFIGMTALVIYSLIQFRRRPGETGDGVNLEGNISLEIFWTAVPAIVVLFV
FT                   GLYSYDIYDRMGGMQPLMHDHSGQMDNQAERVWGGIGSGPIESSSKKNSSSLPIELTAM
FT                   QFAFIFHYPKGDIISGELHVPVGREVSLKMESKDVIHAFWVPQFRLKQDVIPGQPTILN
FT                   FTPTKAGNFPIVCAELCGPYHGGMRSNVIVDEQEDFDTWLKENSKESI"
FT   sig_peptide     complement(443969..444040)
FT                   /locus_tag="PMN2A_1777"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.609 at
FT                   residue 24"
FT   gene            444224..445150
FT                   /locus_tag="PMN2A_1778"
FT   CDS_pept        444224..445150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1778"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /note="Alternative locus ID: NATL2_04831"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1778"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59266"
FT                   /db_xref="GOA:Q46GX2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX2"
FT                   /protein_id="AAZ59266.1"
FT                   /translation="MQFFYPPKPLFRFGQLAAHVVVALIALVVIGGATRVMEAGLACPD
FT                   WPLCYGSFLPGRQMNLQVFLEWFHRLDAFFVGIVLITQFAFSLYWAKTLPKWLPWIYGF
FT                   LTFLVSLQGFLGALTVLQLLPSLVVMAHLVVAFTLVAIMSGVTQQLLNPGKSIFPTWLR
FT                   CFGFLSLFAVIAQSLLGSRVATSWAAQRCLDFGESCNLLGLHRVSAIPVSFLVILFVIV
FT                   SSLQRDVFIKQWPYLLTIIFLIISQILLGAFSIHLRMSEPSLIIGHQLIACLLVAVIAA
FT                   LNFKGRGNDDSSQSLYINQSTLETCHG"
FT   gene            445143..446138
FT                   /locus_tag="PMN2A_1779"
FT   CDS_pept        445143..446138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1779"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="Alternative locus ID: NATL2_04841"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1779"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59267"
FT                   /db_xref="GOA:Q46GX1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GX1"
FT                   /protein_id="AAZ59267.1"
FT                   /translation="MVSSTSELITQPVNREEVVPSRKRIKLPAWLEVVKPRLIPLLLAT
FT                   TVGGMALSEEWPLPSPRLACTLGGGALAAAAAGALNCLWEQDLDKRMKRTSNRALPSGR
FT                   LSQSSVFIGAVACTLVSSALLVSGVNCLAAGLTLLGLCSYVLLYTAFLKPRTSQNIVFG
FT                   GVAGAIPPLVGASAAAGHIGLGGWWLFSLVMVWTPAHFWALAILLKEDYRSVGIPMLPT
FT                   VSGPFVTAKAISVYGYLTVFLSFLGCFVLPEGGLLYGILLLPYNSRLLQLVSRLRDNPE
FT                   DLDRAKGLFRWSILYMFGVCFLLVISRLQVSIVFNDQLIALIKDFSTGFS"
FT   gene            446240..447253
FT                   /locus_tag="PMN2A_1780"
FT   CDS_pept        446240..447253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1780"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_04851"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1780"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59268"
FT                   /db_xref="GOA:Q46GX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GX0"
FT                   /protein_id="AAZ59268.1"
FT                   /translation="MFFIKLRDLFKSYGPVMALNGLNLEVPKGSLYGLLGPNGAGKSTA
FT                   LRIICTLLSPDSGHVEVGGHNVLFEEKETRRRLGYVAQDVAIDKILTGRELLELQGDLY
FT                   HLDKKYKRRRIEELIERLDMHEWIDRRCGSFSGGMKRRLDLSSGLLHEPELLILDEPTV
FT                   GLDIESRSVIWGLLKELRNKETTILLSSHYLEEVDELADEMAIIDKGKVIASGKPDDLK
FT                   KELGGDRVTLRVREFSDEVEAESVKKLIKNINGVSNVVVNQTQGYSLNFLVQSNDVISN
FT                   LSGHLSKENFEVFALSHSRPSLDDVYLQATGKTLMDAELELAGKRDFKLENKKSMR"
FT   gene            447285..448139
FT                   /locus_tag="PMN2A_1781"
FT   CDS_pept        447285..448139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1781"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="Alternative locus ID: NATL2_04861"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1781"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59269"
FT                   /db_xref="GOA:Q46GW9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GW9"
FT                   /protein_id="AAZ59269.1"
FT                   /translation="MITTNPSLQKEKQSRNDLNEMSQEISALTWRLFIQLIRRPSTLFA
FT                   GILQPLIWLLLFAALFSKAPIDFLPGSSSYGEFLGAGLIVFTAFSGALNAGLPLMFDRE
FT                   FGFLNRLLVAPLSSRSSIVISSVIYITSISLLQSFAIMATSALLGYGWPSLGGFLLIAI
FT                   TLLLLVFAITGLSLGLAFVLPGHIELIAIIFIANLPVLFASTALAPISFMPEWLGWIAS
FT                   INPLTFAIEPIRMAYHSSVDLRAILIEAPYGEVNGYSCLAILLILTVGLFFLIRPLLNR
FT                   KLA"
FT   gene            448169..448645
FT                   /locus_tag="PMN2A_1782"
FT   CDS_pept        448169..448645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1782"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04871"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1782"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59270"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GW8"
FT                   /protein_id="AAZ59270.1"
FT                   /translation="METRKYQLQKQIVEALKANDNDLYSLLKSQWAHRFGVDSLEELKS
FT                   LDLEQLNQTPSDVDNQTIDQSKEDSFEGEKETSIKDDDNQSKEIINKEVDESVKDENDK
FT                   SFTITSYSIADKENDEDKTINQYKDSRSHPEIKALIPLPPKPKYSYLKKWLLRK"
FT   gene            complement(448710..450392)
FT                   /locus_tag="PMN2A_1783"
FT   CDS_pept        complement(448710..450392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1783"
FT                   /product="chaperonin Cpn60/TCP-1"
FT                   /note="Alternative locus ID: NATL2_04881"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1783"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59271"
FT                   /db_xref="GOA:Q46GW7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GW7"
FT                   /protein_id="AAZ59271.1"
FT                   /translation="MAKLLSFSDESRGALEKGVNNLANALKVTIGPKGRNVVIEKKFGA
FT                   PDIVNDGVTIAKEIDLEDPFENIGAKLIEQVASKTKEKAGDGTTTATVLAQFMVQEGLR
FT                   NTAAGASPIELRRGMEKAVAQIVDDLKKKSKSVSGDAIKQVATVSAGGDEEIGSMIADA
FT                   IDKVSFDGVITVEESKSLATELDITEGMAFDRGYSSPYFVTDEDRLICEFENPSILITD
FT                   KKISSIADLIPVLETVQKNGTPLIILAEEVEGEALATLVVNKNRGVLQVAAVRAPSFGE
FT                   RRKAALGDIAVLTGGTLISEDKAMSLEKVQISDLGQARRVTITKDSTTIVANEAQNTEL
FT                   SNRIASIKRELEETDSEYDQEKLNERIAKLAGGVAVIKVGAPTETELKNRKLRIEDALN
FT                   ATRAAIEEGIVAGGGTTLLELSEGLGDLAKKLEGDQKTGVEIIKRALTAPTKQIAINAG
FT                   FNGDVVVSDIKRLGKGFNAQTGEYEDLLEAGILDASKVIRLALQDAVSIASLLITTEVV
FT                   IADKPEPPSAPGAEGGDPMGGMGGMGGMGGMGGMGGMGMPGMM"
FT   gene            450521..450697
FT                   /locus_tag="PMN2A_1784"
FT   CDS_pept        450521..450697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1784"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04891"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1784"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59272"
FT                   /db_xref="GOA:Q46GW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GW6"
FT                   /protein_id="AAZ59272.1"
FT                   /translation="MNDPGALFFILMAGLAGTMTLIYFPLRIFLTATARSRRLKLLQRI
FT                   RRLRDELGQPLQN"
FT   gene            complement(450705..451457)
FT                   /locus_tag="PMN2A_1785"
FT   CDS_pept        complement(450705..451457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1785"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Alternative locus ID: NATL2_04901"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1785"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59273"
FT                   /db_xref="GOA:Q46GW5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GW5"
FT                   /protein_id="AAZ59273.1"
FT                   /translation="MTLSKLLEGQTAIVTGASRGIGKAIAIFLAKEGAEVIINYSSSLE
FT                   NANKVVSEINSFGGKAYPLQADISNENSVNELIKTVLEKNNKIDVLVNNAGITKDGLLM
FT                   RMKTDDWQKVLDLNLSGVFYCTRAVSRQMLKQKKGRIINITSVVGLMGNPGQANYSAAK
FT                   AGVVGLTQSAAKEFASRGITVNAVAPGFISTDMTKDLNSESILSAIPLGRFGNPEDVAG
FT                   AVKFLAADPSASYITGQVIQVDGGMVMS"
FT   gene            451617..452294
FT                   /locus_tag="PMN2A_1786"
FT   CDS_pept        451617..452294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1786"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /note="Alternative locus ID: NATL2_04911"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1786"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59274"
FT                   /db_xref="GOA:Q46GW4"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GW4"
FT                   /protein_id="AAZ59274.1"
FT                   /translation="MHLLIAAAGSGSRMGADRNKLLLKVAGKTVLEWTLKAAFEAKTIS
FT                   WIGIIGQPKDKNPICSILDNSVKAVQWINGGSTRQQSVQLGLAALPNDAKSVLIHDGAR
FT                   CLVRSFVFDEISKIVSKGQSVIAASQVTDTIKKVDIDGEIIESPPRSDLWAAQTPQGFP
FT                   VNKLKHAHSEAISKGWNVTDDASLFERLGLPVKIYDAGPSNIKVTTPFDLVIAESLLST
FT                   LKD"
FT   gene            complement(452278..453153)
FT                   /locus_tag="PMN2A_1787"
FT   CDS_pept        complement(452278..453153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1787"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_04921"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1787"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59275"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GW3"
FT                   /protein_id="AAZ59275.1"
FT                   /translation="MTEPIKKGDYFHIVAASSPITKKEDLHSGIKVLQEWGLICNHFDE
FT                   IDRSWGYLAGNDEVRFNELHPSNHYPLLAFARGGWGSARLLEKQQPWKEGWMIGFSDLT
FT                   SILLARLASGFQGGIHGPLITTLGSEPDWSKDRLKSILFGNCVPDIYGEPWGGGISKGR
FT                   LIVGNLTVLTHLIGTEHLPSFKKSILIIEDIGEAPYRIDRMLTHLRLAGVLHQLSGLGF
FT                   GSFTSCDDEKDVDKSKTFKLLEIFKDRTQDLKIPIVSSLPIGHCCGNASLPLGSQAILN
FT                   GDKGSLSLLK"
FT   gene            complement(453179..454045)
FT                   /locus_tag="PMN2A_1788"
FT   CDS_pept        complement(453179..454045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1788"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Alternative locus ID: NATL2_04931"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1788"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59276"
FT                   /db_xref="GOA:Q46LZ5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LZ5"
FT                   /protein_id="AAZ59276.1"
FT                   /translation="MGYYFQLLRWNKPSGRLILLIPSGWSLWLTPAAPPSLLILGIIIL
FT                   GGLFVSGAGCIANDIWDRKFDKKVIRTKERPLANGKVSLKAAWILLILMLFFSLFIVLS
FT                   IPQDSRNLCLLLSSLSLPFILLYPSAKRWFQYPQLILSICWGFSVLIPWAASESSLAGG
FT                   VTLLFCWLATILWTFGFDTVYAMADESEDKVIGLNSSAISLGGKSLKTVSLCYFLTCIF
FT                   LALAAFKANLGLIYWPFWLITTLGMQREVFLLSSKSKGIKTSGLHFSNQVRLGSLLLLG
FT                   MVFSKII"
FT   gene            454155..455789
FT                   /locus_tag="PMN2A_1789"
FT   CDS_pept        454155..455789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1789"
FT                   /product="putative exopolyphosphatase"
FT                   /note="Alternative locus ID: NATL2_04941"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1789"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59277"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LZ4"
FT                   /protein_id="AAZ59277.1"
FT                   /translation="MLGDSINNSSERNSIELDLGEKEDAELCRVATIDIGTNSTHLLIA
FT                   KIERKLNTFSIELAEKSTTRLGERDPQTGELTSLAMNRAFSTLKRFKDLSESYKVESLI
FT                   IAATSAVREAPNGKIFIAEIKKKIGLDVELISGAEEARLIYLGVLSGMQFGNKPHLVLD
FT                   IGGGSTELILADSSEARALTSTKIGAVRLQREFIKKDPISSQNELFLRSFIRGSMESAI
FT                   DKVSKRIEAGEIPVLVATSGTAMAIGSLISNKENHMQSKLQGYKITKNNLDIIVSQLIK
FT                   MTPSERSQLSSLSERRSEIIVPGALILQTIMNMVDVNEIILSERALREGLVVDWMCRNN
FT                   YLKDQLSFQGSIRERTVIHQAKRFGVNSKRSKSVSEFALTFYDQTKGILHNDNGGGRDL
FT                   LWAAAKLHACGKQINISAYHKHSWYLIKNGELLGYSQSEHLMVAAIARYHRKSFPKKRH
FT                   ESWQLLVNESQRSLVADMSLLLRLSCSLDRRPEPLVSKIVIEANNKVVNIELIPNNLGQ
FT                   NLDLEKWSLNKAILLVKKIMDVDINIL"
FT   gene            complement(455786..456283)
FT                   /locus_tag="PMN2A_1790"
FT   CDS_pept        complement(455786..456283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1790"
FT                   /product="putative Uncharacterized protein conserved in
FT                   bacteria"
FT                   /note="Alternative locus ID: NATL2_04951"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1790"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59278"
FT                   /db_xref="GOA:Q46LZ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LZ3"
FT                   /protein_id="AAZ59278.1"
FT                   /translation="MEKSEERKSGNSHVANKKSSLRTVGEFLREARQGRNLSVEDLSSS
FT                   LRIGKEQLIALETGDESALPEKVFIRAMVRRIAEKLNLDTSFILEELNEKKKNEPKPSP
FT                   VIKKKNTRKNKNFNPFIIVILSGALGLFTSIMLLKYIQKGQNDSFNPKRSDIFLLDKKI
FT                   SS"
FT   gene            complement(456401..457153)
FT                   /locus_tag="PMN2A_1791"
FT   CDS_pept        complement(456401..457153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1791"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="Alternative locus ID: NATL2_04961"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1791"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59279"
FT                   /db_xref="GOA:Q46LZ2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LZ2"
FT                   /protein_id="AAZ59279.1"
FT                   /translation="MNPISIVGAGPGALDLMTIRAQQRLKSADVLVWTDSLIPIQITKL
FT                   VKDDCEKIKTSSLTLEEILLILIKKHKEGKKIVRLHDGDPCLYGAISEQICRLNDEGIE
FT                   VEVVPGVSAYQATAATLGFELTVPDLTQTIILSRADGRTGKPKRESLQKLASIQSSLCL
FT                   YLSARHVEEVQSILIKYYPANTPVAIAYRVTWPDEWIKVIPLTEMAKTSQEQNLIRTTL
FT                   YIISPTLKIGNNRSKLYNPTHSHLFRSS"
FT   gene            complement(457150..458061)
FT                   /locus_tag="PMN2A_1792"
FT   CDS_pept        complement(457150..458061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1792"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="Alternative locus ID: NATL2_04971"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1792"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59280"
FT                   /db_xref="GOA:Q46LZ1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LZ1"
FT                   /protein_id="AAZ59280.1"
FT                   /translation="MEHIFLALRSPGPELFQLGPFSLRWYGLLIAISVLVGLNLSSELA
FT                   SKKGLKKSLINDLLPILVLASVIGARIYYVAFEWRNYTGKNFWSSINFLNLNIPIPSAL
FT                   EIWGGGIAIHGALIMGTLSIIFFCRWRQEHFWDVIDVLVPSVALGQAIGRWGNFFNNEA
FT                   FGIPTNLPWKLFIPYRFRPEIFSTIDYFHPTFLYESVWNIFVFGILIFLFRKANKKDLK
FT                   LPPGSLSCLYLITYSLGRFWIEGLRTDPLCLGGVPPFCEGGLRIAQLISLFLISAGLLG
FT                   IWRIYVSKKALPDPSSMNGRNQ"
FT   gene            complement(458075..459040)
FT                   /locus_tag="PMN2A_1793"
FT   CDS_pept        complement(458075..459040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1793"
FT                   /product="apocytochrome F"
FT                   /note="Alternative locus ID: NATL2_04981"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1793"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59281"
FT                   /db_xref="GOA:Q46GW2"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GW2"
FT                   /protein_id="AAZ59281.1"
FT                   /translation="MKKNFYTISKTMSRSLKLILFSVFIGFSIFLIPQPTWAYPFWAQQ
FT                   KFENPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEIGADGSK
FT                   VPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGVYFTQYSEEQENIILVGPLPGDQNRE
FT                   IVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTITSIET
FT                   NEDGSQIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKLTEDPNVGGFGQLDKEIV
FT                   LQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI"
FT   sig_peptide     complement(458924..459040)
FT                   /locus_tag="PMN2A_1793"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 39"
FT   gene            complement(459048..459584)
FT                   /locus_tag="PMN2A_1794"
FT   CDS_pept        complement(459048..459584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1794"
FT                   /product="cytochrome b6/f complex subunit (rieske
FT                   iron-sulfur protein)"
FT                   /note="Alternative locus ID: NATL2_04991"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1794"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59282"
FT                   /db_xref="GOA:Q46GW1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GW1"
FT                   /protein_id="AAZ59282.1"
FT                   /translation="MTQMTTADVPSMGRRQFMNLLTFGTVTGVALGALYPVAQYFTPYR
FT                   AGGGGGGTNAKDELGNNVSASGWLSTHPVGDRSLVQGLKGDPTYLIVEGEDAITSYGIN
FT                   AICTHLGCVVPWNSGANKYMCPCHGSQYDSTGKVVRGPAPLSLAIAHVSIEDDQVLVSQ
FT                   WTETDFRTGTDPWWG"
FT   gene            459668..460030
FT                   /locus_tag="PMN2A_1795"
FT   CDS_pept        459668..460030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1795"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1795"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59283"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GW0"
FT                   /protein_id="AAZ59283.1"
FT                   /translation="MSFKSNELNTGSFPSPIPLEVDEVVGCLRRRWGVTYDLKLLIKKD
FT                   RIYLQMMWGFLEQQSFPLDEETFRENLNRTLEIINRAGQSGFVRNWLENVQAKPRLGRA
FT                   ITLPLPMDQRMDEFVL"
FT   gene            complement(459996..460715)
FT                   /locus_tag="PMN2A_1796"
FT   CDS_pept        complement(459996..460715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1796"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="Alternative locus ID: NATL2_05011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1796"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59284"
FT                   /db_xref="GOA:Q46GV9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV9"
FT                   /protein_id="AAZ59284.1"
FT                   /translation="MPLVDHLEELRQRILKSLIAVLLSSGFCLLFVRKLVQALEMPAGK
FT                   IQFLQVAPGEFLFTSIKVAGYGGLTLSLPFILFQFLKFILPGLTKKEKLLIAPSVAGSA
FT                   ILFFLGIFFAWKALIPAALGFLVSYGADVVEPLWSIEKYLDFVLLLMLSTGLAFQLPIL
FT                   QLILGFLEIISWKKMLSAWRLVVMASAVAGAVLTPSTDPITMLLLSTSITFLFFVGIGL
FT                   VALTTNLKGQIRPSFDP"
FT   gene            complement(460947..461198)
FT                   /locus_tag="PMN2A_1797"
FT   CDS_pept        complement(460947..461198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1797"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1797"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59285"
FT                   /db_xref="GOA:Q46GV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV8"
FT                   /protein_id="AAZ59285.1"
FT                   /translation="MIDFLLGTHEFLGNHTFPEFLIGYLFGAALIIGAPTVFLLLAFTS
FT                   ALMKTNGKMGGYKEYASYGESSLNDCPPFILPDPTKNK"
FT   gene            complement(461240..462943)
FT                   /locus_tag="PMN2A_1798"
FT   CDS_pept        complement(461240..462943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1798"
FT                   /product="RNA-binding protein"
FT                   /note="Alternative locus ID: NATL2_05031"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1798"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59286"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV7"
FT                   /protein_id="AAZ59286.1"
FT                   /translation="MNTVPIQIMDLTTLKAVVFELSQEIVPSRFETAQQIDSHTIQLGL
FT                   RTLEKLTWIEISWLPESPIIVSIPPPKKYGEKSTLAKQIKHLLVNLALVDITQIGFERI
FT                   VRFKFSSRPGKEIEKELIVELMGRHSNILLLDRSGKVITLGKQIKESQSRLRPIGTGDI
FT                   YTSPPPLKGLVPVLSEPFNSWKENICLVPSTFKNSLKDTYQGISPALTLQIVSSDYNES
FT                   LKIINKPVTSIELETWEAIYKRWKEWLLDLENSNYTINFEGPTDYIVWGKKESTAKNKK
FT                   IGLSLSIYYSNKIVERKINSIREKLKQDLANSKGHEKRKLDVQELLIKNISEYTTMQNK
FT                   AKSLLTLPSPTKKQIIEAQSLFKEAKRKKRSRESIVNRINFHKKKISDIQCCESFIDSF
FT                   LYEENEDNKNKLESIIELKEEVEEYICIKKNNSKFKLKRKKETSLHIKEIQSPSGLKIQ
FT                   IGGNNRQNELISLKKGKKGDLWFHAQEIPGSHVVLKSSDGIVDETDIQLAADLASFFSR
FT                   ARGNKLTPIIMVPIENLKRISGSLPGTVSHRGGKVLWGKAERAAKYFHHK"
FT   gene            463012..463572
FT                   /locus_tag="PMN2A_1799"
FT   CDS_pept        463012..463572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1799"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Alternative locus ID: NATL2_05041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1799"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59287"
FT                   /db_xref="GOA:Q46GV6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GV6"
FT                   /protein_id="AAZ59287.1"
FT                   /translation="MSSLGNLTVLTGPSGVGKGTIVRKILESHSDVWLSISATTRQPRS
FT                   GEIDGEHYFFLEKKQFQEIIDKDGFLEWASFSNNFYGTPKKIVKEKIEKGTNVLLEIEL
FT                   EGARQIRKSFPEAFQIFLAPPNLYELEKRIRGRGTETEESIRDRLSIAEKELIAQKEFD
FT                   AVVINEDIEKAFKEIEGFMGLKL"
FT   gene            complement(463596..463733)
FT                   /locus_tag="PMN2A_1800"
FT   CDS_pept        complement(463596..463733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1800"
FT                   /product="photosystem I reaction centre subunit IX PsaJ"
FT                   /note="Alternative locus ID: NATL2_05051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1800"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59288"
FT                   /db_xref="GOA:Q46GV5"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GV5"
FT                   /protein_id="AAZ59288.1"
FT                   /translation="MFQLFRTKWFRSAPVVATIWITLTAGIIVEFNRFVPDLLFHPMSF
FT                   "
FT   gene            complement(463781..464338)
FT                   /locus_tag="PMN2A_1801"
FT   CDS_pept        complement(463781..464338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1801"
FT                   /product="photosystem I PsaF protein (subunit III)"
FT                   /note="Alternative locus ID: NATL2_05061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1801"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59289"
FT                   /db_xref="GOA:Q46GV4"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV4"
FT                   /protein_id="AAZ59289.1"
FT                   /translation="MSRLLSIFLSAFLFLGIAPIANARPGPALNADRAPTDFTASALVS
FT                   CADNPRFQERASTASTDQAIKRFERYSKALCGDDGLPHLIIGPPIEPWGAWINRGHEGD
FT                   LLIPGVMFIYIAGIIGWSGREYVRAVRGKKNAAEYEIIIDTSLAWQCLKRGAAWPLQAN
FT                   REGKNGELRAKDNNVSLNGPRG"
FT   sig_peptide     complement(464267..464338)
FT                   /locus_tag="PMN2A_1801"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            464412..465482
FT                   /locus_tag="PMN2A_1802"
FT   CDS_pept        464412..465482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1802"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Alternative locus ID: NATL2_05071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1802"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59290"
FT                   /db_xref="GOA:Q46GV3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GV3"
FT                   /protein_id="AAZ59290.1"
FT                   /translation="MSIILSLETSCDESAAALVSNEKGKIDLLANEIASQIDEHANWGG
FT                   VVPEIASRRHLENLPFLIEEVFAKSKLQIKDIDAVAATVTPGLAGSLLVGSITARTLAN
FT                   LHQIPFLGIHHLEGHLSSIYLSEKHPKPPFLVLLVSGGHTELIKVDVKHKYQRLGRSHD
FT                   DAAGEAFDKVARLLGLSYPGGPAIQKIAKSGDPKKFLFPKGRVSKPEGGFYPYDFSFSG
FT                   LKTAVFRQIEKIRSENKKLPIEDIAASFEYIVAEVLVERSFKCALDQGLNSLVLVGGVA
FT                   ANVRLREMMLAKASENSIDITLAPMEFCTDNAAMIGAAALLRLSSESFKSSMELGVSAR
FT                   WPLEKSDLLYDPIPPF"
FT   gene            465512..465694
FT                   /locus_tag="PMN2A_1803"
FT   CDS_pept        465512..465694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1803"
FT                   /product="high light inducible protein hli9"
FT                   /note="Alternative locus ID: NATL2_05081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1803"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59291"
FT                   /db_xref="GOA:Q46GV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV2"
FT                   /protein_id="AAZ59291.1"
FT                   /translation="MSLKEIDEENKSTKLASSNELNSWKRGFTPQAEIWNGRMAIAGLI
FT                   IVLIILLASNLFFSG"
FT   gene            465738..466259
FT                   /locus_tag="PMN2A_1804"
FT   CDS_pept        465738..466259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1804"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1804"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59292"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV1"
FT                   /protein_id="AAZ59292.1"
FT                   /translation="MSFCLFSECRSYRWILKRELLSGKKTILFIGLNPSKANSSHNDRT
FT                   LMRIINFSSSWNYKNIYIINLFGLISKSPLQLSKSNDPIGENNDLITLKSLEFWRENNN
FT                   CDLWLGWGDKGQLNGRDLKVLKLIKNFSNFKSNENNYSKRVLSLGLSKKGNPRHPLYMP
FT                   NHSFLRRFDL"
FT   gene            466430..467674
FT                   /locus_tag="PMN2A_1805"
FT   CDS_pept        466430..467674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1805"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="Alternative locus ID: NATL2_05101; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1805"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59293"
FT                   /db_xref="GOA:Q46GV0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GV0"
FT                   /protein_id="AAZ59293.1"
FT                   /translation="MTPERLGLLWGITVFSGAGARLLSVLTGLPGVVLLLLSGLLIGRS
FT                   GLGLVEPLDLGKGLETIVGLLVSLVLFDGGLNLRFPGGAIKSIVLRISSIRLIISLAAG
FT                   FFAAHWFAGLGWSVAGVYSAIVLATGPTVVTPLVRQIRLASPLSDVLEAEGLILEPIGA
FT                   VLALLLLELVVGDLHGWRELFLGLLSRLGGGVLIGSLAGLFLSEGLKRLRSEPYIGIRL
FT                   QLTLGVVFLLYGVCEWLLPESGLPASVAAGFVVGQRPSTQANELDKLIRELAQLAITML
FT                   FPLLAADVSWGELSPLGWGGITCVLFLMIIVRPIAVSIATFGLPLDNKQRLFLGWLAPR
FT                   GIVTAAVASLFSIRLEQAGVLGAGKLQGLVFLTILMTVGIQGLTAQPLAKMLGLLDEDK
FT                   DLDKPTNSGSIFTES"
FT   gene            complement(467630..469060)
FT                   /locus_tag="PMN2A_1806"
FT   CDS_pept        complement(467630..469060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1806"
FT                   /product="glutamyl-tRNA synthetase / glutamate--tRNA(Gln)
FT                   ligase"
FT                   /EC_number="6.1.1.17"
FT                   /EC_number="6.1.1.24"
FT                   /note="Alternative locus ID: NATL2_05111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1806"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59294"
FT                   /db_xref="GOA:Q46GU9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GU9"
FT                   /protein_id="AAZ59294.1"
FT                   /translation="MKVRVRLAPSPTGTLHLGTARTALFNWLFAKKEGGTFLLRIEDTD
FT                   IERSREEYINDIYDGLQWLGINWDESPTIQSERVNEHKQIIKTLVDKGFAYKCYASEAE
FT                   LDEMRETQKRNGLAPKYDNRHRNLTPEQESEFIKSGRDPVIRFKISDEKLISWNDLIRG
FT                   KMTWSGKDLGGDMVIARRAPANSIGDPLYNLVVVADDSAMKISHVIRGEDHLANTAKQI
FT                   LLYEALDLNIPVFAHTPLILNSEGKKLSKRDGVTSISEFKKMGYTSEAMANYMTLLGWS
FT                   VPEGINERFNISEVSEIFSFKKVNKASAKFDWDKLNWLNSQVIHEMSAETLLENLEPLF
FT                   KENGWHLPSHEWGINLVGLIGPSMVLINDGVDQAKPFFEEQELSEDGKKQLEIKEAAVI
FT                   LKFILEKLEDTDAASFSKEKALDLINQATKSCEVKKGLVMKSLRAALFGTLNGPDLIQS
FT                   WVLLSRFSKDRARISRLI"
FT   gene            complement(469082..469155)
FT                   /locus_tag="PMN2A_R0043"
FT   tRNA            complement(469082..469155)
FT                   /locus_tag="PMN2A_R0043"
FT                   /product="tRNA-Asp"
FT   gene            complement(469357..469545)
FT                   /locus_tag="PMN2A_1807"
FT   CDS_pept        complement(469357..469545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1807"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1807"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59295"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU8"
FT                   /protein_id="AAZ59295.1"
FT                   /translation="MELDLQPGDVVKVLESAALGWVRARVIRVKSGGRVVVQSDQGREF
FT                   TARGNQVRLIEPAGFRP"
FT   gene            complement(469581..469653)
FT                   /locus_tag="PMN2A_R0044"
FT   tRNA            complement(469581..469653)
FT                   /locus_tag="PMN2A_R0044"
FT                   /product="tRNA-Trp"
FT   gene            complement(469713..470201)
FT                   /locus_tag="PMN2A_1808"
FT   CDS_pept        complement(469713..470201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1808"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="Alternative locus ID: NATL2_05131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1808"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59296"
FT                   /db_xref="GOA:Q46GU7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GU7"
FT                   /protein_id="AAZ59296.1"
FT                   /translation="MSVDSKEPSSQEVKIEDESNASEDSEVKTASETKSKGKKISIQNL
FT                   SPAEIIKTFEDAQLGKDLPDVYVGDTVRVGVRISEGNKERVQPYEGVVIAKRHGGIHQT
FT                   ITVRRIFQGIGVERIFLVHSPQVASIKVERRGKVRRAKLFYLRERVGKATRVKQRFDR"
FT   gene            complement(470411..470542)
FT                   /locus_tag="PMN2A_1933"
FT   CDS_pept        complement(470411..470542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1933"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1933"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23868"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDD0"
FT                   /protein_id="ABU23868.1"
FT                   /translation="MSFQKKEDQRKDSLFSKKVKTSKFAIIDDLIIDKLSNEEGQFH"
FT   gene            470503..471342
FT                   /locus_tag="PMN2A_1809"
FT   CDS_pept        470503..471342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1809"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="Alternative locus ID: NATL2_05151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1809"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59297"
FT                   /db_xref="GOA:Q46GU6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU6"
FT                   /protein_id="AAZ59297.1"
FT                   /translation="MNLFSDLLSSENSKIPINNGPVIKQRRGVEIKSSREIEIMRKSSK
FT                   IVATVLSEIRDLVKPGMSTLDLDNYAEKRIRDHDAKPSFKGYHGFPGSICSSINNEVVH
FT                   GIPSKKKIINDGDLLKVDTGAFYNGYHGDSCITICVGNTSDKANELSRVAREALMLGIK
FT                   QIRPQNKLLDIAGAIEDYVKANGFSVVEDYTGHGVGRNLHEEPSVFNFRTNDLPNVTLR
FT                   EGMTIAVEPIINLGSKHCKTLSDGWTVITKDGNLSAQWEHTVLVTKNGCEILTDRGD"
FT   gene            complement(471345..472109)
FT                   /locus_tag="PMN2A_1810"
FT   CDS_pept        complement(471345..472109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1810"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1810"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59298"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU5"
FT                   /protein_id="AAZ59298.1"
FT                   /translation="MKKSLSDKSRFKGLKIAITGANGSLGKSLIEVLKKEGAYLIGLTH
FT                   DKKNDSNSEGGKPDEWILWSCGKERLLSSILANIDILILNHGFNPKGMIESNEINKALE
FT                   INSLSHLRLIEIFEDLALSNNLNKYNSKEIWVNTSEAEIQIAFSPVYEITKRLIGELIS
FT                   LKKSKLLMEKRNSFIIKKLILGPFKSKLNPQGIMSPEFVAKKIVQKAKKEDYLVIVSPN
FT                   PITHLIMPLVESIRILYSRFINKIYSNATPLK"
FT   gene            472260..473351
FT                   /locus_tag="PMN2A_1811"
FT   CDS_pept        472260..473351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1811"
FT                   /product="bioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /note="Alternative locus ID: NATL2_05171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1811"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59299"
FT                   /db_xref="GOA:Q46GU4"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU4"
FT                   /protein_id="AAZ59299.1"
FT                   /translation="MSKTFLIGSCEPFSGKSALVLGIARNLIASNHMVRFGKPLATSLE
FT                   LNVSERGDIQDMIDDDVRFVGETLQLSPENLIPSIQFLAASTANERIQKNILDPGGGVD
FT                   EFQLSLNSSGEAINILEAAGSLHEGLLYGLSLPQLAKGLKAKVLLAHFWQDSRSVEALL
FT                   EAKNQLGDHLSGVILNAVNPDQIKDIKENIVPSLKALGLEIFGVMPRSPLLRSVTVEEL
FT                   VRRLNARVICCSDRLELMVETLSIGAMSVNSAMEFFRRRRNMAVVTGADRTDIQLAALE
FT                   ASTQCLILTGAGEPLPQLINRSEELDVPLLKVDRDTLSTVEVIEQAFGHVRLHETVKAT
FT                   YAFRLVQEHCDLDRIFKTLGISS"
FT   gene            473392..473910
FT                   /locus_tag="PMN2A_1812"
FT   CDS_pept        473392..473910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1812"
FT                   /product="cyanobacteria-specific protein"
FT                   /note="Alternative locus ID: NATL2_05181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1812"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59300"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU3"
FT                   /protein_id="AAZ59300.1"
FT                   /translation="MSLSRSLDLPALGRVDTLAQELALLKNEGKRRIAFLGSRHVPVVS
FT                   IHIVELIARSLAQEGHSIITSGSQGVNAAVIRAVLDVNPSLLTVLLPQSLDRQTAEVKD
FT                   LLGSVLHLIEKEDNNDLPLPMASSLCNQEIINRCDQLICFAFHDSETLLSSCHSAEDMG
FT                   KVVSLMFFD"
FT   gene            474036..474533
FT                   /locus_tag="PMN2A_1813"
FT   CDS_pept        474036..474533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1813"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1813"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59301"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GU2"
FT                   /protein_id="AAZ59301.1"
FT                   /translation="MPSSYSFDVVSEFDQQELVNAIDQLRREVDQRYDLKDSKTKIDIK
FT                   EDELSIVSLSDMTIESVKDILLQKATKRNLSLKIFDFQKIETIGGNMVMQIVKLKKGLS
FT                   QEISKKLSKLVRDNMKKVTASIQGDSLRITGKNKDDLQAAINLIKKQEEEFDIALQFQN
FT                   YR"
FT   gene            474575..474769
FT                   /locus_tag="PMN2A_1814"
FT   CDS_pept        474575..474769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1814"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1814"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59302"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU1"
FT                   /protein_id="AAZ59302.1"
FT                   /translation="MDSLIKKLSKKAIDLSGKSKKELERTCWMIVHEYKHGAMPTEYDI
FT                   REIDEELYLQVLSVAKEMI"
FT   gene            474908..475711
FT                   /locus_tag="PMN2A_1815"
FT   CDS_pept        474908..475711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1815"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="Alternative locus ID: NATL2_05211"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1815"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59303"
FT                   /db_xref="GOA:Q46GU0"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GU0"
FT                   /protein_id="AAZ59303.1"
FT                   /translation="MTTPFRNVTPNGPGGTTTLLLVLSFTGFLLLTQAFFVVPAGQVSV
FT                   VTTLGKVSGGSRKPGLNFKVPFVQNTYPFNVQTQVRPEKFDSLTKDLQVISATATVKYA
FT                   LKPNEAGRVFKTISYNDREIYNRIIQPSLLKALKSVFSKYELVTIASSWSDISELVEDT
FT                   VAEELNKFDYVDVQSLDLTGLTIADEYRAAIEQKQIAEQQLLRAQTEVKIAEQEALRYD
FT                   TLNKSLDDQVLFKLFLDKWNGETQVVPSLPGNGSGNVPVIVRGKN"
FT   gene            complement(475771..477069)
FT                   /locus_tag="PMN2A_1816"
FT   CDS_pept        complement(475771..477069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1816"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="Alternative locus ID: NATL2_05221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1816"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59304"
FT                   /db_xref="GOA:Q46GT9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GT9"
FT                   /protein_id="AAZ59304.1"
FT                   /translation="MTDALNTKRSEEIFGAAKNLMPGGVSSPVRAFKSVEGDPIVFDRV
FT                   KGPYAWDVDGNRYIDYVGSWGPAICGHAHPEVIAALQETLEKGTSFGAPCVLENQLAEM
FT                   VIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFLVKAGSGV
FT                   ATLGLPDSPGVPRSTTANTLTAPYNDLEAVKELFAENPDAISGVILEPVVGNAGFITPE
FT                   PGFLEGLREVTQENGALLVFDEVMTGFRISYGGAQERFGVTPDLTTMGKVIGGGLPVGA
FT                   YGGRKEIMSMVSPSGPMYQAGTLSGNPLAMTAGIKTLELLKQEGTYEKLEAITKKLLDG
FT                   ILTAAKESNIPIYGQSISAMFGFYLCEGPVRNFEEAKSSDTELFSKIHRLMLQKGVYLA
FT                   PSAFEAGFTSLAHSEDDINATIKAFKEIFSEMS"
FT   gene            complement(477340..478167)
FT                   /locus_tag="PMN2A_1817"
FT   CDS_pept        complement(477340..478167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1817"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="Alternative locus ID: NATL2_05231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1817"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59305"
FT                   /db_xref="GOA:Q46GT8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT8"
FT                   /protein_id="AAZ59305.1"
FT                   /translation="MLVATWNVNSIRSRIDHVKEWLITNKIDILCLQETKTEDKFFPIE
FT                   IFSDLGYEVSISGQKSYNGVAIISRFPINDIKIGFNEVTNDYQDLSILSEQKRIISADI
FT                   NDIRIINVYVPNGSSINSDKFIYKKKWLKCLQVYLREINKNNTPICLLGDFNIAPEDRD
FT                   IHTPSRYEESIMASSKERELLKDALGGELEDVFRIFEPGEKNWSWWDYRHSAWERDKGW
FT                   RIDHIYLTEDILSCANSCWIDKEQRSREKPSDHAPVVVDINWPPSDIENEFFF"
FT   gene            478226..478561
FT                   /locus_tag="PMN2A_1818"
FT   CDS_pept        478226..478561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1818"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1818"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59306"
FT                   /db_xref="GOA:Q46GT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT7"
FT                   /protein_id="AAZ59306.1"
FT                   /translation="MKQTARFINGQLWFALSCLAPILITVGQVFSPSKTIRISELKNYS
FT                   TDEKRDIYSTFDTEDQIDQGLPIDPFDLMNRLKQAGAMNNATTPSDALDAALNAFDQSE
FT                   DENIPNE"
FT   gene            478631..479278
FT                   /locus_tag="PMN2A_1819"
FT   CDS_pept        478631..479278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1819"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1819"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59307"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT6"
FT                   /protein_id="AAZ59307.1"
FT                   /translation="MQNHPIPSVTDPLQYRAIGLVRGIYKPQDEDTFTRGALIDSKGNE
FT                   IDSVVLGRVITLIKNHVPLEKTHLWVVYPRCRNNQNLHLQITGIWEPSTLKKDLLDSEG
FT                   LNENSGLKGDSDSLLEGDDYFSIRGELIFTKPEEKNVVIKIRQKPRNQQKKALPFKLNL
FT                   KGEVPINYLKHFISLNVRRIDYQLLIEDFQIIGPLSKQQINNKSKKILKNKN"
FT   gene            479344..480567
FT                   /locus_tag="PMN2A_1820"
FT   CDS_pept        479344..480567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1820"
FT                   /product="Protein of unknown function DUF111"
FT                   /note="Alternative locus ID: NATL2_05261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1820"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59308"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT5"
FT                   /protein_id="AAZ59308.1"
FT                   /translation="MKSIFIDCSLGISGDMLASALFDLGVPHSIFLDNLVSLNIDKNYK
FT                   LKFEAGDSDGIKGIVCKKNEIQFKELSRSLNEIKNLLLDSSLNDYVKKKSIKVFEILAE
FT                   AEAVVHGNQISDVHFHELGSIDSILDIVNVCSAIDFLKPYKIYFSNPPSGKGIVSTSHG
FT                   PMPVPVPTVLEIARQNEIPLMVLDDKYFGEITTPTGIALIATFIDKFGQPSNLNIQNIG
FT                   IGLGSKNISRPNFLRILLIDENDYYMENNKPSNENIISQEAWIDDSTPEDVAVLIDRLR
FT                   SAGAIDVICYSVDMKKNRKGICIQAIVYPKHKNLLREVWFNYSTTIGIRENNISRWILP
FT                   RRIVSHKTKFGTVNVKQVMRPNGQTSIKIEHKDLTRITLNTGIPIEEIRQKLIIELSEF
FT                   YEIDDWSF"
FT   gene            480567..481532
FT                   /locus_tag="PMN2A_1821"
FT   CDS_pept        480567..481532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1821"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1821"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59309"
FT                   /db_xref="GOA:Q46GT4"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT4"
FT                   /protein_id="AAZ59309.1"
FT                   /translation="MINFIMNEIIRRNFVFGMISKINIKFLITLICFAFLGNSIYGNFD
FT                   SLSNQTITSEEISWLLWGVIFSFFSIIINAYAWKLLINNIGCSISNLNIIQLFLATNIY
FT                   KYLPGGIWHFVSRYKNLRLELSNEKSIESILLEPILMLVAGFIFIPFRGFNLPIYILCW
FT                   SSTLLFLPTFRQSLIKKLRTMKASIFTNNVNIKDRDLAKNSQNISTSLFYPYKPLFVEI
FT                   IFIFFRFIGFLCCVNAFSIGSLVSHGELISSFSLAWIIGLVVPAAPGGLGVFESVILFS
FT                   LSSHLPEAPLLASLLCYRLVSTVSDILAALIYPVKKLFKV"
FT   gene            complement(481542..483128)
FT                   /locus_tag="PMN2A_1822"
FT   CDS_pept        complement(481542..483128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1822"
FT                   /product="ABC-type Fe3+ transport system permease
FT                   component"
FT                   /note="Alternative locus ID: NATL2_05281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1822"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59310"
FT                   /db_xref="GOA:Q46GT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT3"
FT                   /protein_id="AAZ59310.1"
FT                   /translation="MNNNRPASKAFKIEKNINFVYNLIGLNNSRYILKYLVVLLTFFIL
FT                   WPLFNLVKEGLYGIQKGSIYLTTANLNEIKGTLLLLIFSLTLGGFLGVTNGWILANCHF
FT                   KGRKVLKVCQLIPFATPAYLLAATFIDLGSIYSIRITGMLWGVVIMAFTTYPYVFLLSS
FT                   ESFEEGGRKQIEACRTLGIGPWKSFFRISLPIAIPSITAGLALMAMEIINELGAVQLLN
FT                   IPSISAGILESWIEKGEPSGAIALALFALILVFLLVAIERKSREKSKRWIDGISSVDAP
FT                   KWELKGINLFLAQVVTFTPPILTLGIPITWAIINIDQINQGFNIDLVGLTIRSFSLALA
FT                   VSLITIFISLILSISKRWHNHQWLNILTFLSSIGYAIPGSVLALSLLSFKGSILQVNIL
FT                   SLLIWGYSIRFLAVSKGGLDAGFERISPNIDNAAINLGKNWSEVLFKIHLPLLKGPILV
FT                   GILLVFVDTIKELPLTFILRPFDFDTLSVRIFQYAGDERLAESILPSLIIICLGLIASL
FT                   ALIPSLNNRNK"
FT   gene            complement(483156..484190)
FT                   /locus_tag="PMN2A_1823"
FT   CDS_pept        complement(483156..484190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1823"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1823"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59311"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT2"
FT                   /protein_id="AAZ59311.1"
FT                   /translation="MNASVSNLNKNMVSKKNIPITIISGFLGSGKTTLLNHILTNQQGI
FT                   KTAVLVNEFGEIGIDNELIIKTEEEMIELSNGCICCSINGELVEAIEKLINVNKKLDYI
FT                   IIETTGLADPLPVAMTLLGSDLRDQTRLDSIITLIDAENFNDVALESSIGRSQVIYGDI
FT                   LLLNKCDLVTNKNIEETIDKLKEIKNDVRILKSIKGNIPLNLLLSVGLFETDLINQKES
FT                   VHDHSHEHKHGHGHGHGHGHGHSEEDNRIEDFLSVSFQTKEPFSLRKFQYFLDNQLKSD
FT                   VFRAKGILWFSESERRHVFHLAGKRISIEDSEWGEERNNQLVFIGKELDKTKILSQLNA
FT                   CIDK"
FT   gene            complement(484216..484521)
FT                   /locus_tag="PMN2A_1824"
FT   CDS_pept        complement(484216..484521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1824"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="Alternative locus ID: NATL2_05301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1824"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59312"
FT                   /db_xref="GOA:Q46GT1"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GT1"
FT                   /protein_id="AAZ59312.1"
FT                   /translation="MKYEKLMVSLIEKNQLDSFIEKNPSWIIDNKTIKKEFKFENFIEA
FT                   FGFMSKVALLSEKIDHHPDWQNIYNKVKINLTTHDKGGITTNDIKLAEAIDKLINS"
FT   gene            complement(484523..484984)
FT                   /locus_tag="PMN2A_1825"
FT   CDS_pept        complement(484523..484984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1825"
FT                   /product="Protein of unknown function UPF0047"
FT                   /note="Alternative locus ID: NATL2_05311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1825"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59313"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GT0"
FT                   /protein_id="AAZ59313.1"
FT                   /translation="MEQILSTIDFETKGQGFTDITKNINHWIKYKKLKKGILLIFLKHT
FT                   SCSLIINENADINVLKDLSAYMNAIVPEEGVYPLNKNLKKIEYLHSEEGLDDMPAHIRT
FT                   MLTSNNLSFSVVDGKLEIGLWQAIYIWEHRASNKSRSLQLHAIGDFDLN"
FT   gene            485214..486743
FT                   /locus_tag="PMN2A_1826"
FT   CDS_pept        485214..486743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1826"
FT                   /product="thermostable carboxypeptidase 1"
FT                   /EC_number="3.4.17.19"
FT                   /note="Alternative locus ID: NATL2_05321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1826"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59314"
FT                   /db_xref="GOA:Q46GS9"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS9"
FT                   /protein_id="AAZ59314.1"
FT                   /translation="MSKSAWQLLGDYLKDTQLLGSIQSTLYWDQNTSMPIAGSNWRGEQ
FT                   LSLIAKQLHARQSSEQFEILIKEAKSELQNSKEKDDFESQLITDRFRNIDLLEQDFNRQ
FT                   KSLDPQLVVELATAKSEGYMCWQEARKNNDFKSFSPALKKLIALRTEQSNQLCEERSCW
FT                   ETLAQPFEPNLTIDRVSELFEPLQKRLPELIQKAETITNKKSEKWDLAISDQEKLCQIL
FT                   LNDWSRDPANTAIAKSPHPFSITLGPDDYRITTRIVKGQPLSCLLATAHEWGHSLYEQG
FT                   LPSKSHQWFAWPLGQATSMAVHESQSLFWENRIARSFSFAKSFWHHFENAGAPIHSGDD
FT                   LWINLNPFTPGLNRVEADELSYGLHIMIRTELEIDLLERGLSVEDLPNEWNKRYLHLLG
FT                   VSPKNDTEGCLQDVHWSEGMFGYFPSYLLGHLISAQLTKTLEEDLGKIENLIESTEISK
FT                   ILGWLRKNVHHYGRSLDSEELVRKVTGAKLSPTYFLEYLDNKLEKLSTISK"
FT   gene            486871..487458
FT                   /locus_tag="PMN2A_1827"
FT   CDS_pept        486871..487458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1827"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="Alternative locus ID: NATL2_05331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1827"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59315"
FT                   /db_xref="GOA:Q46GS8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS8"
FT                   /protein_id="AAZ59315.1"
FT                   /translation="MANLDQAPSRTMPNLLHILPAFANESELRVNTIVELNSNTINKYE
FT                   LITETGHLKLDRVGYSSLAYPFAYGCLPRTWDEDGDPLDIEIVNVTEPLVPGSIVEARI
FT                   IGIMTFDDGGEVDDKVIGVIADDKRMDHIQSFEQLGKHWINETTYYWEHYKDLKKPGTC
FT                   TVNGFFGVEKAVQIIKSCEERYLSAIDPNLIN"
FT   gene            complement(487473..488420)
FT                   /locus_tag="PMN2A_1828"
FT   CDS_pept        complement(487473..488420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1828"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Alternative locus ID: NATL2_05341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1828"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59316"
FT                   /db_xref="GOA:Q46GS7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GS7"
FT                   /protein_id="AAZ59316.1"
FT                   /translation="MTLDQLRIASRRSQLAMVQTNWVRDELQREHPDLVITIEAMATQG
FT                   DKILDVALAKIGDKGLFTKELEAQMLLGHAEIAVHSLKDLPTNLPDGLILGCITKREDP
FT                   SDALVVNEKNQIHKLETLPEGSVVGTSSLRRLAQLRYHYPHLVFKDVRGNVITRLEKLD
FT                   SGEYDCLILAAAGLQRLGFANRIHQLIPTDISLHAVGQGALGIECVSGQQKVLDILKTL
FT                   EHESTSKRCLAERSFLRELEGGCQVPIGVRTEINNNELILEGMVASLDGKRLIRDIKKG
FT                   SVSSAEEIGIDLANELKGRGAGEILEEIFKSARA"
FT   gene            complement(488580..489842)
FT                   /locus_tag="PMN2A_1829"
FT   CDS_pept        complement(488580..489842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1829"
FT                   /product="sigma-70 factor"
FT                   /note="Alternative locus ID: NATL2_05351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1829"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59317"
FT                   /db_xref="GOA:Q46GS6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS6"
FT                   /protein_id="AAZ59317.1"
FT                   /translation="MLKEKQTSKNISINQDPKNNSKKIKKTAAKLNVTKETQTLPQESS
FT                   NDLKIDLDLEADKLIAEANKVPEADIDLDDDDDNASVLSSAQEAAAKALASIKIGPKGV
FT                   YTEDSIRVYLQEIGRIRLLRPDEEIELARKIADLLQLEEEAAQFESENGHFPSVKEWAV
FT                   LADMPLARFRRRLMLGRRAKEKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRA
FT                   AEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPVHLYETISRIKKTTKVLSQEF
FT                   GRKPTEEEIAESMEMTIEKLRFIAKSAQLPISLETPIGKEEDSRLGDFIEADIENPEQD
FT                   VAKTLLREDLEGVLATLSPRERDVLRLRYGLDDGRMKTLEEIGQIFDVTRERIRQIEAK
FT                   ALRKLRHPNRNGVLKEYIKLN"
FT   gene            490069..490218
FT                   /locus_tag="PMN2A_1934"
FT   CDS_pept        490069..490218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1934"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1934"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23869"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDD1"
FT                   /protein_id="ABU23869.1"
FT                   /translation="MYKQGGQGISQTGLSQNWIFPILDKASSLPSGWNFASSTTALKLF
FT                   TIQW"
FT   gene            490255..492498
FT                   /locus_tag="PMN2A_1830"
FT   CDS_pept        490255..492498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1830"
FT                   /product="replication restart DNA helicase PriA"
FT                   /note="Alternative locus ID: NATL2_05371"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1830"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59318"
FT                   /db_xref="GOA:Q46GS5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS5"
FT                   /protein_id="AAZ59318.1"
FT                   /translation="MNSFIFDIWLHVGREGRCFSYQDGNNLDIDLGDVVTVRLKGQRMQ
FT                   GLVVKKMKKNITSTHQNLNNFSLNNVETLVQKAAITKEWREWLEEIALDLYVSDFQMLK
FT                   TALPPGWLGRSKLSNRPKKLWWVKLSSNNYEGKISSRQIELKKNLLLNGGGKWQKDLEA
FT                   EGFSSVLIRNFVSVGCGEREKRLYLFNSFDNEESNDKKMLKIEEPQPLTLEQKSAKEKY
FT                   ESLPDGSALLLWGVTGSGKTEVYLQIAAHELSESRHCLILTPEIGLVPQLVDRFRKRFG
FT                   LNVFEYHSNCSTKEKIETWKRALDNTKPSVFIGTRSAIFLPLSSLGLIVLDEEHDSSFK
FT                   QESPMPCYHARELAIHRAKKTGAKVILGTATPSLNVWKNLKPNGNVVVAKLTKRISNRK
FT                   LPTVSVVDMREELALGNRSLISRYLKKQLLSIKESGNQAIVLVPRRGYSSFLSCRSCGE
FT                   VVQCPHCDIALTVHRSKEGNQWLRCHWCDFRSNISDKCGECGSNAFKPFGTGTQRVMDH
FT                   LERELEGISLLRFDRDTTRGRDGHRLLLERFANGDADILVGTQMLSKGMDLPKVTLAVV
FT                   LAADGLLYRPDLMATEETLQLFMQLAGRAGRGEQPGKVVVQTYCPDHPVILHLIDGSYE
FT                   EFLKKEEKTRKEASMVPYSRACLLRFSGESSELASHGAFDVLSKIKDACSQKGWKLVGP
FT                   APSLVERVAGKSRWQLLLYGPELSHIPLPYGPELWKDLPKGVTLSIDPDPLQL"
FT   gene            complement(492512..493603)
FT                   /locus_tag="PMN2A_1831"
FT   CDS_pept        complement(492512..493603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1831"
FT                   /product="uncharacterized membrane protein"
FT                   /note="Alternative locus ID: NATL2_05381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1831"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59319"
FT                   /db_xref="GOA:Q46GS4"
FT                   /db_xref="InterPro:IPR021499"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS4"
FT                   /protein_id="AAZ59319.1"
FT                   /translation="MSNIASAIKATEAALEKGDYGICIKIIDPLLLDFQAETEIGGQLR
FT                   LLIVTAYMGKGDEQKAINICQTLIHNKDESVRQQAKQLLSILDAPRLPKPSNWSVEIPN
FT                   LEMEPSLKSSVSKAKKKREKIYHPPTGPTKSLDFGFSIITLLVILLITFLLSGCVDIST
FT                   NLSVTGPDRLKISLDIDSNSGESIPWQMAFEENLSKKHSILKLQTHEDKQHFESPTIRF
FT                   EEVNKLLQEIVLVASKASGFSINKPEIITNNKNWIIGTSQNFKIYFDLREIPKIPGLKI
FT                   NIVINGIGNKNNFKTKPLEPTFNQGLTSFPLEIGQINQLEISNWKWNQISVGIILIIAL
FT                   TLLSLSLQRLRLQMGFGFPELPP"
FT   gene            complement(493604..494518)
FT                   /locus_tag="PMN2A_1832"
FT   CDS_pept        complement(493604..494518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1832"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="Alternative locus ID: NATL2_05391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1832"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59320"
FT                   /db_xref="GOA:Q46GS3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GS3"
FT                   /protein_id="AAZ59320.1"
FT                   /translation="MNKEIQQAKHSKNINKPFTDKDSIRVSVLSEALPYIQRFANKRIV
FT                   IKYGGSAMADKTLQNAVFRDLALLSSVGVQIVVVHGGGPEINQWLEKLGIKPVFLDGLR
FT                   ITDTETMDVVEMVLTGRVNKQIVSGINNHGRLAVGLCGIDGGLIEARTLGGGSHGLVGE
FT                   VAKVNTKILSPLLEEGYVPVISSVANSSDGKSHNINADTVAGELAAALGAEKLILLTDT
FT                   PGILRNENDPSSLIEKIRLSEARELIDKGIVKAGMKPKVECCIRSLAQGVNAAHIIDGR
FT                   TPHSLLLEVFTDAGIGTMVMGRG"
FT   gene            complement(494511..495074)
FT                   /locus_tag="PMN2A_1833"
FT   CDS_pept        complement(494511..495074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1833"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1833"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59321"
FT                   /db_xref="GOA:Q46GS2"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS2"
FT                   /protein_id="AAZ59321.1"
FT                   /translation="MNKLLSPASLITIGGASLSLIGLTAYFTDATNLSVPTFFYGVPIF
FT                   LIGISLKTTEVPPALRVVPTTKFASERDRAPEELGKLVKDVTRWRYGQSCQLESSLRVL
FT                   KLWDIDNPPQLLEVEELVKEGNYGIRMRFEMAAVSLERWNAQKERLGRFFAKGLCAELF
FT                   CPTPGAIDLILLPQKQEDNPQENE"
FT   sig_peptide     complement(495006..495074)
FT                   /locus_tag="PMN2A_1833"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.370 at
FT                   residue 23"
FT   gene            495129..495320
FT                   /locus_tag="PMN2A_1834"
FT   CDS_pept        495129..495320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1834"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1834"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59322"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LZ0"
FT                   /protein_id="AAZ59322.1"
FT                   /translation="MASHQKQFSELTDLVEKLNKDRAWILEQLDKGCWPEFRPDLAALE
FT                   RELGQLLTRAAEYIEENG"
FT   gene            complement(495326..495763)
FT                   /locus_tag="PMN2A_1835"
FT   CDS_pept        complement(495326..495763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1835"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="Alternative locus ID: NATL2_05421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1835"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59323"
FT                   /db_xref="GOA:Q46LY9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY9"
FT                   /protein_id="AAZ59323.1"
FT                   /translation="MNHCMLEVLVKKAPTVRFTQDNKTPLAELEVEFDSLRADDPPCAI
FT                   KVVGWGKLAEELQNKVQVNTKLVIEGRLRMNTVPRQDGTKEKQAEFTLSRIHPFSSKTP
FT                   LPSIPSQTQSNIKSNSANPLNNEGVKWDSSPLIPDTDDIPF"
FT   gene            495795..496604
FT                   /locus_tag="PMN2A_1836"
FT   CDS_pept        495795..496604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1836"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="Alternative locus ID: NATL2_05431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1836"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59324"
FT                   /db_xref="GOA:Q46LY8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY8"
FT                   /protein_id="AAZ59324.1"
FT                   /translation="MDIREKCQPHLWLLTGTGEGHIFAESLLKEGWKITVSVVSDRASI
FT                   PYEKLNLEKILIGALITEEEIRGVILNARIHQNGFHCVVDLTHPFAMKITRSISKVCKE
FT                   LGQTFIRYERAIDNISNAFLIEKFSDLRNYDLKNKSILLAIGVRHLQEAFIFARNSGAN
FT                   VYARVLANPESIRKTLSSSIQKTNFAVLNPSVSSNGKIEKALVRKWNISGVICRQSGGS
FT                   NEILWHRICMSMKINLWLLERPTEFKNINSVDSYEKLIKKLKSISME"
FT   gene            496620..496943
FT                   /locus_tag="PMN2A_1837"
FT   CDS_pept        496620..496943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1837"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1837"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59325"
FT                   /db_xref="GOA:Q46GS1"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS1"
FT                   /protein_id="AAZ59325.1"
FT                   /translation="MSLSSFNQEIYLVITTEFDKKNASKLANLLLREKLIPCVTFKNIE
FT                   SHFWWEGNINQSQEVQLMIKCKKENLDNVCNKISELHSYEIPEIIYFRVSANKNYHHWM
FT                   NSI"
FT   gene            complement(496955..497962)
FT                   /locus_tag="PMN2A_1838"
FT   CDS_pept        complement(496955..497962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1838"
FT                   /product="possible carbohydrate kinase"
FT                   /note="Alternative locus ID: NATL2_05451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1838"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59326"
FT                   /db_xref="GOA:Q46GS0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GS0"
FT                   /protein_id="AAZ59326.1"
FT                   /translation="MTNKTNAASLDIVGIGNAIVDVLTTTDDSFLKKLSFDKGSMTLID
FT                   EKKAKELYEMTTNRIQKSGGSVANSLACVAQLGGKAAFIGRVRDDKLGEIFTEEISTTG
FT                   TIFKTPPSSVGPSTARCIIFVTPDAQRTMCTYLGASVLLEPKDIDLSLVREAKILYLEG
FT                   YLWDNPAAKNAFIKAAEIAKNAGRKVALSLSDSFCVSRHRESFIKLVEEHIDILFANED
FT                   EITNLYETSSLSNALEKLKKKCDLAAITIGEKGSILISNGKEIKIDPFILGKAIDTTGA
FT                   GDLYAGAFLKGYADGLKPELSAKIGSICAGQIVTQLGSRSNTDLLNLINSHLEA"
FT   gene            complement(498004..499317)
FT                   /locus_tag="PMN2A_1839"
FT   CDS_pept        complement(498004..499317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1839"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Alternative locus ID: NATL2_05461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1839"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59327"
FT                   /db_xref="GOA:Q46GR9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GR9"
FT                   /protein_id="AAZ59327.1"
FT                   /translation="MANVVVIGAQWGDEGKGKITDLLSRSADVVVRYQGGVNAGHTIVV
FT                   EDKVLKLHLIPSGILYPDTICLIGSGTVVDPKVMIKEIKMLEDNDIDISGLKLASTAHV
FT                   TMPYHRLLDLAMEQKRGDQKIGTTGRGIGPTYADKSQRNGIRIIDLMSREKLQERLQVP
FT                   LSEKNGLLQKIYGIEPLIIDEIIEEYLDYGKQLKKHIVDCNRTIHQAARKKKNILFEGA
FT                   QGTLLDLDHGTYPYVTSSNPVSGGACIGAGVGPTLIDRVIGVAKAYTTRVGEGPFPTEL
FT                   HGSINDQLCDRGGEFGTTTGRRRRCGWFDGVIGKYAVEVNGLDCLAITKLDVLDELEEI
FT                   DICVAYELNGKRIDYFPTSVEDFEKCNPIFKKLPGWRCSTENCRRLEDLPPAAMSYLRF
FT                   LAELMEVPIAIVSLGANRDQTIVIEDPIHGPKRALLNS"
FT   gene            complement(499413..499847)
FT                   /locus_tag="PMN2A_1840"
FT   CDS_pept        complement(499413..499847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1840"
FT                   /product="photosystem II protein Psb27"
FT                   /note="Alternative locus ID: NATL2_05471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1840"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59328"
FT                   /db_xref="GOA:Q46GR8"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR8"
FT                   /protein_id="AAZ59328.1"
FT                   /translation="MISAFHRLSIRLVRAALAICLGFCLMLFQFASEVNAAKTLMTGDF
FT                   AKDTIAVSSTLKETITLPKEDKGLSEAEKEAVFLISDYISRYRNRSQVNTSTTFTTMQT
FT                   ALNALSGHYKTFANRPVPENLKERLNKELSKAEKLAARDS"
FT   sig_peptide     complement(499737..499847)
FT                   /locus_tag="PMN2A_1840"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.524 at
FT                   residue 37"
FT   gene            complement(499894..501684)
FT                   /locus_tag="PMN2A_1841"
FT   CDS_pept        complement(499894..501684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1841"
FT                   /product="prolyl-tRNA synthetase, bacterial"
FT                   /note="Alternative locus ID: NATL2_05481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1841"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59329"
FT                   /db_xref="GOA:Q46GR7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GR7"
FT                   /protein_id="AAZ59329.1"
FT                   /translation="MRVSRLMLNTLRDVPAEADIISHQLLVRGGYVKRLTGGIYAYMPL
FT                   LWKVLKKITSIVEEELSTKGCLQTLLPQLQPSEIWERSGRWKSYTKGEGIMFSLKDRQG
FT                   KELGLGPTHEEVITQIISQTIHSYKQLPINIFQIQTKFRDEIRPRFGLMRSREFIMKDA
FT                   YSFHANENDLQSTYSDMRNAYENIFTKCGLDFVCVDADSGAIGGAASQEFMVTAESGED
FT                   LILISSDSKYGANQEKAVSIIEEGKLLEPNKPSIIKTPNQKTIDELCNYNDFHPSQIVK
FT                   VLAYLATCDDNKKYPVLVSIRGDQEINDIKLSNKISQELKQNVLDIRIISNEDMQKQGI
FT                   SNIPFGFIGPDLSDNLLAQSKAWEKKFIRIADNSAKDLKSFICGNNIKDEHKIFYNWNL
FT                   INTVQMICDIRKAKPGDRCIHDKTQKLQECRGIEIGHIFQLGTKYSKSLNATFTNEKGV
FT                   EDHFWMGCYGIGISRLAQAAVEQNHDDLGIIWPTSIAPFTVIIIIANIKNNDQKCLAED
FT                   IYQKLIQDRVDVLLDDRDERAGIKFKDADLIGIPWRIVAGREASSGLVELHNRKTKITE
FT                   LLDLNSVFKKLSEEFNTEKL"
FT   gene            501859..502320
FT                   /locus_tag="PMN2A_1842"
FT   CDS_pept        501859..502320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1842"
FT                   /product="possible helix-turn-helix domain of resolvase"
FT                   /note="Alternative locus ID: NATL2_05491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1842"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59330"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR6"
FT                   /protein_id="AAZ59330.1"
FT                   /translation="MFNGPVNSVTNGRSEEFLDKGLNTASNSSDSLLTIDEVQKTLNRS
FT                   RASVYRYTNTDTRNLNPPFNPRKLNTEFRSDQKDQLLFHPNEVARFAKDILRIKEVTVE
FT                   ILNSPSSETQNILNAILDELRIIRNKLDGQSDKNHSIPNHLQDPDKKAA"
FT   gene            502424..502672
FT                   /locus_tag="PMN2A_1843"
FT   CDS_pept        502424..502672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1843"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1843"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59331"
FT                   /db_xref="GOA:Q46GR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR5"
FT                   /protein_id="AAZ59331.1"
FT                   /translation="MDLEPHLINTQSPEIDPLLLNKEKDQLSADDEDPYSFNSTSTSLI
FT                   GLAIVFVMLGIPLLAVISERPETTKSLPTSINQNGPE"
FT   gene            502659..503186
FT                   /locus_tag="PMN2A_1844"
FT   CDS_pept        502659..503186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1844"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="Alternative locus ID: NATL2_05511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1844"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59332"
FT                   /db_xref="GOA:Q46GR4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR4"
FT                   /protein_id="AAZ59332.1"
FT                   /translation="MDLSDLPPSPSPGLVNLVVEIPAGSRNKYEYFSSAGIMALDRVLH
FT                   SSVKYPFDYGFVPNTLAEDGAPLDAMVVMEEPTFAGCLIQARPIGVLDMHDSGAYDGKL
FT                   LCVPTADPRQREINTIKQIAQDQLEDVAEFFRTYKSLEGRVIEIDGWRDYDAVDELLKS
FT                   CIEAHHLEITQK"
FT   gene            503239..503586
FT                   /locus_tag="PMN2A_1845"
FT   CDS_pept        503239..503586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1845"
FT                   /product="Conserved hypothetical protein ArsC related
FT                   protein"
FT                   /note="Alternative locus ID: NATL2_05521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1845"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59333"
FT                   /db_xref="GOA:Q46GR3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR3"
FT                   /protein_id="AAZ59333.1"
FT                   /translation="MKLFSYSSCSTCRRAIKWLKYNDIPFELIDLLKSPPSKEMLISAS
FT                   ELYGDRKYLLNTSGVVYRSMGSDAVKKMSDNDLFEQLILEPRLIKRPFLYKSSKCFLVG
FT                   FKEEKWAEKLL"
FT   gene            503669..504364
FT                   /locus_tag="PMN2A_1846"
FT   CDS_pept        503669..504364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1846"
FT                   /product="signal peptidase I, Serine peptidase, MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="Alternative locus ID: NATL2_05531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1846"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59334"
FT                   /db_xref="GOA:Q46GR2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR2"
FT                   /protein_id="AAZ59334.1"
FT                   /translation="MKHNHSDSSKESKNCWWYSFFDTWGPISLTILLYIGIRHFIAEAR
FT                   YIPSGSMLPGLKVNDRLIVEKLSLRQRSPLRGEIVVFNSPYSFDKKLIADRTKQLPSKF
FT                   QCSLITFPLISWIPTLSDRACDAYIKRIVAVGGDRLLINGKGEIVLNGRSINEPYVMNF
FT                   CPSKSKFNLCPPMTSTVPKGHVFVLGDNRANSWDSRFWPGGGFLPHNEIIGKASWRFWP
FT                   INRLGKLNY"
FT   gene            complement(504502..505830)
FT                   /locus_tag="PMN2A_1847"
FT   CDS_pept        complement(504502..505830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1847"
FT                   /product="phosphoglycerate mutase"
FT                   /note="Alternative locus ID: NATL2_05541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1847"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59335"
FT                   /db_xref="GOA:Q46GR1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR1"
FT                   /protein_id="AAZ59335.1"
FT                   /translation="MTLRLIFVRHGLSSFNKEGRIQGRNDLSTLTREGQLQAEAAGKTI
FT                   SSIPIDAIYSSPLQRASETTRIIIKQHQSELQATYTDELLEVDLGPWSGLTKNEIKNQF
FT                   PEELSIWQKEPKELTINRDDGSKFQPIKELLSQAENFLKSLFDAHSGSNKTILIVAHNA
FT                   ILRCLILKLINEPSKGFRRLKLDNTSISICNINFNDWKDRQVQIQCLNNVAHLNPTIPK
FT                   KKSKKRIILVRHGETDWNKQGRFQGQIDIPLNKNGKSQAKAASEFLKTNILQKAFSSSL
FT                   SRPKETAQIILNEHPGIEISLKDNLIEIGHGKWEGKLESEIKTDWPDLLQTWKISPEKV
FT                   QMPEGENIKEVSTRSITGWNEICKDLKNDETALVVAHDAVNKTILCHLLGLMPSNIWMI
FT                   KQGNGGVTVIDLSDNEGQPDQITCLNITSHLGGIIDSTAAGAL"
FT   gene            505940..507286
FT                   /locus_tag="PMN2A_1848"
FT   CDS_pept        505940..507286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1848"
FT                   /product="metal-dependent membrane protease"
FT                   /note="Alternative locus ID: NATL2_05551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1848"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59336"
FT                   /db_xref="GOA:Q46GR0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GR0"
FT                   /protein_id="AAZ59336.1"
FT                   /translation="MRQAKTGWKWAIALFSLLLTVLIWQQGLQESFERPSVAPKISLMQ
FT                   TEMAVSASSSLPETIQEVFLGSEPQKKLYQALSDIPLEQIEDRERLLLAILEESESEQK
FT                   FMLMKDFNDKKFETIKGYILDRQQGKELYKFPDFDEIKLDPLLYQISCSNLGFTDEKCI
FT                   NQKYNSLTAIRLLTSQLFPFFASVIGSIFLIRYAFVFLRKKNTPWPEMISPPLSLIDMV
FT                   LLISGGFVVIGEVVFPALIIPITDLLFNNLSSPLNQSLRVFIGYCSMTIAPLFIIRYQL
FT                   MGLVPSGIDGGWLQWKIRPIKEGLFKSISGWLMIMPLVLLIGWLMNEIIGDQGGSNPLL
FT                   ELVLGSDEFFPLFLLLITTVVLAPVFEELVFRGILLPVLVSKVGKASGVLLSALIFALA
FT                   HLSVGELPPLFVLGIGLGLMRLSSGRLFPCALMHSLWNGVTFISLLLVA"
FT   sig_peptide     505940..506017
FT                   /locus_tag="PMN2A_1848"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.651) with cleavage site probability 0.455 at
FT                   residue 26"
FT   gene            507371..507835
FT                   /locus_tag="PMN2A_1849"
FT   CDS_pept        507371..507835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1849"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1849"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59337"
FT                   /db_xref="GOA:Q46GQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GQ9"
FT                   /protein_id="AAZ59337.1"
FT                   /translation="MISRTQYKQKAGQFQKKKLSKELLNSVFSSKQVQRKFPIQAALHI
FT                   VLDGALLGILITVAIMSSVALHSQYLWTKSFTKLETTRDLNRRTLESTSILESYLLRNQ
FT                   KLSRNLVPTKAEDLIYVDRPKPEETKKSFDVTLKSRLLEKISSFPVKSGY"
FT   gene            507844..509640
FT                   /locus_tag="PMN2A_1850"
FT   CDS_pept        507844..509640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1850"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="Alternative locus ID: NATL2_05571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1850"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59338"
FT                   /db_xref="GOA:Q46GQ8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GQ8"
FT                   /protein_id="AAZ59338.1"
FT                   /translation="MRSSDHRKKRKTFKVNTLQPLSHSRFRIIFVLLCLGLGGLFLRVG
FT                   WLQLFQSEQLRALAREVQTEQKTPLGTRRSILDRNGKLVAIDERRFKIWAHPRYFNFPG
FT                   DSSRTVRKPVEVAKLLSAPLSISVDDILKKVGNYSSGVKLAEGVTPEQANAIKKLGISG
FT                   IDLEVYPQRLYPHGSLFANVVGFLDLDRRPQAGLELSLDSDLKRLEKASLIRRGADGTP
FT                   LPTGVQRGVFEEDQLSLQLTLDVRLQEVAIKEISKQVKKWDAKKGVVIVMDIDTGELLA
FT                   LASTPTYDPNKYWDYSPSLFKEWSVQELFEPGSTFKPINLALALEEGVISPNGEVNDDG
FT                   LVTVGGWPLSNWDRRPNGILTFPEVLQVSSNVGMVKIMNKLNASIYWQWLRRLGIEEIP
FT                   ETDLPGAVSGQIKSKQTFVNQPIEPAVASFGQGFSVTPLKLAQLHALIANGGRLVTPHI
FT                   TKGLKGDYESYFNSPSEPKQVLSPEVTKTVLGWMETVVSFYDESGIDVDVPGYRIGGKT
FT                   GTAQKSQDGFNYNSKICSFVASLPIDDPRYVVLAVIDEPQKPNAYGSTVALPVAKKIIE
FT                   TLLVIEKIPPSISKKEHLASKS"
FT   sig_peptide     507844..507978
FT                   /locus_tag="PMN2A_1850"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.430 at
FT                   residue 45"
FT   gene            509733..510731
FT                   /locus_tag="PMN2A_1851"
FT   CDS_pept        509733..510731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1851"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="Alternative locus ID: NATL2_05581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1851"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59339"
FT                   /db_xref="GOA:Q46GQ7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GQ7"
FT                   /protein_id="AAZ59339.1"
FT                   /translation="MESLLSQLSSMTVVVADTGDLEAIKKYHPRDATTNPSLILAAAQM
FT                   PAYQSLIDQALTTSREMLGTSAAKADVVKEALDELCVVFGKEILKLIPGRVSTEVDARL
FT                   SFDTDATIEKARKIIAKYNADGISNDRVLIKIASTWEGIKAAEVLEKENIHCNLTLLFN
FT                   FYQAVACAEAGVTLISPFVGRILDWYKSATGRDSYPATEDPGVVSVTKIFNFFKSNGYK
FT                   TEVMGASFRNIEEITELAGCDLLTISPKLLQQLNETHMDLPIKLNAQKPLVIEEKIHLD
FT                   QTSFELMMAGDKMATEKLDDGISGFSKAIDKLENQLNERLELIEGEVALTH"
FT   gene            complement(510735..511865)
FT                   /locus_tag="PMN2A_1852"
FT   CDS_pept        complement(510735..511865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1852"
FT                   /product="geranylgeranyl reductase, plantal and
FT                   prokaryotic"
FT                   /note="Alternative locus ID: NATL2_05591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1852"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59340"
FT                   /db_xref="GOA:Q46GQ6"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GQ6"
FT                   /protein_id="AAZ59340.1"
FT                   /translation="MTLIDVAIIGGGASGTTTAFHLASNSKKVCILEKNIFSSERICGG
FT                   GMSAAVQNWFPFKLLPIVDEVITNVEFSWCNTDKVVAELSGSSPFWIVKREKLDSFLLD
FT                   QALNSGCNLLTTFKVVDIKKKSNVWHITALDGRQIEARAVVIADGSQSPWPKTFNLGPT
FT                   QQKFASTFSGRIKRRGNLRNETARFEFGLVKNGFAWAFPLDNEVNIGMGTFLDNKNSLP
FT                   VNEILKSFLPDLCFDPSEVIGHEKKLRIWNGHCKLNGEGILLVGDAASLCDPFLAEGLR
FT                   PALMSGFEAAKSLIYWLDGEVNCLDAYTNTMQINWGNSMAWGKRISQVFYRFPKVGYQL
FT                   GVKRPTAPKRIAQILSGEMSYEDIAKRVIKRLLFQN"
FT   gene            complement(511862..512410)
FT                   /locus_tag="PMN2A_1853"
FT   CDS_pept        complement(511862..512410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1853"
FT                   /product="ribosome recycling factor"
FT                   /note="Alternative locus ID: NATL2_05601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1853"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59341"
FT                   /db_xref="GOA:Q46GQ5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GQ5"
FT                   /protein_id="AAZ59341.1"
FT                   /translation="MSNQELKTTMSKSIEAAQRNFNTIRTGRANTSLLDRISVEYYGAE
FT                   TPLKSLATITTPDSQTIAIQPFDLGSLASIEKAIATSDLGFTPNNDGKIIRINVPPLTE
FT                   ERRKEFCKLASKYAEEGKVALRNIRREAIDRVKKSEKDGDLSEDQSRDEQETIQKETDN
FT                   FIKDIEKKLSEKEAEILKV"
FT   gene            complement(512479..513192)
FT                   /locus_tag="PMN2A_1854"
FT   CDS_pept        complement(512479..513192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1854"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="Alternative locus ID: NATL2_05611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1854"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59342"
FT                   /db_xref="GOA:Q46GQ4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GQ4"
FT                   /protein_id="AAZ59342.1"
FT                   /translation="MTYSRALIKLSGEALMGDKPYGIDPEIVQSIAKDVSKVVENGTQI
FT                   AIVVGGGNIFRGLKGSAAGMDRATADYVGMLATVMNAITLQDGLERAGVPTRVQSAIDM
FT                   QQIAEPYIRRRAIRHLEKGRVVVFGGGCGNPFFTTDTTAALRAAEINAEVVFKATKVDG
FT                   VYDRDPKKFTDAVKYDNLTFQDVLANEIGVMDSTAIALCKDNKIPIVVFNIFQPGNIAK
FT                   AISGEPIGSRISNSS"
FT   gene            complement(513290..513982)
FT                   /locus_tag="PMN2A_1855"
FT   CDS_pept        complement(513290..513982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1855"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="Alternative locus ID: NATL2_05621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1855"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59343"
FT                   /db_xref="GOA:Q46GQ3"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GQ3"
FT                   /protein_id="AAZ59343.1"
FT                   /translation="MKNKITKEDSRLNKLDKSAERIGMGGNLIPNMTEEKYKERMQKRK
FT                   EVQTQRLKERKKEKGLIIVNTGQGKGKTTAALGMGLRTIGHNHNVAIIQFIKGGWEPGE
FT                   SLAFKIFGDKLKFHACGEGFTWETQDRNRDINLVKSSWRKAVSYIKDPNYKLIILDEII
FT                   VAIKLGYIDEDEIINGINLRPELTHIVLTGRGASEKLINSADLVTEMKLIHHPFREQGI
FT                   KAQEGIEY"
FT   gene            complement(514065..515225)
FT                   /locus_tag="PMN2A_1856"
FT   CDS_pept        complement(514065..515225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1856"
FT                   /product="XisA-like site specific recombinase from phage
FT                   integrase family"
FT                   /note="Alternative locus ID: NATL2_05631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1856"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59344"
FT                   /db_xref="GOA:Q46GQ2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GQ2"
FT                   /protein_id="AAZ59344.1"
FT                   /translation="MDENQKLLDINHDLESKGINLRIEKRGKVLNIRGSLPDKKSHNLS
FT                   KVQRISLKLPHDINGLEEARKAIELIDFQLKKNQFCWSNWIKEKALSSTKTNKTVISNE
FT                   IESFKRQFFSDTSRSKSSAGMISTWQSAYKPYLNRLIAVSHKSTLKLSEELLVKILLSY
FT                   RENSRSRQQCGIALSALARHLKVELPKNWKQLQSGYGIHESNFRELPSDKEIINSFQLI
FT                   PNPKWRFVYALMATYGLRNHEVFFSDLSCLKKGGDKILRVFPNTKTGEHQVWPFHPEWV
FT                   ALFELGNITDTSDLLPDIKTDLKETTLQHIGRRVSEQFRRYEISFTPYDLRHAWAVRTI
FT                   LIGLPNTVAAKMMGHSVSIHTKTYHHWITRRDQQIAVDSALSRVKY"
FT   gene            515297..516472
FT                   /locus_tag="PMN2A_1857"
FT   CDS_pept        515297..516472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1857"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="Alternative locus ID: NATL2_05641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1857"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59345"
FT                   /db_xref="GOA:Q46GQ1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GQ1"
FT                   /protein_id="AAZ59345.1"
FT                   /translation="MARVGVLLLNLGGPERIKDVGPFLYNLFSDPEIIRLPVRAFQKPL
FT                   AWLISLLRSSKSQEAYRSIGGGSPLRRITEQQARELQSYLRNIGIDATTYVAMRYWHPF
FT                   TESAVADMKADGVSEVVVLPLYPHFSISTSGSSFRELKRLKDGDDEFAELSIRCIRSWF
FT                   DHPAYVSSMAELIKKQILACDLPQESHVFFTAHGVPKSYVEEAGDPYQDQIQNCSLLII
FT                   DQLENSLGFTNSFSLAYQSRVGPEEWLKPYTEEVLEKLGKSGVKELVVVPISFVSEHIE
FT                   TLQEIDIEYKEIAQKNGIVNFKRVPALDVYPLFIEGLADLVSSCLNGEGISLEEASKLP
FT                   ERVKLYPQEKWQWGWNNSSEVWNGRVAMIVFLSFLMELIIGGGPLHQIGLL"
FT   gene            516618..518366
FT                   /locus_tag="PMN2A_1858"
FT   CDS_pept        516618..518366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1858"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Alternative locus ID: NATL2_05651"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1858"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59346"
FT                   /db_xref="GOA:Q46GQ0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GQ0"
FT                   /protein_id="AAZ59346.1"
FT                   /translation="MTLTSTPNQIEDSGTQTQYEMSGADALMDSLRRHGVDTIFGYPGG
FT                   AILPIYDAVFKAEQEGWLKHILVRHEQGGTHAADGFARATGKVGVCFGTSGPGATNLVT
FT                   GIATAQMDSVPLVVITGQVPRPAIGTDAFQETDIFGITLPIVKHSWVVRDPSEIAKVVA
FT                   QAFLIASSGRPGPVLIDIPKDVGQEMFKYVPVEPGSIKPLGFELPFAPEHKAISSALDL
FT                   IENAEQPLLYVGGGVISSGAHETLAAIANRYQIPVTTTLMGKGAFDERDPLSVGMLGMH
FT                   GTAYANFAVTECDLLIAIGARFDDRVTGKLDTFAPKAKVIHFEIDPAEINKNRVVEVSV
FT                   LGDVGISLVKLLDLSNQRKTNPRTSQWLNKIKNWKNNFPLITPPKEGEIYPQEVLIALR
FT                   DLAQDAYITTDVGQHQMWAAQYLLNGPRQWISSAGLGTMGFGMPAAMGVKVALPKEKVI
FT                   CIAGDASILMNIQELGTIAQYKLNLKVIIINNHWQGMVRQWQESFYDERYSASNMSVGE
FT                   PDFISLSKAFGIEGIVISERENLIPQLQKALENEGPVLVNVNVRKGENCYPMVPPGKSN
FT                   AEMVGI"
FT   gene            518394..518741
FT                   /locus_tag="PMN2A_1859"
FT   CDS_pept        518394..518741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1859"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05661"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1859"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59347"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP9"
FT                   /protein_id="AAZ59347.1"
FT                   /translation="MNKFFTKILILLASLFWFHSGVDAAEILQVTSSSVLLIGDHNRTY
FT                   TVKLACTEITPDLEEESLKWLKKQLPRHTKVNLKPKGSVNGVLVAKVIPFDSEIDITEK
FT                   YINEGLATNKC"
FT   sig_peptide     518394..518468
FT                   /locus_tag="PMN2A_1859"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.892 at
FT                   residue 25"
FT   gene            complement(519039..519926)
FT                   /locus_tag="PMN2A_1860"
FT   CDS_pept        complement(519039..519926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1860"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05671"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1860"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59348"
FT                   /db_xref="GOA:Q46GP8"
FT                   /db_xref="InterPro:IPR009472"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP8"
FT                   /protein_id="AAZ59348.1"
FT                   /translation="MIASKKPNLKKTDWEIDFYSRPIIDENGKKRWELLITSTNNFKDK
FT                   KTFKWEKICPASSVNSIWLKDAFDEAIDEAYLQGWDKPSVIRCWRSSMKTMIKRAADQI
FT                   GIELISSRRTYSLLEWLIERERSFYPQQKGYTGVNLAPPSNPITNQAIPLPEEVRGESW
FT                   SFASLSLNTLREADEWEIEFSNLIPIKDSINENISIPGIRLFSPKRSLALAAWLGGLEP
FT                   AKLLIEGTQIILEAGQADRWLVTDVEEEAKKVIENNFLNTKLYADGLQFISVQKSPEEN
FT                   SLHGFWMLKDIEEY"
FT   gene            complement(519950..521245)
FT                   /locus_tag="PMN2A_1861"
FT   CDS_pept        complement(519950..521245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1861"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="Alternative locus ID: NATL2_05681"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1861"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59349"
FT                   /db_xref="GOA:Q46GP7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP7"
FT                   /protein_id="AAZ59349.1"
FT                   /translation="MAGSDPQPKKATPQRPAINAPRKPLQVMHISRKPEEEIINEESSE
FT                   KEFSEQPKDRRFAEKVLAPKEISYLKKAPEQQNSIGKDSSDDFQSETMEDLLRSENNTN
FT                   YKNNIEAFDDQNIFEQKSRTVDEFDFDEDEFLAALEENQPIGTTGEIAKGSVIAVESDG
FT                   IYVDIGGKAPGFMPKNECGLGVITNLKERFPKGLKVEVLVTREQNADGMVTISCRALEL
FT                   RKSWDKVQNLAKEGKVIRVKINGFNRGGVTCDFEGLRGFIPRSQLEDGENHQSLVSKTI
FT                   STAFLEVNPERRKLVLSEKKAAIASRFSELEIGQLIEGEILTIKPYGFFVDLRGVSGLL
FT                   HHSMVTNGSMRSLREVFQPGESIKALITDLDPSRGRIGLNTALLEGPPGELITDKTKVM
FT                   EEANERAIKARNSLNKEKVDPQKEKEDINLSS"
FT   gene            521348..522145
FT                   /locus_tag="PMN2A_1862"
FT   CDS_pept        521348..522145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1862"
FT                   /product="creatinine amidohydrolase related enzyme"
FT                   /note="Alternative locus ID: NATL2_05691"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1862"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59350"
FT                   /db_xref="GOA:Q46GP6"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP6"
FT                   /protein_id="AAZ59350.1"
FT                   /translation="MTWPEASKAASENGSTLVWPFGACEQHGPHLPLITDTFFAENILI
FT                   KTLNRLPENMPIWMMPSQSIGFSPEHQAFPGTLSLSADVLISMVTDVGQQIASMGFNRL
FT                   VFFNAHGGQIGLLQAVSRQLRIQCPSIAVLPCFLWSGVPGLDQLLPEKEVEEGLHAALA
FT                   ETSLMLHMARDLVRNDSYLEIKNVDKQIVTTPKGWSLEGASPCAWLTEDLSSSGVIGDA
FT                   SSSNSELGAALENALVDHWIALFTSLLESDWPPIRSERPVSSS"
FT   gene            522220..522945
FT                   /locus_tag="PMN2A_1863"
FT   CDS_pept        522220..522945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1863"
FT                   /product="fatty aldehyde decarbonylase"
FT                   /note="Alternative locus ID: NATL2_05701"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1863"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59351"
FT                   /db_xref="GOA:Q46GP5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR022612"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP5"
FT                   /protein_id="AAZ59351.1"
FT                   /translation="MQAFASNNLTVEKEELSSNSLPDFTSESYKDAYSRINAVVIEGEQ
FT                   EAYSNFLDLAKLIPEHADELVRLGKMEKKHMNGFCACGRNLAVKPDMPFAKTFFSKLHN
FT                   NFLEAFKVGDTTTCLLIQCILIESFAISAYHVYIRVADPFAKRITEGVVQDEYLHLNYG
FT                   QEWLKANLETVKKDLMRANKENLPLIKSMLDEVSNDAEVLHMDKEELMEEFMIAYQDSL
FT                   LEIGLDNREIARMALAAVI"
FT   gene            523084..524124
FT                   /locus_tag="PMN2A_1864"
FT   CDS_pept        523084..524124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1864"
FT                   /product="dehydrogenase"
FT                   /note="Alternative locus ID: NATL2_05711"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1864"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59352"
FT                   /db_xref="GOA:Q46GP4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016836"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP4"
FT                   /protein_id="AAZ59352.1"
FT                   /translation="MFGLIGHSTSFEDAKRKALGLGYDHIAQGDLDVWCTAPPQLVENV
FT                   KVVSAIGKTIEGAYIDSCFVPEMLSRFKTARRKVLNAMELAQKKEISITALGGFTSIIF
FT                   ENFNLLQNQQVRNTTLDWQRFTTGNTHTAWVICRQLEQNAPRIGIDLSKSKVAVVGATG
FT                   DIGSAVCRWLSNRTGVSELLLVARQQKPLLELQSQLGGGRILSLDDALPEADIVIWVAS
FT                   MPKTLEIDPSKIKRPCLMIDGGYPKNLGEKFSGPGIHVLKGGIVQFFKDIGWSMMELAE
FT                   MENPKREMFACFAEAMLLEFENCHTNFSWGRNNITLEKMDFIGKASERHGFSAVGLKSN
FT                   IQTLTV"
FT   gene            524145..525134
FT                   /locus_tag="PMN2A_1865"
FT   CDS_pept        524145..525134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1865"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /note="Alternative locus ID: NATL2_05721"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1865"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59353"
FT                   /db_xref="GOA:Q46GP3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GP3"
FT                   /protein_id="AAZ59353.1"
FT                   /translation="MARRFLLEFEKPLVELENQIDQIRELARDSEVDVSQQLLQLETLA
FT                   ARRREEIFNALTPAQKIQVARHPQRPSTLDYIQMFCDDWVELHGDRNGTDDQALIGGLA
FT                   RIGEKSVLLIGQQKGRDTKENVARNFGMAKPGGYRKALRLMDHADRFNLPIISFIDTPG
FT                   AYAGLIAEEQGQGEAIAVNLREMFRLKVPIIATVIGEGGSGGALGIGVADRLLMFEHSV
FT                   YTVASPEACASILWRDAGKAPEAASALKITGPDLMKLGIVDEVLKEPSGGNNWAPLQAG
FT                   DTLKNALEKHLSELLALSPDELRNNRYSKFRKMGKYLESQSIESEISV"
FT   gene            525146..525868
FT                   /locus_tag="PMN2A_1866"
FT   CDS_pept        525146..525868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1866"
FT                   /product="short-chain dehydrogenase/reductase family
FT                   enzyme"
FT                   /note="Alternative locus ID: NATL2_05731"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1866"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59354"
FT                   /db_xref="GOA:Q46GP2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP2"
FT                   /protein_id="AAZ59354.1"
FT                   /translation="MLLTFLSTVLITGASRGIGRATAKAFADSGWDLLLLARSEEALAR
FT                   LVEEIDNKKVKVFYKSIDLSNPKNISKGIVELMNNGLIPSVLINNAGVAWTGDLLSMPL
FT                   EKWEWIMQMNLTSIFQVCSEVVPLMRNKGGLVINVSSHASRNIFPQWGAYCVSKAALAS
FT                   FTKSLAEEERKNLIRACTLTLGSVNSSLWDSDSVGMQFDRDSMLSVDQVACELLHLASQ
FT                   PTNQIIEDVTLMPSAGAF"
FT   sig_peptide     525146..525217
FT                   /locus_tag="PMN2A_1866"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.841) with cleavage site probability 0.460 at
FT                   residue 24"
FT   gene            complement(525865..526539)
FT                   /locus_tag="PMN2A_1867"
FT   CDS_pept        complement(525865..526539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1867"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="Alternative locus ID: NATL2_05741"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1867"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59355"
FT                   /db_xref="GOA:Q46GP1"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP1"
FT                   /protein_id="AAZ59355.1"
FT                   /translation="MIRKSSSKKSTAIKICGLTKTSQARSIAELKINAIGVIGVKNSPR
FT                   FVPEEECMKIFNEVEKVSSSIEKVLVIANAKLEEVKCINNRSTPPSVIQLHGNESVDYC
FT                   RELKNEFPGIKIWKAFRLKAINDLENISQYEKNIDAILIDAWDKKSLGGTGNRVPIELL
FT                   LNKTFKAPWILAGGISAEIIPEIFSKLRPDGIDASSRLEISPGIKDIKKVASLVREIRE
FT                   QD"
FT   gene            526642..527832
FT                   /locus_tag="PMN2A_1868"
FT   CDS_pept        526642..527832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1868"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05751"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1868"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59356"
FT                   /db_xref="GOA:Q46GP0"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GP0"
FT                   /protein_id="AAZ59356.1"
FT                   /translation="MRIHPSWFLVFLYFTLSAKDQFETLLNGQASIWNGWVIGASTSSL
FT                   LFLSVLLHELAHSFVAIGEGLKVRDITLFFLGGMASLEKECPTSKGSLKIAISGPVVSL
FT                   LLAFLMILLSNNLSVSNFILSNLFKQVGSLNLLIGVFNLLPIMPLDGGVILKSLIWYFT
FT                   GSKRAGIKVAIGSARLISFLAIFIGILSLLRGNFYLSICFSIIGLFVFSSSKSQSQIIQ
FT                   IQKILSELYVNQVCSRSFRVLEDDLPVKVLSKYSSFNKDNFSNEVWILLCREGRWVGYV
FT                   NEKILKNISVQNWDKKFLYEFSQPINELPSISEKESLWKAILKIEKTKDGRLLVLSFSG
FT                   LPLGTLDRVDLGKAVLKKIGLNLPDQLIKIARKENIYPLGLNLPNIAQSMDSSDLI"
FT   gene            complement(527835..528584)
FT                   /locus_tag="PMN2A_1869"
FT   CDS_pept        complement(527835..528584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1869"
FT                   /product="lipoate-protein ligase A"
FT                   /note="Alternative locus ID: NATL2_05761"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1869"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59357"
FT                   /db_xref="GOA:Q46GN9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GN9"
FT                   /protein_id="AAZ59357.1"
FT                   /translation="MNKLEEVLYLNPLELSGPEQMAIDLFLLEKSLAENNFNMAVRFYT
FT                   WDGDWLSIGKNQKELPKKWIELLKNEQLKIVRRPSGGKAVLHSRGLTYALIWKYPPRNK
FT                   KESYLKTTEWLKDGIKKAGVDLFYGNQPVNISNSNCFSTSTLADLVDQDKNKHIGSAQY
FT                   WRNGHLLQHGEILMEPSKQLWQKVFNADPPKIKNEIKDKDKIINFLKDSLGKTWPNSQI
FT                   FTYTLNQKDKEIIKRFAINKFKKINNY"
FT   gene            528743..529147
FT                   /locus_tag="PMN2A_1870"
FT   CDS_pept        528743..529147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1870"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="Alternative locus ID: NATL2_05771"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1870"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59358"
FT                   /db_xref="GOA:Q46GN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GN8"
FT                   /protein_id="AAZ59358.1"
FT                   /translation="MGQPQRIEEPFRRKRSKKINKRNPSVNEKIDAFTQVSEFQKEAVR
FT                   RELLYSNVGLILKFGLFIVFATSLVNLGLASHQRVNRNLELSYLLEKESKKLHKLRLRF
FT                   DEMFTNGGEQSFFKEQDQWITPNSVRVIWR"
FT   gene            529216..530229
FT                   /locus_tag="PMN2A_1871"
FT   CDS_pept        529216..530229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1871"
FT                   /product="chlorophyll synthase / NADPH-protochlorophyllide
FT                   oxidoreductase"
FT                   /EC_number="1.3.1.33"
FT                   /EC_number="2.5.1.62"
FT                   /note="Alternative locus ID: NATL2_05781"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1871"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59359"
FT                   /db_xref="GOA:Q46GN7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GN7"
FT                   /protein_id="AAZ59359.1"
FT                   /translation="MALVQAAPGTVLITGTTSGVGLYATKSLVERGWRVITANRCSLRA
FT                   EASASAVGLPTNSPRQLKHIQIDLGDLDSVRNGAKSLLEDLEKPLDALVCNAAVYLPRL
FT                   KKPLRSPQGYEISMATNHFGHFLLIQMLLENLSKSSRPVWKGRSWGVESSRVVILGTVT
FT                   ANNKELGGKIPIPAPADLGNLSGFEEGFCDPISMASGKRFKPGKAYKDSKLCNMITTQE
FT                   LHRRFNSSPILFSSLYPGCVANTRLFRNTPKLFQWLFPWFQKLITGGFVSEALAGDRVA
FT                   QVVSDPQFAISGVHWSWGNRQRKDRQQFSQELSDRVTDPVTSRKVWELSMRLVGLK"
FT   gene            complement(530246..531136)
FT                   /locus_tag="PMN2A_1872"
FT   CDS_pept        complement(530246..531136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1872"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   iron-sulfur ATP-binding protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="Alternative locus ID: NATL2_05791"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1872"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59360"
FT                   /db_xref="GOA:Q46GN6"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GN6"
FT                   /protein_id="AAZ59360.1"
FT                   /translation="MTSTITRKEDGEGSVQVKQDPKAQIQEGALVIAVYGKGGIGKSTT
FT                   SSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMF
FT                   KGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAA
FT                   PLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNE
FT                   RTGLKTMAHFRNVDAIRRSRLKKCTIFEMDSEEEGVVEVQNEYLSLAQKMIDNVEPLEA
FT                   EPLKDREIFDLLGFD"
FT   gene            531497..532753
FT                   /locus_tag="PMN2A_1873"
FT   CDS_pept        531497..532753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1873"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   N subunit"
FT                   /note="Alternative locus ID: NATL2_05801"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1873"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59361"
FT                   /db_xref="GOA:Q46GN5"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GN5"
FT                   /protein_id="AAZ59361.1"
FT                   /translation="MSGATLLKESGPREVFCGLTSIVWLHRRMPDAFFLVVGSRTCAHL
FT                   IQSAAGVMIFAEPRFGTAILEERDLAGLADAHDELNRVVKNLLARRPEIKTLFLVGSCP
FT                   SEVIKIDLSRVAENLNIELKGQVTVLNYSGSGIETTFTQGEDGALKALIPLMPKSDQKK
FT                   LLLVGTLANAVEDRLTSIFNRLGIDKVESFPPRQSTELPSIGPETKVLLTQPYLTDTAR
FT                   ELKNKGAEIIEAPFPLGVTGSTLWIQAAADSFGIEKSLVDSILNPLISRAKQALIPHVE
FT                   KLSGKKLFLLPESQLEIPLARFLSNECGMEIIEIGTPYLNRDLMKAEIDLLPPDCRIVE
FT                   GQHVERQLDRVRDSSPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQASDLAEL
FT                   FSRPLRRHDILNPKTLTSN"
FT   gene            532758..534335
FT                   /locus_tag="PMN2A_1874"
FT   CDS_pept        532758..534335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1874"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   B subunit"
FT                   /note="Alternative locus ID: NATL2_05811"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1874"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59362"
FT                   /db_xref="GOA:Q46GN4"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GN4"
FT                   /protein_id="AAZ59362.1"
FT                   /translation="MELTLWTYEGPPHIGAMRIATSMKKLHYVLHAPQGDTYADLLFTM
FT                   IERRGSRPPVTYTTFQARDLGGDTAELVKGHIKEAVDRFKPETLLVGESCTAELIQDQP
FT                   GSLAKGMGFDIPIVSLELPAYSKKENWGGSETFYQIVRTLLKDHSNESKHTWQEEKRRP
FT                   RVNLLGPTLLGFRCRDDVLEIQKLLGQYGIDVNVVAPLGASPADILRIPNADVNVCLYP
FT                   EIAESTCIWLERNLNIPFTTTVPLGVGATQDFLKELHKVLEMEIPQSVNESNNSKLTWY
FT                   SNSVDSNYLTGKRVFIFGDGTHALAAARIANEELGFKVVGLGTYSREMARKVRPAAKAL
FT                   GLEALITNDYLEVEDAIKETSPELVLGTQMERHSAKRLGIPCAVISTPMHVQDVPARYS
FT                   PQMGWEGANVIFDDWVHPLMMGLEEHLIGMFKHDFEFVDGHQSHLGHLGGKGTQNTNKE
FT                   AIKTNLQDSVITDSDPIWTHEGEKELSKIPFFVRGKVRRNTENYARQAGCREINEETLY
FT                   DAKAHYKA"
FT   gene            complement(534347..534712)
FT                   /locus_tag="PMN2A_1875"
FT   CDS_pept        complement(534347..534712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1875"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05821"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1875"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59363"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GN3"
FT                   /protein_id="AAZ59363.1"
FT                   /translation="MSATQPKDPKNNNSNAEINPEQALGLVSLGLMQKLSDKGLADLNW
FT                   LKEDEKCDTYELRQRLELTSLALETGAPLSTTEVSKLLGVRPGSSKVERGGLIAKKLSR
FT                   NVWRLIKSSQESSHWRN"
FT   gene            534814..535590
FT                   /locus_tag="PMN2A_1876"
FT   CDS_pept        534814..535590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1876"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05831"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1876"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59364"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GN2"
FT                   /protein_id="AAZ59364.1"
FT                   /translation="MTRFATFENNERRPGGSQRITGAEVNKYLVDDPKRVITTDSEKSL
FT                   VARQASHVKQIELRTYVFLDSLQPQLAAYMGTASSGFLPIPGDACLWMEVSPGMAVHRV
FT                   TDIALKASNVRLGQMIVERAFGSLALYHRDQSTVLHSGDVVLDAIGSTIDRRTDPQVTW
FT                   TEVIRSITPDHAVLINRQNRRGSMIQSGMSMFILETEPAGYVLMAANEAEKASNITIVD
FT                   VKGVGAFGRLTLAGKEGDVEEAAAAAMRSIDQINRS"
FT   gene            complement(535587..536177)
FT                   /locus_tag="PMN2A_1877"
FT   CDS_pept        complement(535587..536177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1877"
FT                   /product="HAM1 family protein"
FT                   /note="Alternative locus ID: NATL2_05841"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1877"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59365"
FT                   /db_xref="GOA:Q46LY7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY7"
FT                   /protein_id="AAZ59365.1"
FT                   /translation="MKKPLITIASGNPKKVAEIEAMLGPLPIEVKKQPSSLDVEETGKT
FT                   YLENAILKAKAAAALTNSWTIADDSGLEIDSLGNAPGIFSARLANTNEKKIEKILTALG
FT                   DSPYRSAKVCSVMVLCSNSGEIIQNTIGICWGEILKEPAYPNGEFESLFWVRETNCTYG
FT                   ELNNAQLSKHGSRGKAARELAPYLLKAIGIKNN"
FT   gene            536535..536846
FT                   /locus_tag="PMN2A_1878"
FT   CDS_pept        536535..536846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1878"
FT                   /product="carboxysome shell protein CsoS1"
FT                   /note="Alternative locus ID: NATL2_05851"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1878"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59366"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY6"
FT                   /protein_id="AAZ59366.1"
FT                   /translation="MASETMGIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGG
FT                   YVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPHREVEPALGNGNFLGQKD"
FT   gene            536918..538330
FT                   /locus_tag="PMN2A_1879"
FT   CDS_pept        536918..538330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1879"
FT                   /product="ribulose 1,5-bisphosphate carboxylase large
FT                   subunit"
FT                   /EC_number="4.1.1.39"
FT                   /note="Alternative locus ID: NATL2_05861"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1879"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59367"
FT                   /db_xref="GOA:Q46GN1"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GN1"
FT                   /protein_id="AAZ59367.1"
FT                   /translation="MAKKYDAGVKEYRDTYFTPDYVPLDTDLLACFKCTGQEGVPKEEV
FT                   AAAVAAESSTGTWSTVWSELLVDLEFYKGRCYRIEDVPGDKDAFYAFIAYPLDLFEEGS
FT                   ITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPSGIVVERDRLNKYGRPLLG
FT                   CTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQ
FT                   ETGEVKGHYLNCTATTPEEMYKRAEFAKELDMPIIMHDYITGGFTANTGLANWCRENGM
FT                   LLHIHRAMHAVIDRHPQHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDN
FT                   LRESFVPEDRTRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTH
FT                   GHPWGSAAGAAANRVALEACVKARNAGREIEKESRDILLEAAKHSPELAIALETWKEIK
FT                   FEFDTVDKLDVQ"
FT   gene            538431..538772
FT                   /locus_tag="PMN2A_1880"
FT   CDS_pept        538431..538772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1880"
FT                   /product="ribulose 1,5-bisphosphate carboxylase small
FT                   subunit"
FT                   /EC_number="4.1.1.39"
FT                   /note="Alternative locus ID: NATL2_05871"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1880"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59368"
FT                   /db_xref="GOA:Q46GN0"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GN0"
FT                   /protein_id="AAZ59368.1"
FT                   /translation="MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPV
FT                   IEHVQPSGSMQTYWSYWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIVGYDAYTQSQG
FT                   TCFVVFQGR"
FT   gene            538872..541262
FT                   /locus_tag="PMN2A_1881"
FT   CDS_pept        538872..541262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1881"
FT                   /product="carboxysome shell protein CsoS2"
FT                   /note="Alternative locus ID: NATL2_05881"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1881"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59369"
FT                   /db_xref="InterPro:IPR020990"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM9"
FT                   /protein_id="AAZ59369.1"
FT                   /translation="MAKQTSRQLVLERRQALSQGGKNASIKGGSTANRVRSSADARATR
FT                   TNSGFVKPNKSIASANNSSSQSSTSSFQLSTSGSASSSRSYRSSVAQPSRQLVIARREA
FT                   LSRRGKSADNTKDITRVELERKKVQSAPSYDAKNAEHCCPECEQKALEETSNTTQKPEI
FT                   SLKLNKRTTDHRSTVKRKAITNSSRAFVLARREALSKHGKSAGKQPTTAASVARQGNPD
FT                   LTTKEIAQRVRELKSKTGATGSKRTSVTRPCGPNKNGAKQNASVPDAHWKVGISETSTG
FT                   QIVTGTQANRSLKTTGNEASTCRSITGTQYLGSEVIDSFCNGSNTQISQPAKVAVTSTS
FT                   HGNLVTGNEVGRSEKVTGDEPGTCKNLTGTEYISANQSNNYCGGVNPSPSKIGYSQTID
FT                   GQKVSGTMTGRSALVTGNEAGSNKGLTGDQYLGSDPLPSGRPAEKVGSLTTIRGNGVTG
FT                   TDVSRRENVTGNEAGSCKNVTGDEYVGAGQFDSFCGSKPAPDPAKVGLSITNKTQSVSG
FT                   TMTGRSHLVTGDEPGTCKAVTGTPYAGLDQANQWCDNSASSEVEARTPRKTGTPGARLT
FT                   GQQPGIGGKMTGAHKGACEPLTGTPYVGGDQLADNCGISTSPEGYAHQETTEKAAAWTS
FT                   FSVKSPARQAHIQNEINAGVTGTSYEDSSRITGPFDMAANKVTGTEQFRFDRKPSNSTN
FT                   NKVDQIVNEESKQRPTSQITGEGQSAGLNITGDDWARGEHVTGTEGASAKRRNPSRPGP
FT                   MSAMNAAELKRNQEVPEPDFLITGSSGNTRDGQLVTFSGGARG"
FT   gene            541270..542829
FT                   /locus_tag="PMN2A_1882"
FT   CDS_pept        541270..542829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1882"
FT                   /product="carboxysome shell polypeptide, CsoS3"
FT                   /note="Alternative locus ID: NATL2_05891"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1882"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59370"
FT                   /db_xref="InterPro:IPR014074"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM8"
FT                   /protein_id="AAZ59370.1"
FT                   /translation="MAYRNLAKKSRRGPTAPMKRFIDLETKNLNSEVIKTTNSFSDEIK
FT                   TISSFSTDHPLTNSQENQKLNQYENKVKGRFDNIVPLLKRVSSLQNDLNFVERAQNLCR
FT                   SELGYELPLHILEKAWVGSIDISALFAWCVFQSHQLTSNEFFNSDPIEGSENSQYAKSF
FT                   QSFLYQCGFHLLDITPCADGRLAHAISYALRIPFSSVRRRSHAGALFDIEKTVNRWIKT
FT                   EHSRYRESTPNSATEPTRYLKSVIYHFSSVDPTHQGCAAHGSNDELAASEGLQRLLDFR
FT                   EAVENSFCCGASVDLLLIGIDTDTDAIRVHTPSKTNEVDLKSWVCANEIYKETQFLKAE
FT                   EALQKIQENIKRVCPGETDPNMVMFITRLISNNISQIDYVKNFHSGSYQDAGHAERFIG
FT                   VGIGFKEVHLRNLTYFAHLETVEQGAPDLDVGVKIFTGLNISRSLPIPIVIRFDYSGSV
FT                   PHARNRALSDCHRINEAIKSRYRDLIDNGSLHTFLTIRDRDKKAPAEVVGSSLDPVTQE
FT                   AH"
FT   gene            542830..543105
FT                   /locus_tag="PMN2A_1883"
FT   CDS_pept        542830..543105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1883"
FT                   /product="putative carboxysome peptide A"
FT                   /note="Alternative locus ID: NATL2_05901"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1883"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59371"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014076"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM7"
FT                   /protein_id="AAZ59371.1"
FT                   /translation="MLICKVLKPLVSTNRIPGFEHKHLQVVLDGSSKKVAVDAVGCKPD
FT                   DWVICVGSSAAREAAGSKSYPSDLTIVGIIDHWDPETQQQISGGAK"
FT   gene            543105..543356
FT                   /locus_tag="PMN2A_1884"
FT   CDS_pept        543105..543356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1884"
FT                   /product="putative carboxysome peptide B"
FT                   /note="Alternative locus ID: NATL2_05911"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1884"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59372"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014077"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM6"
FT                   /protein_id="AAZ59372.1"
FT                   /translation="MEIMQVMGRLVCTQRVEGLGHMHLRILCNNKGKRLVAVDPVGARE
FT                   GNWVFTATGTAARWGCPDPNVQTDLTIGGIIDHWNPDD"
FT   gene            543401..543949
FT                   /locus_tag="PMN2A_1885"
FT   CDS_pept        543401..543949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1885"
FT                   /product="carboxysome shell peptide, CsoS1"
FT                   /note="Alternative locus ID: NATL2_05921"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1885"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59373"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM5"
FT                   /protein_id="AAZ59373.1"
FT                   /translation="MTNSSNRRPKSSNKTIKPKDQVVDVTPLNSTTKSKNSSRIQSSSA
FT                   EKASNTKSIPSAKNLSNASGGGGSFNARIGQNKAFETKSNFGIALGMIETRGLVPAIEA
FT                   ADAMTKAAEVNLIVKELVGGGYVTVMVRGETGAVNASVRAGADACERVGDGLVAAHIIA
FT                   RPHGEIEPALRGSGAKRRS"
FT   gene            544025..544288
FT                   /locus_tag="PMN2A_1886"
FT   CDS_pept        544025..544288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1886"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_05931"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1886"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59374"
FT                   /db_xref="GOA:Q46GM4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM4"
FT                   /protein_id="AAZ59374.1"
FT                   /translation="MEGWRQKKRPECLEKRFEFQSYEKNRDFLDALGEYCEKVNRFPDI
FT                   SFGKTYANITIRPEENNVKEEISNDDHDFASEIDFLNKQEEN"
FT   gene            complement(544285..544515)
FT                   /locus_tag="PMN2A_1887"
FT   CDS_pept        complement(544285..544515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1887"
FT                   /product="conserved hypothetical"
FT                   /note="Alternative locus ID: NATL2_05941"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1887"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59375"
FT                   /db_xref="InterPro:IPR021483"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM3"
FT                   /protein_id="AAZ59375.1"
FT                   /translation="MSTAKLTIGELEAGYPLYCKALRRLLQQGRTADQIQRTVCWSHLE
FT                   TLNRCLPGRYKTPSYLMALIKRDLEQPKEED"
FT   gene            complement(544603..545010)
FT                   /locus_tag="PMN2A_1888"
FT   CDS_pept        complement(544603..545010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1888"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="Alternative locus ID: NATL2_05951"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1888"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59376"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GM2"
FT                   /protein_id="AAZ59376.1"
FT                   /translation="MKSSSIEAIETKFAPKPVGPYNQAILVENYLYCSGQIALDPSTGV
FT                   MVGNGNIEEETRQVLKNLMAVVEAAGGKSSAVIRTTIYLTDLNDFAKVNEIYAETFNKT
FT                   VSPARACVEVSKLPKGGKIEIDCIAWLENKK"
FT   gene            complement(545056..545850)
FT                   /locus_tag="PMN2A_1889"
FT   CDS_pept        complement(545056..545850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1889"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="Alternative locus ID: NATL2_05961"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1889"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59377"
FT                   /db_xref="GOA:Q46GM1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GM1"
FT                   /protein_id="AAZ59377.1"
FT                   /translation="MKWTLITPLPKETMLGKKSDFTIHPINVLQDNIVWVWVHNCNAVV
FT                   VDPSISGPVEKWLLEKNLSLKAILQTHHHDDHIGGTQKLIKTWPEAKVVASKKEHKRIP
FT                   FQTFSVDDNDIFNLMDAEIKVIEVHGHTDNHIAFYISKQNAKCNILFPGDTLFGGGCGR
FT                   LLEGSPVQMFESLYKLNSLPENTEIYPAHEYTESNLKWALSLEPGNISIIERLKLIQKK
FT                   LQKGMSSLPSTLSEERKTNLFLIAENVEKFTMLRKHKDRWKC"
FT   gene            545862..546524
FT                   /locus_tag="PMN2A_1890"
FT   CDS_pept        545862..546524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1890"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="Alternative locus ID: NATL2_05971"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1890"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59378"
FT                   /db_xref="GOA:Q46GM0"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46GM0"
FT                   /protein_id="AAZ59378.1"
FT                   /translation="MFTVALAKGALLQESVSMFSDVGLDFSAVLDDSNRQLMVPSACGR
FT                   AKALLVRNSDVPVYVSYGQAQLGIVGFDVLQEQKLQVSNLVDLGFGECHMSVAVKSSSG
FT                   YLSASDLPPNCRVASKFTNCAKHFFDQIDLPVQLVHLSGSVELGPITGMAEAIVDLVAT
FT                   GRTLRDNGLVEIEELFKSSARLVGHPLSLRLDKGPLQEIIDSIQIQSQTNLLSDGKK"
FT   gene            546511..548307
FT                   /locus_tag="PMN2A_1891"
FT   CDS_pept        546511..548307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1891"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_05981"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1891"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59379"
FT                   /db_xref="GOA:Q46GL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GL9"
FT                   /protein_id="AAZ59379.1"
FT                   /translation="MAKNDFRRIKKLGKYLKREKKRLILILLILIPVALAGSIQPLLVG
FT                   QAISVLRGEDTIAFFNNLPKELTINFIIGILFITVLLRLGLQGFQSYNIQSVGQRLTAR
FT                   IRNDLFAHSMSLSLRFHDKMPVGKLLTRLTSDVDALSEVFGSGAVGVLADFVSLIVISI
FT                   TMILIEWRLGLLLLIVQIPVTLFILWLQKRYRKQNYKVREELSQLNANFQENLQGLEVV
FT                   QMFRRQSLNGQNFFKTGTNYKNAVNGIIFYDSSISAFIEWVSLAAVALVISLGGYMVTA
FT                   GAMGLGTLTTFILYSQRLFEPLRQLAERFTQIQGGLTAVERIGELLEKKIEIYDHINHK
FT                   AENKESLNSNKTVLGEVLFENVSFFYREDEPIINDLSFKIKPGEHVALVGPTGSGKTTL
FT                   IRLLCRLYEPQKGNIYIDGQNIKSIPIDSLRKQLGVVLQDTFLFSGNVADNLRLDSSID
FT                   NQRLKDVCSDLGLDNLLRKLPNGLDTYIRERGGNLSSGERQLLSIARVAIRDPKILIMD
FT                   EATAFMDPSTEATLQRDLDRLLEKRTALVIAHRLATIEASDRILVMRKGSLIEEGTHEE
FT                   LRALGGLYSQLSELQEKGLATI"
FT   sig_peptide     546511..546621
FT                   /locus_tag="PMN2A_1891"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.882 at
FT                   residue 37"
FT   gene            548321..548863
FT                   /locus_tag="PMN2A_1892"
FT   CDS_pept        548321..548863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1892"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Alternative locus ID: NATL2_05991"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1892"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59380"
FT                   /db_xref="GOA:Q46GL8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GL8"
FT                   /protein_id="AAZ59380.1"
FT                   /translation="MINLGSTKIGMSGWKNEKLLSDETLKNIYGKQAFQYFNQTNSSLF
FT                   VFSHSKSFDLIELEQLLQAVGWGRRPLRRVKRALDNSLIKVGLWQHDPKFPKLIGFARC
FT                   TGDGIIDATIWDVAINPVYQGYGLGKQLMEYLMKSLKREGISRVTLFADSDVITFYKRQ
FT                   GWTLEPKGNKCAFWYSN"
FT   gene            complement(548887..549591)
FT                   /locus_tag="PMN2A_1893"
FT   CDS_pept        complement(548887..549591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1893"
FT                   /product="glycosyltransferase"
FT                   /note="Alternative locus ID: NATL2_06001"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1893"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59381"
FT                   /db_xref="GOA:Q46GL7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GL7"
FT                   /protein_id="AAZ59381.1"
FT                   /translation="MARSQKIPALSIIIPTLNEADHLPLLLADLNEWPYNFELIIVDGG
FT                   SIDLTISIAQIQGIDVIKSSKKNRGYQLKKGASNARGDWLLFLHADSRLRPTWFKNLSQ
FT                   IIQNKKSENFAWYFDFKIKKHNLEFRFLEIAVALRSYFLQHPYGDQGLLIHKDLYSNTG
FT                   GYSSLKIMEDIDLITRITKKTKVKRIRENIYTDDIKWTNSNIIKRAIKNAKLRNKWRQG
FT                   FDIDYLSKEYNS"
FT   gene            complement(549540..550271)
FT                   /locus_tag="PMN2A_1894"
FT   CDS_pept        complement(549540..550271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1894"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06011"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1894"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ59382"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q46GL6"
FT                   /protein_id="AAZ59382.1"
FT                   /translation="MNLAISKTKSTKKLSVNSKPTIVLMTKWHAIFRCKSRLAKDIGAF
FT                   KAAKIQEKLTNHTIKVAKEIQKKGLAEIKVAIDGIGIKAAKKWAVLNKIKTVEIQGPGN
FT                   LGTKMKRQFSKTHSEKNLSHQIQNPILIIGSDLPSISHFELIQAIQILNHKEMVLGPSN
FT                   DGGYWLIGLSNKLLNPLCAWPFSGISWGSDKVLKETIRLASFNQIDYQLLQTKNDLDNI
FT                   MDLSPWLDHKKFLLSASSYQL"
FT   gene            550495..551895
FT                   /locus_tag="PMN2A_0001"
FT   CDS_pept        550495..551895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Alternative locus ID: NATL2_06021"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57493"
FT                   /db_xref="GOA:Q46LY5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY5"
FT                   /protein_id="AAZ57493.1"
FT                   /translation="MPVPTRDELWTKVQQLLQKNLSKPSYETWIRPAEFFDFKDGCLTL
FT                   IAPNSFSSDWLRKNYSQTIEEIASEIFGHEVKVCIKVKEEFSSNKSNKKKNYSNVEANS
FT                   IATSENYDVKSKQTQIKKFLPSLNLRYVFNRFVVGPNSRMAHAAAMAVAEAPGREFNPL
FT                   FICGGVGLGKTHLMQSIGHYRLEIDPGAKVAYVSTETFTNDLIVAIRKDGMQAFRNRYR
FT                   EADLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVLTSDRPPSQIPRLQERLISRF
FT                   SMGLIADIQAPDLETRMAILQKKAEHERMRLPRDLIQFIAGRFTSNIRELEGAFTRAVA
FT                   FASITGLPMTVESVAPMLDPTGQGVEVKPKQVLEKVAEVFGVTEEEMRSPSRRRPVSQA
FT                   RQVGMYLMRHGTDLSLPRIGESFGGKDHTTVMYAIEQVEKKLSSEPQLASQVQKVKDLL
FT                   QIDSRKRR"
FT   gene            complement(551932..553173)
FT                   /locus_tag="PMN2A_0002"
FT   CDS_pept        complement(551932..553173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0002"
FT                   /product="glutaredoxin-like domain/phycoerythrin related
FT                   domain fusion"
FT                   /note="Alternative locus ID: NATL2_06031; related to
FT                   GSH-dependent dehydroascorbate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57494"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY4"
FT                   /protein_id="AAZ57494.1"
FT                   /translation="MNPTRNAMSWEELAIYAADPVDQINGLNNPYSSLRLFNKNESQAI
FT                   VTLYRDNHAWCPYCQKVWIWLELKNIPYRIKKVTMRCYGEKERWYLKKVPSGMLPAIEI
FT                   ENHVITESDEILFVLEEIYGPLGQSLNENKVLEHRRLERELFSSWCNWLCRNSLFQAQE
FT                   EQKKENFKNVANKFEKELQKNASRWLTPVSTKNGEKPGSADVIFIPYVERMNASLAYYK
FT                   GYSLREEHPIINIWLKNLEKLEEYRGTQGDFHTHAHDLPPQMGGCFTYSNKNQQLFAQE
FT                   IDIGAGLGQLELVDFKVDQKSEQHFEALALERVIRHKERIVSVSPMKNKLFDQPLRAAL
FT                   TSMISKKDCRPEENSASALRYLRDRISVPRDMPLLSGRLFRQALERTANIDGSDLGPKI
FT                   PTRNRLDQNPIQFN"
FT   gene            553215..554576
FT                   /locus_tag="PMN2A_0003"
FT   CDS_pept        553215..554576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0003"
FT                   /product="NADPH-glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="Alternative locus ID: NATL2_06041"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57495"
FT                   /db_xref="GOA:Q46LY3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY3"
FT                   /protein_id="AAZ57495.1"
FT                   /translation="MKSSFDLIVIGAGSGGLAAAKKAASYGASVAIVEGDLVGGTCVIR
FT                   GCVPKKLLVCGSSLLESFLSATSYGFDFDNIKIKSEVLLANIRKEVQRLNELHENFLNK
FT                   ANVELFKGWGEFRNSNCVEVKDRKNGETLNELYGERILIAVGGRPKRPSIEGASLGWTS
FT                   DDMFLLKSFPKKITIVGAGYIACEFACILHGLGVEVTQLVRGDRILRGFDFELSSALTE
FT                   AMKNKGVNISFGEQISSLKGTPGSLIIKTNAGKEFDSNGLLFATGREPFLDGLKLEQVG
FT                   IEILENKIKVDSEGKTNISNIFAIGDVTDRINLTPVAIDEGRKFADRNYGESDHKVNYN
FT                   FVPYAVFSQPEIASVGMTEEKAIQSMGKDNIKVYRSIFRPLSKSLPKTGSKCILKLIVD
FT                   KNNNKVLGCHMIGDNASEIIQMASISLMLGAKKSDFDNTMALHPTIAEEFVTMR"
FT   gene            complement(554590..555684)
FT                   /locus_tag="PMN2A_0004"
FT   CDS_pept        complement(554590..555684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0004"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /note="Alternative locus ID: NATL2_06051"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57496"
FT                   /db_xref="GOA:Q46LY2"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY2"
FT                   /protein_id="AAZ57496.1"
FT                   /translation="MPSILLSFLELIAGILLLFSGGEFFIQGSVALALILGIPQLVIGL
FT                   TIVSLGTSAPELFVSVNSSLNGSDSLALSNIVGSNIFNVMVVLGGSALLRPLRVESRLV
FT                   RRDIPLLLAVSTAVWGMAASELITWQFGVALIVALIINTTWEIRTAREEPQKTQEAEPE
FT                   INIEKDSTSLLKAGVKLLGGIFLLTLGSRLLIEGASTIAGLLGVSEAIIGLTIVSLGTS
FT                   LPELITSLVAAIRGQTDLAIGNVIGSCLLNQLLVLGSCSLLSGGSGLVVESLLITKDIP
FT                   IMVITTLACMPIFWTKGIISRGEGGVLLGLYMLYIADKIIPLTLPTLHTAFKELVFIAI
FT                   LLAITIIIYKTIAYWLRLRKSSNN"
FT   gene            555833..556897
FT                   /locus_tag="PMN2A_0005"
FT   CDS_pept        555833..556897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0005"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="Alternative locus ID: NATL2_06061"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57497"
FT                   /db_xref="GOA:Q46LY1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LY1"
FT                   /protein_id="AAZ57497.1"
FT                   /translation="MIASVNQISLLKPDDWHLHLRDGKILKGVLSHTADVFCRAIIMPN
FT                   LDPPITTLSQAQEYKKRIIQSIPKGVSFTPLMTAYLTDDMPANVLERGFREGVFHGAKL
FT                   YPANVTTNSSYGVTDISKVSNLFETMERIGMPLLIHGEVTDFNVDVFDREAVFIERHLE
FT                   PLLRTFSSLKVVLEHITTIDAIDFVEKSEFDIAATITPHHLHINRNAMFNGGLRSDFYC
FT                   LPTAKREIHRIALRQAATSGKPCFFLGTDSAPHTRRFKESSCGCAGIFNAPFALESYLK
FT                   VFEEENALDRFEAFSSINGATFYGLPLNTERITLIRKDISVPQMIDVGLDGDPNDFVKP
FT                   FHSGETLRWAIEDV"
FT   gene            556890..557087
FT                   /locus_tag="PMN2A_1935"
FT   CDS_pept        556890..557087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1935"
FT                   /product="Hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06071"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1935"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23870"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDD2"
FT                   /protein_id="ABU23870.1"
FT                   /translation="MFSEIADPYVKQFDLMTFGGWKTLKAMQVYLQTNIHPLNRCGEAI
FT                   HKRIPATRLELVRPLRISGF"
FT   gene            complement(557035..557120)
FT                   /locus_tag="PMN2A_R0001"
FT   tRNA            complement(557035..557120)
FT                   /locus_tag="PMN2A_R0001"
FT                   /product="tRNA-Leu"
FT   gene            557330..557599
FT                   /locus_tag="PMN2A_0006"
FT   CDS_pept        557330..557599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0006"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06081"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57498"
FT                   /db_xref="GOA:Q46LY0"
FT                   /db_xref="InterPro:IPR019654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LY0"
FT                   /protein_id="AAZ57498.1"
FT                   /translation="MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLLVVPLFLFYW
FT                   MNNRWNVMGKLERLFIYGLVFLFFPGMILFAPFLNLRMNGKEGS"
FT   gene            557603..557935
FT                   /locus_tag="PMN2A_0007"
FT   CDS_pept        557603..557935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06091"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57499"
FT                   /db_xref="GOA:Q46LX9"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX9"
FT                   /protein_id="AAZ57499.1"
FT                   /translation="MTRAQVFQIGFIVFVLGGLGYEMFQLLGFESISAGIAAQSILILI
FT                   IFAWTASYLFRVFSGNMTFMEQRKRYREAYEKLTDEKIREKFEAMTDDEKNELLKSVEE
FT                   ESIEQT"
FT   gene            558019..558834
FT                   /locus_tag="PMN2A_0008"
FT   CDS_pept        558019..558834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0008"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="Alternative locus ID: NATL2_06101"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57500"
FT                   /db_xref="GOA:Q46LX8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LX8"
FT                   /protein_id="AAZ57500.1"
FT                   /translation="MKSTNISRSFSKIKKEKRIALMPFLMAGDPDLETTAKILLELQAN
FT                   GADMIELGIPYSDPLADGPIIQLAASRALSAGTSPDRVFKMLFELRDQLTIPIILFTYS
FT                   NPLINKGLEEFCLQASKVGVSGLVVPDLPLEEAEKLSDIAESKEIDLVLLVAPTTPKDR
FT                   MKRIAATSNGFTYLVSVTGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIE
FT                   QVREWGADGAIVGSALVKRIANASIEMKVEEAGSFCKELRAATNEYFFK"
FT   gene            558912..559181
FT                   /locus_tag="PMN2A_0009"
FT   CDS_pept        558912..559181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0009"
FT                   /product="uncharacterized YCII family conserved protein"
FT                   /note="Alternative locus ID: NATL2_06111"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57501"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX7"
FT                   /protein_id="AAZ57501.1"
FT                   /translation="MDKFVLWGSYCEDALLKRTPFREEHLQRLSLLKEKGILITLGPTK
FT                   CNRYVFGIFKSGDIEYIRSLIKEDVYWREGIWTDFEIYSWTQAF"
FT   gene            complement(559157..559528)
FT                   /locus_tag="PMN2A_0010"
FT   CDS_pept        complement(559157..559528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0010"
FT                   /product="cytochrome c"
FT                   /note="Alternative locus ID: NATL2_06121"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57502"
FT                   /db_xref="GOA:Q46LX6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX6"
FT                   /protein_id="AAZ57502.1"
FT                   /translation="MKKNTNFFFIKLRVFFLISICCTFFYLSLPKELNAIEADSGRTLF
FT                   NHNCAGCHINGGNIIRRSKNLKISSLKRNGIDNPEAIAKIARQGVGIMSGYEDELGDNG
FT                   DQIVANWVWEQAQKAWVQE"
FT   gene            complement(559542..559874)
FT                   /locus_tag="PMN2A_0011"
FT   CDS_pept        complement(559542..559874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06131"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57503"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX5"
FT                   /protein_id="AAZ57503.1"
FT                   /translation="MSKERWSKDIEEDLVLLIKDWLRQTGRTQSELCRSLNLPSARMPT
FT                   LIESLKKDFSSGGIPKIANRLCEVEELWTNGEEGKTKKSFELNSSGQLDLLDEICEDLS
FT                   KINFNK"
FT   gene            complement(559871..560236)
FT                   /locus_tag="PMN2A_0012"
FT   CDS_pept        complement(559871..560236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06141"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57504"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX4"
FT                   /protein_id="AAZ57504.1"
FT                   /translation="MVSSRNSNKEVFEAEVLESSVIDEGVLKKILLRAGRVIAQPALEG
FT                   FELIMDNTTPPQVRLSIMGALTYLIVPFDLIPDFIPASGFSDDLVALTAVISLWQHHIT
FT                   PEIKFRAKSKLDKWFPL"
FT   gene            complement(560239..561162)
FT                   /locus_tag="PMN2A_0013"
FT   CDS_pept        complement(560239..561162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0013"
FT                   /product="possible type II alternative RNA polymerase sigma
FT                   factor"
FT                   /note="Alternative locus ID: NATL2_06151"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57505"
FT                   /db_xref="GOA:Q46LX3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX3"
FT                   /protein_id="AAZ57505.1"
FT                   /translation="MSSLSDFLGEIGRHELLTPEQELTLGREVQAMVALNERCQQAGGH
FT                   GPECEYSSAEKKKFKAGERAKNQMITANLRLVVNLAKRYQGKGLDLLDLIQEGTLGLTR
FT                   AVEKYDPKRGHRFSTYAYWWIRQGLNRALSTQSRTIRIPVNINEKLTKLRAAKSRLMQE
FT                   LGVHPSTNQIAIQMKIPLEEVEELLACELRSITVSLQGAVKSKADPSELVDILPSEEVP
FT                   PMELAELAERSASAWSLLDKSNLTPKERTILSLRFGLDGSNEWRTLAEVARQMNCSREY
FT                   CRQVVQRALRKLRKTGIQSGLLEKSI"
FT   gene            complement(561456..561575)
FT                   /locus_tag="PMN2A_1936"
FT   CDS_pept        complement(561456..561575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_1936"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06161"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_1936"
FT                   /db_xref="EnsemblGenomes-Tr:ABU23871"
FT                   /db_xref="UniProtKB/TrEMBL:A7MDD3"
FT                   /protein_id="ABU23871.1"
FT                   /translation="MVERQRIKLIKSLEREKNKSTDFLKSLVIYRLPKIRSSA"
FT   gene            complement(561625..562269)
FT                   /locus_tag="PMN2A_0014"
FT   CDS_pept        complement(561625..562269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0014"
FT                   /product="phosphoribosyl-ATP pyrophosphatase /
FT                   phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="Alternative locus ID: NATL2_06171"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57506"
FT                   /db_xref="GOA:Q46LX2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX2"
FT                   /protein_id="AAZ57506.1"
FT                   /translation="MFFIDNLHFDQNGLIPAIAQDWVDGAVLMMAWMNKESITKTLESG
FT                   EVHYWSRSRKELWHKGKTSGHFQKLKGIRTDCDSDTILLSIEQIGSIACHTGKRSCFFK
FT                   DLETNKDVLHPPSNACSELFNVIESRKSNPEEGSYTNTLLKEGDNKILKKIGEETAEFI
FT                   MACKDKNPISVANEAADLLFHMQVSLAHQNVSWEEVLKVLVKRRGAPRRNQ"
FT   gene            562347..562817
FT                   /locus_tag="PMN2A_0015"
FT   CDS_pept        562347..562817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06181"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57507"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX1"
FT                   /protein_id="AAZ57507.1"
FT                   /translation="MTIKDITFNCSKHFKDYPCSHRQWKHKGHCRYVHGYSRSFTFYFA
FT                   SNKLDENGFVVDFSSLRPLEEHLKDHFDHTFLVNSDDPFLETWKELHSKEVLDLRVMNN
FT                   VGMESTAELVWGWANDLLFSREKGRSCCWRAIAHENDVNSASYTFLPEWFTP"
FT   gene            complement(562873..565464)
FT                   /locus_tag="PMN2A_0016"
FT   CDS_pept        complement(562873..565464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0016"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_06191"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57508"
FT                   /db_xref="GOA:Q46LX0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LX0"
FT                   /protein_id="AAZ57508.1"
FT                   /translation="MKVNPDDFTNNAWQGIIDAKDLALIEKHQTLETEHLFWSLLKKNE
FT                   IAIKIIERSGGVIKNLLTEIESFIKNQPKMLLAQESIFFGKKISLSISRAKNIQQSFKD
FT                   DFISSEHLVISLFDDERICNRLFEENNVDKNSLLEAINALRGDKKVTQKNAENSYEALQ
FT                   KYGLDLTSAARDGKLDPVIGRDEEIRRTIQILSRRTKNNPVLIGEAGVGKTAIIEGLAQ
FT                   RIINGDVPTALENRQLISLDMGALIAGAKFRGEFEERLKSVLKNVTDSEGKIILFIDEI
FT                   HTVVGAGASGGAMDASNLLKPMLARGELRCIGATTINEHRENFEKDPALERRFQQILVK
FT                   QPSVQDTISILRGLKERYEVHHGVRISDNALIAAAILSDRYIPERFLPDKAIDLIDESA
FT                   SRLKMEITSKPEEIDEIDRKIIQLEMEKLSLEGESDTSSKERLELITSELALLTKNQIE
FT                   VNKKWKREKESIEEISTLKEEIEKVQLEIEKAKRNYDLNRAAELEYGTLVNYQQNLKSK
FT                   ELNLKNSSQNAEKSLLREEVVADDVAEIIAKWTSIPVKRLAQTEIEKLLNLESELQKKV
FT                   IGQDKAVQSISSAIQRSRTGLSDPSRPIASFLFLGPTGVGKTELSKALASQLFDSENSL
FT                   IRIDMSEYMEKHSVSRLIGAPPGYVGYEAGGQLTEAIRRKPYCVLLFDEIEKAHKDVFN
FT                   VLLQILDEGRVTDGQGRTTNFKNTIIILTSNLGSELISENDVTNDPLTNIDELINQELK
FT                   SNFRPEFLNRLDEIINFEPLKKETLLKVVDLQLNRLRERLGAKGIELKIDDDVLFFITE
FT                   LGYNPSYGARPLKRVIQKELESEIARYILKGKYKEGCTIKIENKESKLIFH"
FT   gene            complement(565844..566194)
FT                   /locus_tag="PMN2A_0017"
FT   CDS_pept        complement(565844..566194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0017"
FT                   /product="plastocyanin"
FT                   /note="Alternative locus ID: NATL2_06201"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57509"
FT                   /db_xref="GOA:Q46LW9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002387"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW9"
FT                   /protein_id="AAZ57509.1"
FT                   /translation="MIRSISTALFAFFAFLVIGVTNVNASTVEVKLGTDAGMLAFEPST
FT                   LNISAGDTVKFVNNKLAPHNAVFDGNDDLSHPDLAFAPGESWERTFSTAGTYDFYCEPH
FT                   RGAGMVGKIVVN"
FT   gene            complement(566249..567235)
FT                   /locus_tag="PMN2A_0018"
FT   CDS_pept        complement(566249..567235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06211"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57510"
FT                   /db_xref="GOA:Q46LW8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW8"
FT                   /protein_id="AAZ57510.1"
FT                   /translation="MKNEIILITGASGCVGQYIANWLIENSTSELFLWVRDPKKITSIN
FT                   LENPRIKILVGDLRESNKFKKEISEVNRVIHTATAWGDPKRAKEVNIDAVKNLLNLLNP
FT                   SNIKQIIYFSTASVLDRNLNLLPEAFTYGTEYIQTKAQCLRELESHQLATKIIAVFPTL
FT                   VFGGRLDGKSKFPTSYLTEGLRDALRWIWLARWIKLSSRFHFIHAADIAFICGHLANSD
FT                   FEPVQPFSATKIKKLVLGQPYTSIDVVIQTLLIWKGMRRVPQIPILPWLIELITILLPI
FT                   QMTNWDRFSLRQKHFIHEPVTSPETFGGISHAKTLSQVLHNSGLTKH"
FT   gene            complement(567232..568290)
FT                   /locus_tag="PMN2A_0019"
FT   CDS_pept        complement(567232..568290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0019"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="Alternative locus ID: NATL2_06221"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57511"
FT                   /db_xref="GOA:Q46LW7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LW7"
FT                   /protein_id="AAZ57511.1"
FT                   /translation="MNETTPLLLRAARGENVERPPVWMMRQAGRYMKVYRDLRDNHPSF
FT                   RERSENPDLSYEISMQPFKAFQPDGVILFSDILTPLPGMGINFDIVESKGPLINDPIRS
FT                   LKQVKDLKPLQPEESMSFVGEVLGRLRESVGNKAAVLGFVGAPWTLAAYVVEGKSSKNY
FT                   AVIKAMAFQEPELLHQLLNHFAESIANYLSYQIQSGAQVVQMFDSWAGQLSPQDYDEFA
FT                   APYQQKVVNLVKEKHPDTPMILYISGSAGVIERMGQTGVDIVSLDWTVDMADGLKRLPQ
FT                   AVGVQGNVDPGLLFGTPDAIRSRIVDVVRKAKGRKHILNLGHGILPGTPEENARVFFEA
FT                   GKNVNELIKVSS"
FT   gene            complement(568452..570719)
FT                   /locus_tag="PMN2A_0020"
FT   CDS_pept        complement(568452..570719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0020"
FT                   /product="glycogen branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="Alternative locus ID: NATL2_06231"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57512"
FT                   /db_xref="GOA:Q46LW6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LW6"
FT                   /protein_id="AAZ57512.1"
FT                   /translation="MTVSILLDSLKDDGQRLSECRHESPFSILGPQPFKDKWIIRIWMP
FT                   EASQVELVTQQTKIKLQNPNHEWIFEGVLEKDPGTDYQIKVNRGGIEHVQHDPWSFRKE
FT                   WMGEIDRHLFAEGNHHHIWRKMGAHLTEIDKKKGVMFCLWAPHAKSVSVIGDLNSWDGR
FT                   HHPMQKRLGGIWELFIPGLSEGDLYKYEIRTEKGHCYEKADPYGFQHEVRPAKSSVISK
FT                   IDSFQWSDQSWISNRDNRDPLEQPISVYEMHLGSWMHASSDDPFINSNGEHRAPVPAAD
FT                   MKPGSRLLTYKELANKVIPYVKERGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRFGS
FT                   PDEFRAFVDSCHKEGIGIILDWVPGHFPKDQHGLAYFDGSHLYEHSDPRVGEHKEWGTL
FT                   IFNYSRNEVRNFLVANLIFWFDQFHIDGIRVDAVASMLYKDYLRPEGEWIPNEDGGNEN
FT                   FEAVRFLQQANHVLFQHFPGALSIAEESTTWTGVTKPTDMDGLGFNLKWNMGWMHDMLD
FT                   YFEIDPWFRQFNQNNITFSICYNFTENFMLALSHDEVVHGKSHLLHKMPGDDWQKYANT
FT                   RALLAYMWTHPGKKTIFMGMEFGQRQEWNVWDDLQWDLLNYEPHKGIQKLVDDLNNLYK
FT                   REPALWRNDFDEYGFQWIDCDDNKNSVISFMRREKTDGEWLVIVANFTPQNHSNYRIGV
FT                   PVDGFYEEIFNTDASQYGGSNLGNMGGKSTDLYNIHGYENSIDLCLPPLSVLVLKHKSK
FT                   KN"
FT   gene            complement(570776..572353)
FT                   /locus_tag="PMN2A_0021"
FT   CDS_pept        complement(570776..572353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0021"
FT                   /product="alpha/beta superfamily hydrolase"
FT                   /note="Alternative locus ID: NATL2_06241"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57513"
FT                   /db_xref="GOA:Q46LW5"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW5"
FT                   /protein_id="AAZ57513.1"
FT                   /translation="MNSIRYRDEDLQLRDGTVLKSRIWSPQGNGPWPVLLMRQPYGREI
FT                   ASTITYAHPSWWASKGYLVVIQDVRGQGGSGGEFSGFNQEASDTSQTHNWVRSLPECNG
FT                   LLGTYGFSYQGLTQLIAEEGTPPPDCIIPAMTGLSEDEHWSCEGGAFWWHLGIGWGLQL
FT                   AAQKAQREKNWKGWHEIRENLESKKYLYNGHDLLEKYDPEGMAHKWLNLSSSKTPQWKT
FT                   HKPLSSWLKKPLLLIGGWWDPHLKGILDIFEKAKKAGGNPKLLIGPATHLQWWEGAQRT
FT                   QLDFFDSHLKEKNKESHFSQINLWNLTTKGWELSVQNKTPTWSLRSEGLASINHLEGFL
FT                   APNSDLEADSEVNLVHDPWRPIPSIGGHLSDTAGEANRYQLDIRPDVAVFTSDPILKDL
FT                   RLEGIPTLFLETNCDRECFDLFVALSIIPKAVENTVTQLSTGVLRIADCDKGITSAREI
FT                   RLQPILATFKKGDRLRISISGSGWPAIGINPGKSKYLCEGPSPNCLVTTISLLLLNSKL
FT                   KFESLISS"
FT   gene            complement(572361..572630)
FT                   /locus_tag="PMN2A_0022"
FT   CDS_pept        complement(572361..572630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06251"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57514"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW4"
FT                   /protein_id="AAZ57514.1"
FT                   /translation="MNGLLITLIFASFGINQGVIAQSRLLEGVKRNPDEAKSICESFRK
FT                   LNKENISAGSQKSIQKISIQKNISEGDAEILSMYVRGLYCPETF"
FT   gene            complement(572678..573094)
FT                   /locus_tag="PMN2A_0023"
FT   CDS_pept        complement(572678..573094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0023"
FT                   /product="conserved hypothetical"
FT                   /note="Alternative locus ID: NATL2_06261"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57515"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW3"
FT                   /protein_id="AAZ57515.1"
FT                   /translation="MSNKSFLKDLPKSFYQEEKILISNNIKTWDSLLSISDEEINNLIY
FT                   GSLGSVRNLKRLKCIAYFICTLDIQLSEAALLMHSGLISNKAISRLTPQELVQKTGRFE
FT                   RTLRTGRIPIIDLKKAHFLIEKAKKNLFNVPKCH"
FT   gene            complement(573087..573626)
FT                   /locus_tag="PMN2A_0024"
FT   CDS_pept        complement(573087..573626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0024"
FT                   /product="uncharacterized membrane protein"
FT                   /note="Alternative locus ID: NATL2_06271"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57516"
FT                   /db_xref="GOA:Q46LW2"
FT                   /db_xref="InterPro:IPR019664"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW2"
FT                   /protein_id="AAZ57516.1"
FT                   /translation="MSMIEVIQDVTKWLAWVGAGLGVLTILAYLFNWGIKFRLTGTTIF
FT                   TLLLSASCWAFEQSYTPPFNVEGYKYAPIVYDNGFDLVVAQASNDFPKEAIKPTLLQIA
FT                   GNLKGGGRNGAQVKVRLRKIESAGDGTSKPIILGELINDLKESKIIELPDRNYSASENF
FT                   SNDADIEEISLLETDE"
FT   gene            573694..577653
FT                   /locus_tag="PMN2A_0025"
FT   CDS_pept        573694..577653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06281"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57517"
FT                   /db_xref="GOA:Q46LW1"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LW1"
FT                   /protein_id="AAZ57517.1"
FT                   /translation="MGDEWSSKRLKRWGLAGTFAALGGVLIWSGADLLVDRTISRFSPQ
FT                   IEKTLSNSLGHPLKIGSYRGLRPWGVELGPTRLLPGIKDSSSVNISNLTIKFAPFASLL
FT                   NWKPVAIFNPKGTEIILNKNDTGSFWVVPQKDNPKQINLQLKFNLKEPTKIVFNAGDTT
FT                   LLAKGNLSLNLGEKKIFGAINLESKEQGSLYLSGKGYWDGIEFQTKVKINKLSLSIFER
FT                   ILGNNSNFIARGNINGSLKLGVKKGLIRCNGGLLLNNLTLMGGPLSDTLSTNNSKIECD
FT                   KNKLKLIDSNWNYGYWDISNSSEIPFYKKDKTYINSETTIKIKDFDHKPLSLKLKLPIS
FT                   VVDRQFIPGELNANFNLESFPLGALNPILNASLSGKLNTKGDFQGPLSSLNSTINLSLE
FT                   NPQVNGIRLREKWRGSFTRIPSEKKWGSLRMKSEGASIPANLQINFNKDGDFNDLNLNR
FT                   LGGEISLNPKSNAFEWEANKFKLDRVEVAFPPEKSFKRIFGEVTGNGLFSLDPLFLNGD
FT                   LSLDYFRLLGFKLKNASIKGQIKNSETNLTGELIPSENGKIKFDINNGSEFSLLAQVKD
FT                   VSASWITATALEFPKLGLKYSDAIGKAEDLEKFIIGYPISSIDSQFEALTRSQDSYREE
FT                   ISKVNSESIINPYDLKGDINADIKLSGPNLSDLNLEAKAFGKVWTNKLKIINSNKIRPF
FT                   KVTFNGNLASGLGDFSLLNLNFSLLSLVAPIPSAVDGYFGLKGKYSLANSTPQVTADLI
FT                   IKDTVIYNRKIILDNGNIIFKDNNLEFDITLRDKSSANPVKLGGTYPLISSYPIDLKIE
FT                   SHGDGLAFLTGLTKGNVSWTSGTADLSLLIRGTPAKPVANGFLVLKNSELLFQDKEINN
FT                   LNSTIVFDFNRIEIRDLKANMGANGIISSQGGISLFDSQLSESEPLALSIEKTRIKTAF
FT                   TDIRASSSLVVKGSILKPQLSGEVFISEGSIFAKRAKNPSKTSSEKSDRYQDSKVRIIR
FT                   RLPEQNWNQKEPLVLFIQDEDAPASRIVSAGLPNGFESLTFDNLKLALGPSLRLVSQPL
FT                   ASFETNGFLILNGAFDETLDVSGVIKLDSGYVNLFTTTFNLDQSEPNVAVFVPSMGLVP
FT                   YIDVTLNSRVPDNVRDVSNFSSNGMASFGIGGSRFVNVEVAASGPADRISENFQLRSTP
FT                   SLGRSELIGLLGGNSLANLISSGGNGDVLASFLNRSFASYLQGNINGFLSDRLQISLYP
FT                   AYINGSDSEDDTSDSSSSSADQEDTNLPGQQAWVTEIGVDLNDKINFSVQAAPNRKDIP
FT                   PKGNITFQMNPNVGLLGSFDKNGNWQSQLQLYFRY"
FT   gene            577799..579115
FT                   /locus_tag="PMN2A_0026"
FT   CDS_pept        577799..579115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0026"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="Alternative locus ID: NATL2_06291"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57518"
FT                   /db_xref="GOA:Q46LW0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LW0"
FT                   /protein_id="AAZ57518.1"
FT                   /translation="MSTNFSVPEPTPQLVKVAESAKEASISLGQSTNKQRCEALTEMAN
FT                   ALNDNADEILKANVQDLERSEKEGLNKSLLSRLQLTKTKLKGCIDGVLKVSNLADPIGK
FT                   RQLHRELNENLILERVTVPLGVLGVIFESRPDALIQIASLAVRSGNGALLKGGSEAKDT
FT                   NQAIMDSLDKGLRKANVGSGALSLLTTRQESLGLLRLDKFVNLIIPRGSNELVQFIQEN
FT                   TRIPVLGHADGICHLYVDNSVDIDKAISIALDSKIQYPAACNAIETLLIHEDIAEMFLK
FT                   KGLPIFSSEGVTLKGDTKSQALGVKNKADESDWSKEYLDLILSIKIVRNVNEAIEHIRK
FT                   YSSRHTEAIVTEDKMVAEKFLSSVDSAGVYHNCSTRFADGFRYGFGAEVGISTQTLPPR
FT                   GPVGLEGLVTYRYYLRGDGDLVKDFASGDRSFSHIDLPL"
FT   gene            579112..579501
FT                   /locus_tag="PMN2A_0027"
FT   CDS_pept        579112..579501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0027"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="Alternative locus ID: NATL2_06301"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57519"
FT                   /db_xref="GOA:Q46LV9"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV9"
FT                   /protein_id="AAZ57519.1"
FT                   /translation="MSQLHNLSAIHIKDINLWAHVGVLESERIHGQRFLLDLSFWLELD
FT                   ESSKLDKLDKSIDYSEAVKAVKKLSFEIKCLTIEYFSDQILNLLESLYGPVPIHILLTK
FT                   CSPPIDGFTGSVLIEKKRNFLFPIN"
FT   gene            579502..580104
FT                   /locus_tag="PMN2A_0028"
FT   CDS_pept        579502..580104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0028"
FT                   /product="probable alpha/beta superfamily lipase"
FT                   /note="Alternative locus ID: NATL2_06311"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57520"
FT                   /db_xref="GOA:Q46LV8"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV8"
FT                   /protein_id="AAZ57520.1"
FT                   /translation="MYINKRPIFLVHGLWNNPKLFEKLIKKINEDDYELYRPHLPHKYG
FT                   KTSLKRLALDLDSKIEELVGPEIEIDIVGFSMGGLISRFWLQNHDGFLRTKRFFSIGTP
FT                   HFGTYTAQMIPSFLMPGIAEMKRGSRLLSLLNNDLTSLEKVECTSFFTKWDLMSFPGWQ
FT                   AKLSIGESYHLPVLTHKELITNSSSLDILVKKIFKNS"
FT   gene            complement(580101..582212)
FT                   /locus_tag="PMN2A_0029"
FT   CDS_pept        complement(580101..582212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0029"
FT                   /product="oligopeptidase A, Metallo peptidase, MEROPS
FT                   family M03A"
FT                   /EC_number="3.4.24.70"
FT                   /note="Alternative locus ID: NATL2_06321"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57521"
FT                   /db_xref="GOA:Q46LV7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV7"
FT                   /protein_id="AAZ57521.1"
FT                   /translation="MTSIKPTALLKGEGLPDYDKITPNEITENIPKLIKELNEKLDKLE
FT                   VQLEKQLQTKSSLSWDDVMPQLYEIGEKLRWSWGVVSHLNAVCNSTELRAVHSNQQPTI
FT                   VRFSNQLAQNEVIFKALLNLKEHGNIKDETQIRILETELITMKNKGIGLEADEKTLFNS
FT                   RSERLAELSTTFSNNVLDATKNWSLLLKNKSEVEGLPERALETLALAAKEAGDKDEEGN
FT                   DPSSAIGPWRVGLDLPRYIPFQTYAKNRRIREKVYRAFVSRASDGKINNKKIIEEILDL
FT                   RNKQAKLLGYKNWCEISLATKMADNEEAVEMLLEELRIAAIHHAEKEVIHLRECAKRNG
FT                   ENEDFELSPWDISFWSEVLRKEKYDLDQEKLRPWFPLDQVLDGLFNLCKRLFEIDIEEA
FT                   INTAPLWHEDVRFFNVKNIDGQKIASFYLDPFSRPATKRGGAWMDECLCRNQKTKDDIV
FT                   LPVAYLVCNQTPPIANKPSLMSFEEVETLFHEFGHGLQHMLTTINYPQAAGINNVEWDA
FT                   VELASQFMENWCLEDQTISEIAIHWKTKEPLPESEINKLRQSRTFNSGLATLRQIHFAL
FT                   TDLKLHSQWNEDLEISPDEFRREIAKNTTVMEPIPEDQFLCAFSHIFAGGYAAGYYSYK
FT                   WAEVLSSDAFAAFEEAGLANQDEVRKIGKKYRDSILSLGGSRSPNKVFKQFRGRLPSTE
FT                   ALIRHSGLN"
FT   gene            complement(582229..583803)
FT                   /locus_tag="PMN2A_0030"
FT   CDS_pept        complement(582229..583803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0030"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="Alternative locus ID: NATL2_06331"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57522"
FT                   /db_xref="GOA:Q46LV6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV6"
FT                   /protein_id="AAZ57522.1"
FT                   /translation="MADLPQIMDANLPMSIDSQTVFPWLSLIVLLPIVGALIMPFLPTQ
FT                   ESKNSNLPRNIALVILLADFLIVVLALANLFDPNSESLQLVERLQWLPSIGLEWSLGVD
FT                   GISAPLVVLSGLITFLSAAASWKVKQKTRLYFALLLIQASAQALVFLSQDFLLFFLAWE
FT                   LELVPVYLLIAIWGGKRKLYAATKFILYTALASLLILISGLALALSGDQFTFNLSEIAA
FT                   KSFTGNFGIFCYLGFLIGFGVKLPIFPLHTWLPDAHGEANAPVSMLLAGVLLKMGGYAL
FT                   IRFNVQILPDTHLILAPALIIIGIVNIIYGALNAFAQDNVKRRIACSSVSHMGFVLVGI
FT                   GAINALGISGAMLQMISHGLIAAAMFFVTGSFYERTNTLSIPNMGGLAKALPITFAFFL
FT                   ASSLASLALPGMSGFISEITVFLGITSQEGFTSLFRAITILLAAIGLVLTPIYLLSMCR
FT                   RVFFGPRIPALSIVKEMDARELSIGLSLLVPTLVIGFWPRIAIDLYEVSTNALAQSLIT
FT                   NNLVPIS"
FT   gene            complement(583840..584787)
FT                   /locus_tag="PMN2A_0031"
FT   CDS_pept        complement(583840..584787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0031"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="Alternative locus ID: NATL2_06341"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57523"
FT                   /db_xref="GOA:Q46LV5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LV5"
FT                   /protein_id="AAZ57523.1"
FT                   /translation="MGPPKIGQTVVVEVPSTTANIGPGFDCLGAALDLSNQFTIKRIEG
FT                   NAERFELIMESTEGNHLRGGPENLFYRAAQRVWRTAGIEPVALEARVKLAVPPARGLGS
FT                   SATAIVAGLVGANALAGYPLPKEKLLELAIDIEGHPDNVVPSLIGGLCVTAKTASDRWR
FT                   VVRCDWDKSIKAVVAIPSIRLSTSEARRVMPENIPVNDAVINLGALTLLLQGLRTGNED
FT                   LITDGMHDKLHEPYRWGLIKGGLEVREAAKAAGALGCAISGAGPSILALCKATKGREVS
FT                   VAMVKAWEAAGVASRAPLMSLQLTGSECISNTFG"
FT   gene            complement(584817..585842)
FT                   /locus_tag="PMN2A_0032"
FT   CDS_pept        complement(584817..585842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0032"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="Alternative locus ID: NATL2_06351"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57524"
FT                   /db_xref="GOA:Q46LV4"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV4"
FT                   /protein_id="AAZ57524.1"
FT                   /translation="MNLLAGDLGGTKTILAIYSNEKYPKKLFEKYYISSEWKSFYSLFE
FT                   DFIKHLPDHISLPQNGSIGVAGPIQNQEVKITNLGWDIESKKLSLLSKINNIELINDFS
FT                   VLIYGIPFFNRNQYEVIQGTLNSDYKNNQKLIAIIGAGTGLGMSRGLITPKSISIFPSE
FT                   GGHREFSPRTENEWALVKWLKKKLNIQRISIERIVSGTGLGMIARWKLDDPINESHPLQ
FT                   VILKNMDSDKSDSTDLPALVWEKAKNGDKLMTEALQLWLNAYGSAAGDLALQELCSSGL
FT                   WIAGGTAAKNLDGINSSNFLSAFSNKGRFQSYLKEIPLVVLKDKEATLFSSACRARLIA
FT                   E"
FT   gene            complement(585866..587791)
FT                   /locus_tag="PMN2A_0033"
FT   CDS_pept        complement(585866..587791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0033"
FT                   /product="threonyl-tRNA synthetase / Ser-tRNA(Thr)
FT                   hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /note="Alternative locus ID: NATL2_06361"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57525"
FT                   /db_xref="GOA:Q46LV3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LV3"
FT                   /protein_id="AAZ57525.1"
FT                   /translation="MPIITLPDGTEKKYDSAVTIDQIASEIGPGLAKAALAGRVNGELI
FT                   DTCIPITQNSHIQIITSKDDEGLEIIRHSFAHLLGHAVKQLYPEAKMAIGPVIEDGFYY
FT                   DISYKDTFTPDDLLKIEKRMKELVNRDYSVGVEIVSPEKAKEVFTDRGEIFKLDIVKNI
FT                   PKNEIIKLYKHQEYIDMCRGPHVPNTRHLRAFKLMKVSGAYWRGDSNNEMLQRIYGTAW
FT                   KSSKELKEYLSRIEEAEKRDHRKLGKKYSLFHSQEEAPGMVFWHPKGWTIYRILEDFIR
FT                   ETITKYDYQEVKSPQVVDRSLWEKSGHWDKFKEDMFTTTSENREYAIKPMNCPCHIQIF
FT                   NQGLKSYRDLPIRLSEFGSCHRNEPSGALHGLMRVRNFVQDDAHIFCTDEQIQEEVQNF
FT                   IDLVFEVYKTFGFDSILIKLSTRPVKRVGSDDIWDKSEKALSEALDSKGLDWSLLPGEG
FT                   AFYGPKIEFSLKDCLNRVWQCGTIQVDFSMPQRLNASYIDITGRKQTPVMLHRAILGSF
FT                   ERFIGILIENYSGNFPTWLSPIQIMIMGITDRNNEACFTAKDKLVDFGFRAEIDIRNEK
FT                   VGFKIREHTMQRIPFLIIIGDKEEENSEISVRTREGKDLGNMSIDKFKLIIDESISKKG
FT                   IQGNQS"
FT   gene            complement(587798..588811)
FT                   /locus_tag="PMN2A_0034"
FT   CDS_pept        complement(587798..588811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0034"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="Alternative locus ID: NATL2_06371"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57526"
FT                   /db_xref="GOA:Q46LV2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV2"
FT                   /protein_id="AAZ57526.1"
FT                   /translation="MNQKRVLSGVQPTGDVHIGNWLGAIRNWVELQENYETFVCVVDLH
FT                   AITTPHDPKSLYQNSLSTAALYIACGMNPDKCSIFIQSQISAHSELCWILNCLTPLNWM
FT                   ERMIQFKEKSIKQGDNVSIGLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIASQ
FT                   RVNSKFGTKENPILKVPNPLILKECSKVMSLTDGTKKMSKSDPNENSRITLLDSPDIIT
FT                   KKIKRSKTDSELGLEFGNPLRPEADNLLTIYSIISGLGREKAAEYCAEMGWGKFKPEFT
FT                   EAMINVLKPIQEKYKELMNDPEELKRILNKGKLTAEEVSKLTLNRVKEALGFYSNL"
FT   gene            complement(588812..589342)
FT                   /locus_tag="PMN2A_0035"
FT   CDS_pept        complement(588812..589342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06381"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57527"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV1"
FT                   /protein_id="AAZ57527.1"
FT                   /translation="MFMGDSYTNNQSGGGDFQNQRQNGRNNFRGGRGPNNREGGFRIRL
FT                   SDNEMRAARSLQEAFNLRSTVAVLGFAVRTLAQMLEDGNLENLVNEYRSQAPANEQRRG
FT                   RGNRGNYNGENNNSANTKPNPFARPEKPVKEQEVADTDQANNLAQDHAEKDNDEATKAS
FT                   SNEDDSTNTSEQG"
FT   gene            589573..590928
FT                   /locus_tag="PMN2A_0036"
FT   CDS_pept        589573..590928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0036"
FT                   /product="membrane associated GTPase"
FT                   /note="Alternative locus ID: NATL2_06391"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57528"
FT                   /db_xref="GOA:Q46LV0"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LV0"
FT                   /protein_id="AAZ57528.1"
FT                   /translation="MENHSLTKSPLSLPSFSIPKISLFIGLTITGQWVLSDVAHIPGGG
FT                   LGLLLGLGCIFYFLKPGKVSFDAPSTVQGWVRRCHDVLENFEYLLDDGEQSERKKERIN
FT                   SLQKIIDRSEDQSIGFLKTKGVKLPDKEQLEKVLGINNQIKVSFPPALPVRDRNWILPD
FT                   LIQEQDFIVYSLALPMSAADLLWIKNIPTDQPAWLMVASKESTDWSDERNALEAQLPDR
FT                   WTNRVLKWDGSQKEMATVLSPIKKLLENPKKNTDITKQRLLSRLHTSWQKDLEKLRREK
FT                   FKVIQTRSQWIVAGIVFASPVASTDLLAVAVVNGLMIKEMSKIWSSKMKPELLEAVSRQ
FT                   LAMAAIAQGVVEWSGQSLLSLAKLDGSSWVAAGTIQALSAAYLTRVVGRSMADWMALNN
FT                   GVTQPDLELIKQQAPQLVSKAAELERVDWVAFLKQSKEWIQSQSINYKVKSV"
FT   gene            591003..591968
FT                   /locus_tag="PMN2A_0037"
FT   CDS_pept        591003..591968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0037"
FT                   /product="ABC transporter, substrate binding protein,
FT                   possibly Mn"
FT                   /note="Alternative locus ID: NATL2_06401"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57529"
FT                   /db_xref="GOA:Q46LU9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU9"
FT                   /protein_id="AAZ57529.1"
FT                   /translation="MFNKKVISEYIYKKNKILSLSIFLALNILFLTGCVNKNTYKPGND
FT                   KPFVLTTFTILADLARNVAGDRLLVKSITKPGAEIHSYQFTPSDIVKTKGAKLIIENGL
FT                   GLEAWFSKFMISTGDIPNVKLTEGMKPLLIDGDAYSGKPNPHAWMSPKRAMKYVDKIVD
FT                   AFITIDPDGALEYSSNASTYKAKLESLDKELRDSLSSIPKERRFLVTCEGAFTYLARDY
FT                   GMKEAYLWPVNAESQVTPRRMVNLIKKIKENEVPTIFCESTVSADAQMEVAKSSGAVFG
FT                   GTFYVDSLSDLNGPAPTYIDLLRHNVRLITKGLSISKVKK"
FT   gene            591968..592765
FT                   /locus_tag="PMN2A_0038"
FT   CDS_pept        591968..592765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0038"
FT                   /product="ATPase"
FT                   /note="Alternative locus ID: NATL2_06411"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57530"
FT                   /db_xref="GOA:Q46LU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU8"
FT                   /protein_id="AAZ57530.1"
FT                   /translation="MNPIFKSHEKDFMRIEADQVCVDYNGTVALYDASLNLKAGSICGL
FT                   VGMNGAGKSTFFKALMGFVRPSRGKIRINGIKVNQAQKEQSVAYVPQNEGIDYSFPVSV
FT                   WDVVMMGRYGAMNIFRIPRESDRRAVVHALERVDLFDLRERPIGSLSGGQRKRAFLARA
FT                   IAQRASVLLLDEPFSGVDVPTEKLMAELFLQFRQEGHTILISTHDLNHVRDFCDFVVLI
FT                   NKTVLAYGETSEVFTSENLNKTFGGIPPNPLSGPTSSKDFINE"
FT   gene            592758..593630
FT                   /locus_tag="PMN2A_0039"
FT   CDS_pept        592758..593630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0039"
FT                   /product="ABC-type Mn2+/Zn2+ transport system permease
FT                   components"
FT                   /note="Alternative locus ID: NATL2_06421"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57531"
FT                   /db_xref="GOA:Q46LU7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU7"
FT                   /protein_id="AAZ57531.1"
FT                   /translation="MSEFLISITPIDWLLDPLTHDFMRRALMVSALVGGVCGLLSCYMT
FT                   LKGWALMGDAVSHAVMPGVVVAYALGLPFSLCAFVFGVGSVALIGFVKQKSRIKEDTVI
FT                   GLVFTGFFALGLVLVSKIKSNIDLMQILFGSPLGISRSDVNQTLIISFIVISILLIFRK
FT                   DLMLYCFDAKHARSIGINTGILHYLLLTLLSLSAVVGLQTVGIILVVAMLITPGATAYL
FT                   LTDRFDRMTILAVISSSFSSILGVYISYWSDIETGGSIVLVQTLIFLIAFLFAPRYGIF
FT                   KNQTLINND"
FT   gene            593643..594821
FT                   /locus_tag="PMN2A_0040"
FT   CDS_pept        593643..594821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06431"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57532"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU6"
FT                   /protein_id="AAZ57532.1"
FT                   /translation="MNNSASEQKWKWWPLLPLYPYGRRRTIFRELVPNQIWSFEQLQGI
FT                   YYVAVPVRLLVIRVKNELMIINPLPPTSELLKEIDLLQKKIGPVKTIVLPTASGLEHKI
FT                   GLPALARAFPNAKIWLCPGQWSFPFQLPFDWLGIPSNRTNILLADGFPHGDDCEWISLG
FT                   PIDIGLARFQEISCFHKPTKSLLVTDALVGIEATPPELFNLDPTPLLFHSREKGSEELI
FT                   DSPIARRKGWLRLVLFASYLKPEKLEIPKIKEILENSFKPKMRNKRSHFGIYPFAWQEG
FT                   WDLSAKKLVGEKTPLIQIAPVIERLVFPRGKKAFISWLNKIESLKGISFLISAHYSGKV
FT                   RFTTNEIRALKVKIDNSNWEKTQGDFKFLSWFDQKLLNFGIVPKNPLKKFSD"
FT   gene            complement(594818..595162)
FT                   /locus_tag="PMN2A_0041"
FT   CDS_pept        complement(594818..595162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06441"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57533"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU5"
FT                   /protein_id="AAZ57533.1"
FT                   /translation="MFNPEFLATDNNEGHEANALIQYLQDQPADVLQRVAKSASPEIQE
FT                   IIRHNVQGLLGMLPGEQFEVKVTSSKDNLASLLASAMMTGYFLRQMEQRKQLEETLLSD
FT                   EEMSVDPDKI"
FT   gene            complement(595226..595792)
FT                   /locus_tag="PMN2A_0042"
FT   CDS_pept        complement(595226..595792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0042"
FT                   /product="signal peptidase I, Serine peptidase, MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="Alternative locus ID: NATL2_06451"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57534"
FT                   /db_xref="GOA:Q46LU4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU4"
FT                   /protein_id="AAZ57534.1"
FT                   /translation="MTSTGSKKNQNQNSWKGLLVWILIALLLRWQAVEPRWIPSGSMIP
FT                   TLQIQDRILIEKITPRLNNKLNKHLNLNTIVIFKPPKILTEAGYSDGSALIKRVVGLPG
FT                   DKIEVTDGKLYRNGKEINEPWIKEPIQYEMDAINVPEYSLWVLGDNRNNSLDSHIWGAL
FT                   PEKNLIGTALARYWPLKKIGPIRFP"
FT   gene            595856..597652
FT                   /locus_tag="PMN2A_0043"
FT   CDS_pept        595856..597652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0043"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="Alternative locus ID: NATL2_06461"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57535"
FT                   /db_xref="GOA:Q46LU3"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LU3"
FT                   /protein_id="AAZ57535.1"
FT                   /translation="MTISLARYNFFISLELLKTLVAKGVKYFVLCPGSRSGPLALAAAS
FT                   LSKRKELTLITSIDERSAAFLALGISAASGQVSCVITTSGSAVANLLPAAVEADRSCHP
FT                   LLFLTADRPLRLKECGANQAVNQQDFLKSVCRHFDESPKEGIHLISKERLTSLVGKSFE
FT                   MASNIPGPVHINLAYEEPLHPCELDQKKVLDGWVIEGFLKGKITPTKDEVVKSFQSLKL
FT                   LKLDPFSLGIIIVGPWRGKVKQLNSFRGALKKWQKLTGWPILADPLSGVENDQEGLINH
FT                   WDLFFSIGLFEKIKEIQVLRLGPIPPSRELQTWLKKPGKFQLLITEGDSRNLDPIGGST
FT                   QFSEGFSCWVDKMLEVIPVKPAIDKKIVSKKLIKELIKYDLFIHDWLDKRLFRNGLITE
FT                   PALARLLPRLLPESIPVMIASSSPIRDWLSYSGEGAFLRRCFGFRGASGIDGTLSMGMG
FT                   LSIIMGRMVLVTGDLALLHDTNGWLFSKDKNISLIVIMIDNGGGGIFNQLNIDRIEEGD
FT                   FEDIFLMPQQVCHLTLAKAYGLKYKQVACLDDLEKAIEWSFSLSTNVLIRVCTNSIEDH
FT                   RLRVNLSDDLKKTLSENLSSFD"
FT   gene            597666..598565
FT                   /locus_tag="PMN2A_0044"
FT   CDS_pept        597666..598565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0044"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="Alternative locus ID: NATL2_06471"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57536"
FT                   /db_xref="GOA:Q46LU2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU2"
FT                   /protein_id="AAZ57536.1"
FT                   /translation="MTLKPITPNNNNMSRRVLPGEIITSWVSVGEYKDILLDKSTEGIA
FT                   RVAINRPEKRNAFRPQTISELCDAFIRIREDPKIGVVLFTGVGPSKDGKFAFCSGGDQA
FT                   IRGSGGYLGDDGIPRLNVLDLQRIIRSLPKVVIALVPGFAIGGGHVLHLICDLSLAADN
FT                   AIFGQTGPKVGSFDAGFGSSYLARVVGQKKAREIWFLCRKYGAKEALDMGLINAISPIN
FT                   LLESEGVKWAREILQNSPTAIKCLKFSFNADTDGLAGIQELAGQATHLFYTTDESKEGR
FT                   NAFMEKRDPDFSESKWLP"
FT   gene            598614..600077
FT                   /locus_tag="PMN2A_0045"
FT   CDS_pept        598614..600077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0045"
FT                   /product="glycogen/starch synthases, ADP-glucose type"
FT                   /note="Alternative locus ID: NATL2_06481"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57537"
FT                   /db_xref="GOA:Q46LU1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LU1"
FT                   /protein_id="AAZ57537.1"
FT                   /translation="MRILFAAAECAPMIKVGGMGDVVGSLPPALKKLGHDVRLIIPGYG
FT                   KLWTLMDIAPEPIFRSNTMGVDFSVFETKHPSNGLPIYLVGHPCFDSERIYGGEDEDWR
FT                   FTFFASAVSEFAWNSWKPQVLHCHDWHTGMIPVWMHQDPEISTVFTIHNLKYQGPWRWK
FT                   LDQITWCPWYMHGDHTMASAMLYADRVNAVSPTYSREIRTSEYGEKLEGLLNYISGKLR
FT                   GILNGVDLDEWNPATDNSLPAKFSVDNISGRAINKRVLQERMGLEVNPDKYLMGMVGRL
FT                   VDQKGIDLLLQVANRLLSYTDSQVVVLGTGDRYLESSLWQLAIEYPGRFSVFLTYDDAL
FT                   SRLIYGGADAFLMPSRFEPCGISQLLAMRYGAIPIVRKVGGLVDTVEPYNPMNETGSGF
FT                   CFDRYEPIDFYTSLVRSWEEYRHQKSWKQLQLRAMSNKYSWDRSAKEYELMYKDVCGIK
FT                   EPSPDAAEVEKFSYGQEADPSRKGKKIKL"
FT   gene            600123..601520
FT                   /locus_tag="PMN2A_0046"
FT   CDS_pept        600123..601520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0046"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="Alternative locus ID: NATL2_06491"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57538"
FT                   /db_xref="GOA:Q46LU0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LU0"
FT                   /protein_id="AAZ57538.1"
FT                   /translation="MDITFKDLIKLWGTLDNQKEIDLDLPIGRISTDSRTIEKGDFFVP
FT                   LVGNKFDAHDYLDMAFDLGIQAAVVSEKYNGLVPIGLPHWVVPDTLYAYQQIALLHRRN
FT                   LNLPVVAVTGSVGKTTTRELIRAILSPLGEIVSSRGNENNDIGVPKTLLSGSETDAAFV
FT                   LEMGMRGFGQITRLSRVAEPDIAVITNVGQAHIGILGSRENIAKAKSEITSYLSPDGVV
FT                   IIPFGDYILEKALLEKWSGRIVRVEIEGFSLNWLDCNNEHFAFQDIEPDYISQIDMQNN
FT                   FILFEGRKFKLPLEGRHNAMNFLLALTVATELGLSIKKLDQLKINMPIGRNRLVDCGQY
FT                   LVLDETYNASPESVIASLELLVSKPGRHFAVLGTMLELGSESILLHQKVLKKAIELGLT
FT                   GIVFVSCGEESNIIKKTIKELPNHDVVSNPKDAAMSLLPWLSPGDNILIKGSRKLELEK
FT                   VLPYLQK"
FT   gene            complement(601535..602875)
FT                   /locus_tag="PMN2A_0047"
FT   CDS_pept        complement(601535..602875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0047"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="Alternative locus ID: NATL2_06501"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57539"
FT                   /db_xref="GOA:Q46LT9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LT9"
FT                   /protein_id="AAZ57539.1"
FT                   /translation="MLAIAILAAGKGTRMKSKLPKVLHPLAGKSLIDRVLSCTHGLKPN
FT                   RRLIVVGHQANLVEDSLRKHQDLDFVLQQPQNGTGHAIQQLKPRLKGFNGELLVLNGDV
FT                   PLLKEETLSSLLKFHKESNASVTFLSASLDSPTGYGRVFTDESGLVKKIIEERDCTNEQ
FT                   RKNKLINAGIYCFNWQQLSDVLNLLSNQNSQNEIYLTDTISLLKKALHFEVDNPFEIKG
FT                   INDRVQLSECEHYIQEELKSLWMSKGVSFVDPISCSLSEDSNFGTDVIIEPQTHLRGKC
FT                   SIGNGCHLGPGSVITNSTLAENVLAIHSFINEATIGNNTSIGPFAHIRPESNIRQNSKI
FT                   GNFVEIKKSCIGEGTKINHLSYVGDSALGKNINIGAGTITANFDGKNKHRTIIDDYSKT
FT                   GANSVLVAPIKIGAHVTIGAGSTISKDIPDKSLVVERSKAIIRTKAD"
FT   gene            complement(602911..603807)
FT                   /locus_tag="PMN2A_0048"
FT   CDS_pept        complement(602911..603807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0048"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="Alternative locus ID: NATL2_06511"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57540"
FT                   /db_xref="GOA:Q46LT8"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LT8"
FT                   /protein_id="AAZ57540.1"
FT                   /translation="MDDYKKHTTKDGSLSLYSLSYEEGFHDKDGALRESINKYLLPAQL
FT                   EEFYNAKKIVVLDVCMGLGYNTGCILEELLQRNIKIEWHGLEIDQKPLNLGLNEKIFQE
FT                   IWSSKVLNFFNCLNISGKWTEGFNQGTIHWGDARQKIFEIQDSLRFDLILLDPFSPQKC
FT                   PELWSEEFISLLTERLSTEGRLITYSTAASIRASFKRAGLNIYSIVPSTDDQRKWSSGT
FT                   VAMKKKIEQQLIEKNCQIKELSTKEVEHLATRSSIPYRDPTGKGNSKEIISTREIEQSK
FT                   SQLINTSSWRKRWNTAR"
FT   gene            complement(603819..605153)
FT                   /locus_tag="PMN2A_0049"
FT   CDS_pept        complement(603819..605153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0049"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Alternative locus ID: NATL2_06521"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57541"
FT                   /db_xref="GOA:Q46LT7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LT7"
FT                   /protein_id="AAZ57541.1"
FT                   /translation="MNAPTKDQSLRNLQKGGELCGKVKVPGDKSISHRALLFGAIAKGK
FT                   TLIEGLLPAEDPLSTAECLRSMGVKISPIKKGDIIEIEGVGLNGLQEPQDILNCGNSGT
FT                   TMRLIMGLLAGQKDHHFILTGDKSLRNRPMKRVGQPLKMMGAKVFGRCGGNLAPLSIIG
FT                   NKLRGAVIGTPVASAQIKSAILLAALNAEGSTTVIEPARSRDHSERMLKAFGANLEVGG
FT                   EMGRHITVSPGKDLKGQSIIVPGDISSAAFWLIAGSIIPGSELVVENVGLNPTRTGILD
FT                   VLEEMEANINVINKRDVAGEPVGDIEVFYKENLKPFKIDGEIMPRLVDEIPILSVGACF
FT                   CNGISQIKGASELRVKETDRLAVMARQLKRMGASVDEHQDGLTIYGGKSLEGCELDSED
FT                   DHRIAMSLAIASIMANSNSTLRRSEAAAISYPDFWSDLKRLQQKN"
FT   gene            complement(605209..606786)
FT                   /locus_tag="PMN2A_0050"
FT   CDS_pept        complement(605209..606786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0050"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="Alternative locus ID: NATL2_06531"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57542"
FT                   /db_xref="GOA:Q46LT6"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LT6"
FT                   /protein_id="AAZ57542.1"
FT                   /translation="MQTFMKLFRQEPLTRDIRDFLTLLEKKGQLKRISSPVDSDLEIAA
FT                   ISDRVLGMGGPALLFENVKGSSMPVAVNLLGTMERVVWSMGLEKQEELEDLGKKLALLQ
FT                   QPRPPKGLKETKAFASVAWDLLKARPDIDLLPPCHQQVISEKDLDLNHLPLLRPWPEDA
FT                   GGAITLGLVITKDPETGVPNVGVYRLQRQSAKSMTVHWLSVRGGARHLRKAAAMNKKLE
FT                   VAVAIGVHPLLVMAAATPIPVQLSEWLFAGLYAGEGVRLTKCKTIDLQVPSHSEVVLEG
FT                   SISPGEEMMDGPFGDHMGFYGGAESSPLIRFQCMTQRKKPIFLTTFSGRPPKEEAMLAI
FT                   ALNRIYTPILKQQIPEIIDFFLPMEALSYKLAVISIDKAYPGQAKRAAMAFWSALPQFT
FT                   YTKFVVVVDSTINVRDPRQVVWVLSSQVDPQRDLFVLENTPFDTLDFASENIGLGGRLA
FT                   IDATTKIGPEKNHDWGKPLTRPKELEDKVDERWEELGLSELENKKPSPELFGYVIDELM
FT                   RQKQINNS"
FT   gene            606839..607567
FT                   /locus_tag="PMN2A_0051"
FT   CDS_pept        606839..607567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0051"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /EC_number="3.1.3.71"
FT                   /note="Alternative locus ID: NATL2_06541"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57543"
FT                   /db_xref="GOA:Q46LT5"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LT5"
FT                   /protein_id="AAZ57543.1"
FT                   /translation="MKLSYFYVAADVPDGIIPESSVVIDVLRATTTIAWALENGADSVQ
FT                   VFADVDELKNQAKTFDSKEKILVGERGGKKLDGFDLGNSPLGVSPESVKGKRVFMSTTN
FT                   GTRSLHRVRESKSLYTMALPNRKAIAERLKSDNPKEVWIVGSGWEGSYSLEDSLAAGAL
FT                   ASLLMDQLESVQIVNDELMASVALWKNWENDVEGCLRIASHGQRLAGIGNHDDDFACCA
FT                   SLDNLSVIPKQIEMGVLRSN"
FT   gene            607595..608419
FT                   /locus_tag="PMN2A_0052"
FT   CDS_pept        607595..608419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0052"
FT                   /product="nitrilase-like protein"
FT                   /note="Alternative locus ID: NATL2_06551"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57544"
FT                   /db_xref="GOA:Q46LT4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LT4"
FT                   /protein_id="AAZ57544.1"
FT                   /translation="MSDFLAAALQLTSTSDIDSNLNAAEEQIELAARRGADLVGLPENF
FT                   AFLGEDQKKLKIASSIYEKCNSFLVTMARRYQVVLLGGGFPVPAGDGIRTLNRAELFGK
FT                   DGQSLARYDKIHLFDVDLPEGNTYRESETIVSGSESPPVVDVPGLCKIGLSICYDVRFP
FT                   ELYRDLVNKGADLLMIPAAFTAFTGKDHWQVLLQARAIENTAYVVAPAQTGRHYGRRQS
FT                   HGHAMVIDPWGTVLADAGVVQGAAIAPADKERVERIRGQMPSLKHRKTELFI"
FT   gene            608419..609504
FT                   /locus_tag="PMN2A_0053"
FT   CDS_pept        608419..609504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0053"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="Alternative locus ID: NATL2_06561"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57545"
FT                   /db_xref="GOA:Q46LT3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LT3"
FT                   /protein_id="AAZ57545.1"
FT                   /translation="MFKDQSLMSKLGLFAGFIFCSNLFISLPLRSASALAAWALTSNGS
FT                   LKLRTSSGAKLDAFYQSSTTDKGDRVWIDFTGELSRPRTIKGNGSVKEIRLGKPSKGIT
FT                   RLVIEFLPSVELEPSKLQLIGISTNTWELELIGLESNSFRPIEEGNILRNSIKRTYEKI
FT                   KPEDLDVSSLPNVPYGKYKVVIDPGHGGSDPGAVGINGLRETDIVLEVSKSVSDFLTNK
FT                   GVKTILTRNYERTLDLQPRVTKANNSKADVFVSIHANATRGKRKEVNGLETYYYSGYKG
FT                   YSLAKNIQKQILIVSPQSPDRGVRRSRFYVIRKTSMPAALVEIGFVTGMYDADLLRQKV
FT                   YRDKMSFAIARGILNYLKISN"
FT   gene            609507..610304
FT                   /locus_tag="PMN2A_0054"
FT   CDS_pept        609507..610304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0054"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="Alternative locus ID: NATL2_06571"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57546"
FT                   /db_xref="GOA:Q46LT2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LT2"
FT                   /protein_id="AAZ57546.1"
FT                   /translation="MRIGLFDSGIGGFTVLKKVIKLCPNNSFIYLADTARLPYGIKTTN
FT                   EIKKIAEEISSWFRYQKIDAFLVACNTTNAIALDILKKNLDIPVFDLIGSAASTIQESR
FT                   VGVLATPSTVKTKAYTNAILEFKPKTFVIEQPCPAFVPMIEMDNINSDDITDVATGYLQ
FT                   PLLKQKIHSLILGCSHYPLIAPSLRKVLPSSVKLIDPAEALSFKLKLFIDSKTSNYSKN
FT                   KNFVDLKFYVTSNLKHFPNKAKHWLNVFPEVNLVSLQKKGWVS"
FT   gene            610327..611298
FT                   /locus_tag="PMN2A_0055"
FT   CDS_pept        610327..611298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0055"
FT                   /product="trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="Alternative locus ID: NATL2_06581"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57547"
FT                   /db_xref="GOA:Q46LT1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LT1"
FT                   /protein_id="AAZ57547.1"
FT                   /translation="MTTATEILQPVELDLEALLLDLRSLIGAGHPILQAAAEHLFSAGG
FT                   KRLRPGIVLLISRALTSEKELPLKHRKLAQITEMIHTASLVHDDVVDEADTRRGVETVH
FT                   SRFDPRIAVLAGDFLFAQASWHLANLENLEVVKLLSRVIMDLAEGEIKQGLNRFDSSQS
FT                   FESYLEKSYCKTASLIANSSKAIGVLSNVDQESLNSLYFFGRQLGLAFQVVDDILDFTG
FT                   NDEQLGKPAASDLQSGYLTAPVFYALEENPSLSELINGKFSQKDDLDQALSLVRDSSAI
FT                   KKSRELAEQFASESKDSISWLPDSPSKKALLELPEFVISRLY"
FT   gene            complement(611300..611980)
FT                   /locus_tag="PMN2A_0056"
FT   CDS_pept        complement(611300..611980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0056"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /note="Alternative locus ID: NATL2_06591"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57548"
FT                   /db_xref="GOA:Q46LT0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LT0"
FT                   /protein_id="AAZ57548.1"
FT                   /translation="MKKNWNFPKAFLFDLDGVLIDSEPLHGQAWKETAALFDLNLTLEQ
FT                   LKLLRGKRRIDCANELVKLIPKTVEVKDLLDRHRPISRQLILRAQAMQGGESLVERCHK
FT                   NNIPMALVTSSSAESFQIKTTQHKWMNLFSVIVLGDEKLLAKGKPAPDPYLLAAKKLNI
FT                   APQECWAVEDSIAGVSSALEAGCYVLFLKAQSEELPKKEDLDQHLNLRQISHLKEIDQI
FT                   LNEY"
FT   gene            612073..614049
FT                   /locus_tag="PMN2A_0057"
FT   CDS_pept        612073..614049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0057"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="Alternative locus ID: NATL2_06601"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57549"
FT                   /db_xref="GOA:Q46LS9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LS9"
FT                   /protein_id="AAZ57549.1"
FT                   /translation="MNSNNSNSIESVLQEQRVFPPSDNFSSKSRISSFSKYLEMSEMAK
FT                   SDPNKFWGDAAREELHWFKSFNKVLDWSNPPFAKWFDGGKTNISFNCLDRHLNSSTADK
FT                   VALIWEGEPGDKKKYTYKQLHKEVCKAANALKSIGIGKGDLVALYMPMVPEAAIAMLAC
FT                   ARIGAPHSVVFGGFSSEALRDRLINGEAKAIITADGGFRKDKVIPLKDAVDQALGGGAC
FT                   PKVESVLVVQRTKKNIAMDDGRDYWWHEIVDSQADDCLPEQMDSEDCLFVLYTSGSTGK
FT                   PKGVVHSTAGYNLWSHLTFKWIFDIRENDVYWCTADVGWITGHSYIVYGPLSNGATTVM
FT                   YEGVPRPSNPGAFWDVIQKHKISIFYTAPTAIRAFMKAGNKIPNQYDLSSLRLLGTVGE
FT                   PINPEAWIWYRDVIGGGRCPIVDTWWQTETGGVMISPLPGATPTKPGSATFPLPGIEAD
FT                   VVNSDGDSVANNEGGYLVVKRPWPGMMRNVYGDEKRFRESYWEYLKPSDNSYMYFAGDG
FT                   ARRDEDGYFWVMGRVDDVINVSGHRLGTMEIESALVSHELISEAAVVGRPDDLKGESIV
FT                   AFVTLRTGAEANENIEAQLKKHVVNEIGPIAKPDEFKFTDSLPKTRSGKIMRRILRALA
FT                   SGDEISGDTSTLEDRSVLDKLRS"
FT   gene            complement(614038..614772)
FT                   /locus_tag="PMN2A_0058"
FT   CDS_pept        complement(614038..614772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06611"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57550"
FT                   /db_xref="InterPro:IPR010765"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LS8"
FT                   /protein_id="AAZ57550.1"
FT                   /translation="MSTFKRISDVSCQWPSRPVGLIELIGGSYISIKPEVTYKRLISCL
FT                   LKKNFAVHSWGYIPNFDHQLQANQAWKQFRQSRKILEKRIGLIPKSIRLGHSLGCKLHL
FT                   LAPDGGRNCDGLVAISFNNFRADKSIPLLRKMSKKLNFQTEFSPSPSETLNLVREHYEQ
FT                   INNLLIKFKNDNLDQNDFLLKSLKERSADKSKIMNLDGNHLTPVSVGLREKLLKANLQN
FT                   SLKYENINLIVDQIIHWEILTS"
FT   gene            614880..615758
FT                   /locus_tag="PMN2A_0059"
FT   CDS_pept        614880..615758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0059"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Alternative locus ID: NATL2_06621"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57551"
FT                   /db_xref="GOA:Q46LS7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LS7"
FT                   /protein_id="AAZ57551.1"
FT                   /translation="MIIEVRLINFEVKEEQNHQKESEQLNFLDETTKEIANEKEKDLVV
FT                   QSPLQSKDERFGILRNEHFPENILILDTETTGLDNENDDCLEVGSILFNVKSRSVLAQQ
FT                   SFLLPVEINNAEKINNIPAEITRLPQPLSEAIKYFESLVRVSNVIVAHNSEFDKKWFGL
FT                   KKLPQIEKPWICSMDDITWPADRQLKTRPSVRDLALAYGVPVWNAHRALTDCIYLAEVF
FT                   IRCSELEKLLIRALEPKVLLRAEISYEDRYLAKNAGFRWNDAIKGAWSRKMSRRDKEKL
FT                   DFPVHEVDFHS"
FT   gene            615853..616140
FT                   /locus_tag="PMN2A_0060"
FT   CDS_pept        615853..616140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0060"
FT                   /product="hypothetical protein"
FT                   /note="Alternative locus ID: NATL2_06631"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57552"
FT                   /db_xref="UniProtKB/TrEMBL:Q46LS6"
FT                   /protein_id="AAZ57552.1"
FT                   /translation="MRKYTTKKNIVGQRPLVKSKAGNNELKKRLRQWQHSRSWARLICE
FT                   AEKMWSLDSRDLKRLGAMELIQLQNEMPFNVRRRVNYWLVKYSGATRLEN"
FT   gene            616268..617548
FT                   /locus_tag="PMN2A_0061"
FT   CDS_pept        616268..617548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PMN2A_0061"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="Alternative locus ID: NATL2_06641"
FT                   /db_xref="EnsemblGenomes-Gn:PMN2A_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ57553"
FT                   /db_xref="GOA:Q46LS5"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46LS5"
FT                   /protein_id="AAZ57553.1"
FT                   /translation="MTNLKNLRGMVDLLPAQSQGWQKVESIALEHFSRAGLQEIRTPII
FT                   EQTELFSRGIGENTDVVGKEMYSFDDRGGRSCTLRPEGTASVARSIVQHGLLNKGPQRL
FT                   WYRGPMFRYERPQAGRQRQFHQIGVEFVGLASVISDAEVISIAWNFLKDVGLNELTLEI
FT                   NSLGSNEDRNIFKEELKDWLNQRFDLLDEDSQKRINVNPLRILDSKNNSTKELLSEAPS
FT                   LIDFLSNESKTRFDYLQELLVNLKIPYEINYNLVRGLDYYSHTAFEITSDHLGSQATVC
FT                   GGGRYDGLISELGGPQAPSIGWAIGMERLIILAGDKILQSKSPDVYVIHKGKKAEQLAL
FT                   EITCQLRSSNLIIELDYSGSSFSKQFKRADKSRAKWALVIGEDEVSKGQLLMKKLRDKQ
FT                   KDEESREYIFSKSDLDQLIKKLIAEKK"
FT   gene            617562..618965
FT