(data stored in SCRATCH3701 zone)

EMBL: CP000096

ID   CP000096; SV 1; circular; genomic DNA; STD; PRO; 2364842 BP.
XX
AC   CP000096;
XX
PR   Project:PRJNA13012;
XX
DT   28-OCT-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Chlorobium luteolum DSM 273, complete genome.
XX
KW   .
XX
OS   Pelodictyon luteolum DSM 273
OC   Bacteria; Chlorobi; Chlorobia; Chlorobiales; Chlorobiaceae;
OC   Chlorobium/Pelodictyon group; Pelodictyon.
XX
RN   [1]
RP   1-2364842
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Bryant D., Schmutz J., Larimer F.,
RA   Land M., Kyrpides N., Ivanova N., Richardson P.;
RT   "Complete sequence of Pelodictyon luteolum DSM 273";
RL   Unpublished.
XX
RN   [2]
RP   1-2364842
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Bryant D., Schmutz J., Larimer F.,
RA   Land M., Ivanova N., Richardson P.;
RT   ;
RL   Submitted (08-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; af79acb34cd7a6564d40024ae1183130.
DR   BioSample; SAMN02598284.
DR   CABRI; DSM 273.
DR   EnsemblGenomes-Gn; EBG00001150996.
DR   EnsemblGenomes-Gn; EBG00001150997.
DR   EnsemblGenomes-Gn; EBG00001150998.
DR   EnsemblGenomes-Gn; EBG00001150999.
DR   EnsemblGenomes-Gn; EBG00001151000.
DR   EnsemblGenomes-Gn; EBG00001151001.
DR   EnsemblGenomes-Gn; EBG00001151002.
DR   EnsemblGenomes-Gn; EBG00001151003.
DR   EnsemblGenomes-Gn; EBG00001151004.
DR   EnsemblGenomes-Gn; EBG00001151005.
DR   EnsemblGenomes-Gn; EBG00001151006.
DR   EnsemblGenomes-Gn; EBG00001151007.
DR   EnsemblGenomes-Gn; EBG00001151008.
DR   EnsemblGenomes-Gn; EBG00001151009.
DR   EnsemblGenomes-Gn; EBG00001151010.
DR   EnsemblGenomes-Gn; EBG00001151011.
DR   EnsemblGenomes-Gn; EBG00001151012.
DR   EnsemblGenomes-Gn; EBG00001151013.
DR   EnsemblGenomes-Gn; EBG00001151014.
DR   EnsemblGenomes-Gn; EBG00001151015.
DR   EnsemblGenomes-Gn; EBG00001151016.
DR   EnsemblGenomes-Gn; EBG00001151017.
DR   EnsemblGenomes-Gn; EBG00001151018.
DR   EnsemblGenomes-Gn; EBG00001151019.
DR   EnsemblGenomes-Gn; EBG00001151020.
DR   EnsemblGenomes-Gn; EBG00001151021.
DR   EnsemblGenomes-Gn; EBG00001151022.
DR   EnsemblGenomes-Gn; EBG00001151023.
DR   EnsemblGenomes-Gn; EBG00001151024.
DR   EnsemblGenomes-Gn; EBG00001151025.
DR   EnsemblGenomes-Gn; EBG00001151026.
DR   EnsemblGenomes-Gn; EBG00001151027.
DR   EnsemblGenomes-Gn; EBG00001151028.
DR   EnsemblGenomes-Gn; EBG00001151029.
DR   EnsemblGenomes-Gn; EBG00001151030.
DR   EnsemblGenomes-Gn; EBG00001151031.
DR   EnsemblGenomes-Gn; EBG00001151032.
DR   EnsemblGenomes-Gn; EBG00001151033.
DR   EnsemblGenomes-Gn; EBG00001151034.
DR   EnsemblGenomes-Gn; EBG00001151035.
DR   EnsemblGenomes-Gn; EBG00001151036.
DR   EnsemblGenomes-Gn; EBG00001151037.
DR   EnsemblGenomes-Gn; EBG00001151038.
DR   EnsemblGenomes-Gn; EBG00001151039.
DR   EnsemblGenomes-Gn; EBG00001151040.
DR   EnsemblGenomes-Gn; EBG00001151041.
DR   EnsemblGenomes-Gn; EBG00001151042.
DR   EnsemblGenomes-Gn; EBG00001151043.
DR   EnsemblGenomes-Gn; EBG00001151044.
DR   EnsemblGenomes-Gn; EBG00001151045.
DR   EnsemblGenomes-Gn; EBG00001151046.
DR   EnsemblGenomes-Gn; EBG00001151047.
DR   EnsemblGenomes-Gn; EBG00001151048.
DR   EnsemblGenomes-Gn; EBG00001151049.
DR   EnsemblGenomes-Gn; EBG00001151050.
DR   EnsemblGenomes-Gn; EBG00001151051.
DR   EnsemblGenomes-Gn; EBG00001151052.
DR   EnsemblGenomes-Gn; EBG00001151053.
DR   EnsemblGenomes-Gn; EBG00001151054.
DR   EnsemblGenomes-Gn; EBG00001151055.
DR   EnsemblGenomes-Gn; EBG00001151056.
DR   EnsemblGenomes-Gn; EBG00001151057.
DR   EnsemblGenomes-Gn; EBG00001151058.
DR   EnsemblGenomes-Gn; Plut_R0001.
DR   EnsemblGenomes-Gn; Plut_R0002.
DR   EnsemblGenomes-Gn; Plut_R0003.
DR   EnsemblGenomes-Gn; Plut_R0004.
DR   EnsemblGenomes-Gn; Plut_R0005.
DR   EnsemblGenomes-Gn; Plut_R0006.
DR   EnsemblGenomes-Gn; Plut_R0007.
DR   EnsemblGenomes-Gn; Plut_R0008.
DR   EnsemblGenomes-Gn; Plut_R0009.
DR   EnsemblGenomes-Gn; Plut_R0010.
DR   EnsemblGenomes-Gn; Plut_R0011.
DR   EnsemblGenomes-Gn; Plut_R0012.
DR   EnsemblGenomes-Gn; Plut_R0013.
DR   EnsemblGenomes-Gn; Plut_R0014.
DR   EnsemblGenomes-Gn; Plut_R0015.
DR   EnsemblGenomes-Gn; Plut_R0016.
DR   EnsemblGenomes-Gn; Plut_R0017.
DR   EnsemblGenomes-Gn; Plut_R0018.
DR   EnsemblGenomes-Gn; Plut_R0019.
DR   EnsemblGenomes-Gn; Plut_R0020.
DR   EnsemblGenomes-Gn; Plut_R0021.
DR   EnsemblGenomes-Gn; Plut_R0022.
DR   EnsemblGenomes-Gn; Plut_R0023.
DR   EnsemblGenomes-Gn; Plut_R0024.
DR   EnsemblGenomes-Gn; Plut_R0025.
DR   EnsemblGenomes-Gn; Plut_R0026.
DR   EnsemblGenomes-Gn; Plut_R0027.
DR   EnsemblGenomes-Gn; Plut_R0028.
DR   EnsemblGenomes-Gn; Plut_R0029.
DR   EnsemblGenomes-Gn; Plut_R0030.
DR   EnsemblGenomes-Gn; Plut_R0031.
DR   EnsemblGenomes-Gn; Plut_R0032.
DR   EnsemblGenomes-Gn; Plut_R0033.
DR   EnsemblGenomes-Gn; Plut_R0034.
DR   EnsemblGenomes-Gn; Plut_R0035.
DR   EnsemblGenomes-Gn; Plut_R0036.
DR   EnsemblGenomes-Gn; Plut_R0037.
DR   EnsemblGenomes-Gn; Plut_R0038.
DR   EnsemblGenomes-Gn; Plut_R0039.
DR   EnsemblGenomes-Gn; Plut_R0040.
DR   EnsemblGenomes-Gn; Plut_R0041.
DR   EnsemblGenomes-Gn; Plut_R0042.
DR   EnsemblGenomes-Gn; Plut_R0043.
DR   EnsemblGenomes-Gn; Plut_R0044.
DR   EnsemblGenomes-Gn; Plut_R0045.
DR   EnsemblGenomes-Gn; Plut_R0046.
DR   EnsemblGenomes-Gn; Plut_R0047.
DR   EnsemblGenomes-Gn; Plut_R0048.
DR   EnsemblGenomes-Gn; Plut_R0049.
DR   EnsemblGenomes-Gn; Plut_R0050.
DR   EnsemblGenomes-Gn; Plut_R0051.
DR   EnsemblGenomes-Gn; Plut_R0052.
DR   EnsemblGenomes-Gn; Plut_R0053.
DR   EnsemblGenomes-Gn; Plut_R0054.
DR   EnsemblGenomes-Tr; EBT00001567369.
DR   EnsemblGenomes-Tr; EBT00001567371.
DR   EnsemblGenomes-Tr; EBT00001567374.
DR   EnsemblGenomes-Tr; EBT00001567376.
DR   EnsemblGenomes-Tr; EBT00001567378.
DR   EnsemblGenomes-Tr; EBT00001567381.
DR   EnsemblGenomes-Tr; EBT00001567383.
DR   EnsemblGenomes-Tr; EBT00001567385.
DR   EnsemblGenomes-Tr; EBT00001567387.
DR   EnsemblGenomes-Tr; EBT00001567389.
DR   EnsemblGenomes-Tr; EBT00001567391.
DR   EnsemblGenomes-Tr; EBT00001567393.
DR   EnsemblGenomes-Tr; EBT00001567395.
DR   EnsemblGenomes-Tr; EBT00001567398.
DR   EnsemblGenomes-Tr; EBT00001567400.
DR   EnsemblGenomes-Tr; EBT00001567402.
DR   EnsemblGenomes-Tr; EBT00001567405.
DR   EnsemblGenomes-Tr; EBT00001567407.
DR   EnsemblGenomes-Tr; EBT00001567409.
DR   EnsemblGenomes-Tr; EBT00001567411.
DR   EnsemblGenomes-Tr; EBT00001567412.
DR   EnsemblGenomes-Tr; EBT00001567415.
DR   EnsemblGenomes-Tr; EBT00001567417.
DR   EnsemblGenomes-Tr; EBT00001567419.
DR   EnsemblGenomes-Tr; EBT00001567422.
DR   EnsemblGenomes-Tr; EBT00001567424.
DR   EnsemblGenomes-Tr; EBT00001567426.
DR   EnsemblGenomes-Tr; EBT00001567429.
DR   EnsemblGenomes-Tr; EBT00001567431.
DR   EnsemblGenomes-Tr; EBT00001567433.
DR   EnsemblGenomes-Tr; EBT00001567435.
DR   EnsemblGenomes-Tr; EBT00001567438.
DR   EnsemblGenomes-Tr; EBT00001567440.
DR   EnsemblGenomes-Tr; EBT00001567441.
DR   EnsemblGenomes-Tr; EBT00001567443.
DR   EnsemblGenomes-Tr; EBT00001567446.
DR   EnsemblGenomes-Tr; EBT00001567447.
DR   EnsemblGenomes-Tr; EBT00001567449.
DR   EnsemblGenomes-Tr; EBT00001567452.
DR   EnsemblGenomes-Tr; EBT00001567454.
DR   EnsemblGenomes-Tr; EBT00001567456.
DR   EnsemblGenomes-Tr; EBT00001567458.
DR   EnsemblGenomes-Tr; EBT00001567460.
DR   EnsemblGenomes-Tr; EBT00001567461.
DR   EnsemblGenomes-Tr; EBT00001567463.
DR   EnsemblGenomes-Tr; EBT00001567466.
DR   EnsemblGenomes-Tr; EBT00001567468.
DR   EnsemblGenomes-Tr; EBT00001567470.
DR   EnsemblGenomes-Tr; EBT00001567472.
DR   EnsemblGenomes-Tr; EBT00001567475.
DR   EnsemblGenomes-Tr; EBT00001567477.
DR   EnsemblGenomes-Tr; EBT00001567479.
DR   EnsemblGenomes-Tr; EBT00001567481.
DR   EnsemblGenomes-Tr; EBT00001567483.
DR   EnsemblGenomes-Tr; EBT00001567484.
DR   EnsemblGenomes-Tr; EBT00001567486.
DR   EnsemblGenomes-Tr; EBT00001567488.
DR   EnsemblGenomes-Tr; EBT00001567491.
DR   EnsemblGenomes-Tr; EBT00001567494.
DR   EnsemblGenomes-Tr; EBT00001567495.
DR   EnsemblGenomes-Tr; EBT00001567496.
DR   EnsemblGenomes-Tr; EBT00001567498.
DR   EnsemblGenomes-Tr; EBT00001567500.
DR   EnsemblGenomes-Tr; Plut_R0001-1.
DR   EnsemblGenomes-Tr; Plut_R0002-1.
DR   EnsemblGenomes-Tr; Plut_R0003-1.
DR   EnsemblGenomes-Tr; Plut_R0004-1.
DR   EnsemblGenomes-Tr; Plut_R0005-1.
DR   EnsemblGenomes-Tr; Plut_R0006-1.
DR   EnsemblGenomes-Tr; Plut_R0007-1.
DR   EnsemblGenomes-Tr; Plut_R0008-1.
DR   EnsemblGenomes-Tr; Plut_R0009-1.
DR   EnsemblGenomes-Tr; Plut_R0010-1.
DR   EnsemblGenomes-Tr; Plut_R0011-1.
DR   EnsemblGenomes-Tr; Plut_R0012-1.
DR   EnsemblGenomes-Tr; Plut_R0013-1.
DR   EnsemblGenomes-Tr; Plut_R0014-1.
DR   EnsemblGenomes-Tr; Plut_R0015-1.
DR   EnsemblGenomes-Tr; Plut_R0016-1.
DR   EnsemblGenomes-Tr; Plut_R0017-1.
DR   EnsemblGenomes-Tr; Plut_R0018-1.
DR   EnsemblGenomes-Tr; Plut_R0019-1.
DR   EnsemblGenomes-Tr; Plut_R0020-1.
DR   EnsemblGenomes-Tr; Plut_R0021-1.
DR   EnsemblGenomes-Tr; Plut_R0022-1.
DR   EnsemblGenomes-Tr; Plut_R0023-1.
DR   EnsemblGenomes-Tr; Plut_R0024-1.
DR   EnsemblGenomes-Tr; Plut_R0025-1.
DR   EnsemblGenomes-Tr; Plut_R0026-1.
DR   EnsemblGenomes-Tr; Plut_R0027-1.
DR   EnsemblGenomes-Tr; Plut_R0028-1.
DR   EnsemblGenomes-Tr; Plut_R0029-1.
DR   EnsemblGenomes-Tr; Plut_R0030-1.
DR   EnsemblGenomes-Tr; Plut_R0031-1.
DR   EnsemblGenomes-Tr; Plut_R0032-1.
DR   EnsemblGenomes-Tr; Plut_R0033-1.
DR   EnsemblGenomes-Tr; Plut_R0034-1.
DR   EnsemblGenomes-Tr; Plut_R0035-1.
DR   EnsemblGenomes-Tr; Plut_R0036-1.
DR   EnsemblGenomes-Tr; Plut_R0037-1.
DR   EnsemblGenomes-Tr; Plut_R0038-1.
DR   EnsemblGenomes-Tr; Plut_R0039-1.
DR   EnsemblGenomes-Tr; Plut_R0040-1.
DR   EnsemblGenomes-Tr; Plut_R0041-1.
DR   EnsemblGenomes-Tr; Plut_R0042-1.
DR   EnsemblGenomes-Tr; Plut_R0043-1.
DR   EnsemblGenomes-Tr; Plut_R0044-1.
DR   EnsemblGenomes-Tr; Plut_R0045-1.
DR   EnsemblGenomes-Tr; Plut_R0046-1.
DR   EnsemblGenomes-Tr; Plut_R0047-1.
DR   EnsemblGenomes-Tr; Plut_R0048-1.
DR   EnsemblGenomes-Tr; Plut_R0049-1.
DR   EnsemblGenomes-Tr; Plut_R0050-1.
DR   EnsemblGenomes-Tr; Plut_R0051-1.
DR   EnsemblGenomes-Tr; Plut_R0052-1.
DR   EnsemblGenomes-Tr; Plut_R0053-1.
DR   EnsemblGenomes-Tr; Plut_R0054-1.
DR   EuropePMC; PMC1489667; 16751554.
DR   EuropePMC; PMC3150298; 21714912.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01696; Chlorobi-1.
DR   RFAM; RF01697; Chlorobi-RRM.
DR   RFAM; RF01711; Lnt.
DR   RFAM; RF01724; SAM-Chlorobi.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP000096.
DR   SILVA-SSU; CP000096.
DR   StrainInfo; 156559; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA available from Don Bryant (dab14@psu.edu)
CC   Bacteria available from DSMZ: DSM 273
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done at Penn State University
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2364842
FT                   /organism="Pelodictyon luteolum DSM 273"
FT                   /strain="DSM 273"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:319225"
FT   gene            284..1420
FT                   /locus_tag="Plut_0001"
FT   CDS_pept        284..1420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22893"
FT                   /db_xref="GOA:Q3B6Y8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22893.1"
FT                   /translation="MLDQMKLTSSIRQLQDAVSKVAQAIPAKSIDQRFENINLSLEPGE
FT                   LTLFASDGEVSITAKSGVESSDSGNIGIRARTLQDFLRSMYDTSVMFSIERQEISDHGT
FT                   VSISTDKGRYRIPCLFQSKPEKQDKQYDISIEMETSEMLDLIQKTTFACSVDGMRPAMM
FT                   GVLFELEGSIITAVATDGHRLVRCRKASSVDLSEKNKVVVPARVLSILQKLAQTDSVTM
FT                   QFDSERKFVRFICGSIVLDAALIVEPYPNYEAVIPVEHDRNLIINRSMIYDSVRRVGRF
FT                   SSIGDVKVVLEGQMMKIMAENTNEGESAQEELACEFSGEDMAIGFNSRFIEAALAHLDE
FT                   NEIRIELKSPTTAVIFRPHGEEENDNLIILVMPVRINN"
FT   gene            1555..2664
FT                   /locus_tag="Plut_0002"
FT   CDS_pept        1555..2664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0002"
FT                   /product="RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22894"
FT                   /db_xref="GOA:Q3B6Y7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22894.1"
FT                   /translation="MRLKNIQVENFRNHHSLAFQPEEGITVLYGPNGSGKTSVLEAIHY
FT                   CALTKSLLGAPESECLAFSEEYFIISGEFVSTRGTSLSVKVSYGKDRGKLVQLNQSEVK
FT                   PFSQHVGTIPCITFSPSEIAIVNGSPGERRRFLDNALSQSDRRYLDELLDYRRVLQQRN
FT                   ALLLQLASSSGGSREMLDLWTENLADLAAGVTLRRISFLGELSVYFEPLQTSLAGKGSH
FT                   LVTYRSSFGTIDSGLSRDELRDRYIKRFKETQRQELLRTQTMSGPHRDDLLFLSNGREI
FT                   KKYGSQGQQRAFLISLKLALFRYFSHRLPESPICLFDDMFSELDAERTSEIFNILEDCG
FT                   QTILTTTDGSLHPASQAVSVTALPGYRGG"
FT   gene            2667..2960
FT                   /locus_tag="Plut_0003"
FT   CDS_pept        2667..2960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22895"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22895.1"
FT                   /translation="MARTRNPKPFSAIAGEMYQTLGMREAFLQFKALEAWGGVVGPAIA
FT                   RATTVERFSDGQLFVRVRNSSWRMELNYRKVDIVRQLNAVLEKPMVKEIIFR"
FT   gene            complement(3098..4321)
FT                   /locus_tag="Plut_0004"
FT   CDS_pept        complement(3098..4321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0004"
FT                   /product="rubredoxin:oxygen oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22896"
FT                   /db_xref="GOA:Q3B6Y5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22896.1"
FT                   /translation="MTDKNILPVSPSVTWIGVLDPGLITFDIVMETKYGTTYNSYFINA
FT                   EKKAIVETTKEKFWPEYLAKIKQVTDPAEIEYIIVDHTEPDHSGNVANLLKIAPNATVV
FT                   GSGNALKFLRDQTGHDFRSIAVKTGDTLDLGNKTLHFINAPNLHWPDTIYTWLEEERVL
FT                   FTCDSFGSHFCNEKMYDDEVGDFDDAFTYYFDAILRPFSKYMIQAIEKIKPLDISVICP
FT                   GHGPILRSDWKKYVDMSQRYAMGAIALPNEKNILIAYVSAYENTMLLANKIAEGLKSSC
FT                   DFTIDVCDIEHMHFSKLEEKIAHASGIILGSPTINQNILPQIYGFFGAINPIRDKGKLG
FT                   AAFGSYGWSGEASKMIEGNFTMLKLKVFERNMMVKFKPHEEAFKECIDFGKAYAEKMIE
FT                   MYRLSCNI"
FT   gene            complement(4402..6780)
FT                   /locus_tag="Plut_0005"
FT   CDS_pept        complement(4402..6780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0005"
FT                   /product="DNA-directed DNA polymerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22897"
FT                   /db_xref="GOA:Q3B6Y4"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22897.1"
FT                   /translation="MDTIISDILKNELLFGKDKEERIVGAYPISDTHIRLFNRTNEGVT
FT                   SHDEPLYPFFFLTDAILLEGYIPVDGSKYWLIKLDGDNHYRSLAIFRNLKSSRGALDHL
FT                   AGKKPDAQDNRGIDAGEGGLEVIQNVYSRGDGVTQYMMQTGKTFFKGMIFDELYRMQLD
FT                   IETLYDPAKPPKKGRGIGEDEIIIISMSDNRGWEMAIHSRDRSEKELLREMVRIITEKD
FT                   PDVIEGHNIFSFDLPYIQARCELHRVPFAIGRNGTLPKSYPASIRFAERSIDYPFYDIP
FT                   GRHVIDTLFLVQSYDITKRSMQSYGLKAVARHFGFASENRTYVEYSDIAEMWRTRDDRL
FT                   LAYALDDVRETRELSTLLSGSSFYLSQMLPYTYAMTARIGQAAKIEALFIREYLRLKHS
FT                   VPRPTLGQQHAGGYTEVFRKGVLGPIVYADVESLYPSIMLSYGVCPKSDSLKVFPGVLG
FT                   DLRELRLKAKALAGEEKRMGNTSLAANYDAMQGSFKILINAMYGYLGFSGGLFNDFDEA
FT                   DRVTSTGQSIAKKMIREFESRGCRIIEVDTDGILFIPPDSVKSEAEERALVQDVSELMP
FT                   DGINIGFDGRFRKMISYLKKNYALLDYNGIMKMKGSSLTSRSGEKFGRDFIRRGFEQLL
FT                   AEDITGLHDLYREYRNKILNHGLDITDFSRTESMKSSLEQYREDVASGKRSKSITYETA
FT                   IRSAIMVTKGDRITYYIAGTGQGGAASDRGKPAAEWSRDKPDENTSFYLKRLDEYCQKF
FT                   IPFFKPQDYSSIFSDDTLFSFSPEGIELQELILSPGEGD"
FT   gene            complement(6887..8770)
FT                   /locus_tag="Plut_0006"
FT   CDS_pept        complement(6887..8770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0006"
FT                   /product="Glucose-inhibited division protein A subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22898"
FT                   /db_xref="GOA:Q3B6Y3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6Y3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22898.1"
FT                   /translation="MQRAMAMYDVIVAGAGHAGTEAALAVSRSGLSCLLVTTDLNAVAR
FT                   MSCNPAIGGVAKGQITREIDALGGEMAKAIDSTGIQFRMLNLSKGPAMHSPRAQADRVA
FT                   YTAYMKRALEEEVNLDLLQDTVTGIEQREGILRGVRLLSGRLVTGRAAILTCGTFLNGL
FT                   IHIGMDHYPGGRTIAEPPVTGLTENLILAGFEAGRLKTGTPPRIDRRSVDYSRVEEQKG
FT                   DENPPPFSFSTPTLKGRAQLSCYVTHSSERTHEILKTGFDRSPLFTGKVQGIGPRYCPS
FT                   IEDKIFRFPDRPGHHIFLEPEGFETNEMYVNGFSTSLPEDIQIDGLRSMKGLEEVKLIR
FT                   AGYAIEYDYFPPYQIHSTLETKRIRNLYFAGQINGTSGYEEAAAQGLLAGINAAADILK
FT                   RPALRLKRSDAYIGVLVDDLVTKEMKEPYRMFTSSAEHRLMLRHDNADIRLMHFGHQSG
FT                   LVSDAAMERCRTKMRAIGEIKALTEKTAIPAEVLDSLISKQGQPHAASGQKISAAIKRP
FT                   GMSLEILMNSLPPFREALLSISTDKEAHQQVEIDLKYEGYLKRELLTADKIARLDALQI
FT                   PSEYNYSCIKGLSSEGVEKLISHRPETLGQASRISGVSPSDISVLMVHIGR"
FT   gene            8986..10773
FT                   /locus_tag="Plut_0007"
FT   CDS_pept        8986..10773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0007"
FT                   /product="SecD export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22899"
FT                   /db_xref="GOA:Q3B6Y2"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22899.1"
FT                   /translation="MSSMKNKRFNLLLIAVVTLVALWSLWPTWRDYSFSRQLSSLSSQQ
FT                   DSLNYTLSHRNEIEDARQKSLKLGLDLKGGMHLVMEVDQVDLFSEKAWNRDARFDSLMA
FT                   AVAQEARTSDADVVDLLTAAFKKDNIRLSRYFYDIRNTDSEIQGKLRNEAGDALVRARE
FT                   IIRNRIDQYGVAEPMITTQGNRKIIIELPGVSDENRMRNLLKGTAKLEFRLLREPDALI
FT                   RTLDRINSAMAAGTIAAASTGKQSISPLYDLVSVSPGGSAVIDARNRDLVSALLRDAAV
FT                   RDLLPPDSEMLISARPETGNDALSYHDLYLVKKTPELTGGVITEAKATFGSQGVQPEVL
FT                   MSMNSEGTSKWARITGANIGKRVAIVLDGAVYSAPVVQSKIPNGNSVINGIQSLEEAKD
FT                   LEIVLKAGALPAPVRIIEERTVGPSLGADYIRAGFQSMIWGFSAVVIFMIIYYRTAGLA
FT                   ADTALVLNVLIVLSVLAGFNASLSLPGIAGIVLTMGMAVDANVLIYERIREEIADGRTV
FT                   TAAVTQGYDRAFSSILDSHVTTLAAAFLLYTYGIGPIQGFAVTLMIGTAASLFTSIVVT
FT                   REIFQFLLSRNKMTAKSFG"
FT   sig_peptide     8986..9060
FT                   /locus_tag="Plut_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.921) with cleavage site probability 0.851 at
FT                   residue 25"
FT   gene            10796..11731
FT                   /locus_tag="Plut_0008"
FT   CDS_pept        10796..11731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0008"
FT                   /product="protein translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22900"
FT                   /db_xref="GOA:Q3B6Y1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22900.1"
FT                   /translation="MRIFNSTSINFLRYRKIAYGVSLAILLAGFVSLAVKGLNYGIDFR
FT                   GGSEVVIRFEKDVPVGEVRSVLRDAGVSGTLKQYGLDRSFLLSTVFSGETNDLKLLITS
FT                   ALNARMKDAPHEIVRIDAVGPSIASDLKWSAVKAMVAALLAILLYVGIRFELKFAAAGV
FT                   VAIFHDVLIVLGLFSLLGGVFDVMPLEMDQSIIAAFLTIAGYSITDTVVVYDRIRERIR
FT                   NQKPSEYERIFNESMNQTLSRTIITSGTTLLTVFVLFLFAGPAIRGFAFAVFAGILIGT
FT                   YSSIFVAAPLVFDWLRLSKTPVRLRGSSKS"
FT   sig_peptide     10796..10900
FT                   /locus_tag="Plut_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.825 at
FT                   residue 35"
FT   gene            11785..13104
FT                   /locus_tag="Plut_0009"
FT   CDS_pept        11785..13104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0009"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22901"
FT                   /db_xref="GOA:Q3B6Y0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Y0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22901.1"
FT                   /translation="MKKALHSVFAVIAVLLIMPPTLSAAVVADKVVAVVGSEVIFKSEL
FT                   DSRELMTRMQYPGLKDEASLRSTILDNIIDQKIILTKAKIDSVSIDENAVTSMAVDRFR
FT                   QLSGRFTSKEDMERRLGRSVDAIRRDLADELRGQQMIETLKRKKFSSVTIGYGEVMSFY
FT                   RSNQASMPNLPEEVSVSQILKFPGVNSASKAEALKKIQEIQKKQGSGFLSFEELARRYS
FT                   MDPGSAPLGGDLGFVQRGELVKPFEDAAYALKDGHVSGIVETRYGYHIIQRLGREGSSI
FT                   HVRHILVAFERSGSDDGEAAAFLDAIRSKVLAGKVDFATMAGSYSDDPVSASLGGLVLA
FT                   SGTAGKYLDPSMLRPQLRDIVNALRTPGDISRPTKITPPKGDPFFGIFRLNDRIVPHVL
FT                   DPEKDYPLLEQLALDNKKQELFDAWVKGLHKEVYMRRTDR"
FT   sig_peptide     11785..11859
FT                   /locus_tag="Plut_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.838 at
FT                   residue 25"
FT   gene            complement(13263..15197)
FT                   /locus_tag="Plut_0010"
FT   CDS_pept        complement(13263..15197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0010"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22902"
FT                   /db_xref="GOA:Q3B6X9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22902.1"
FT                   /translation="MQEADIQTPQSNYGATNIQVLDGIAHVRMRPAMYIGDIHSRGLHH
FT                   LIYEIVDNSIDETLGGYNDYIFVSLNPDGSVTVIDHGRGIPVDIHPDKKKSALELVMTL
FT                   IGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAWFQRYHRGVPEADVKE
FT                   IGTTTERGTKTTFMPDSEIFKVTEFRKDIIIDRMRELAFLNSNLKIVVQDIEGEQETFH
FT                   FEGGLKEFVLFTDENRLNLIKEPIYIYGEKDGTIVEIALEYNDSYQENVFSYVNNINTH
FT                   EGGTHVTGFRKALTRTLNAYAQKNDLLKNLKLALTGDDFKEGLTAVISVKVAEPQFEGQ
FT                   TKTKLGNSETQSIVESVLNEQLAEFAESNPNVIKMIIEKVKGAAMSREAARKAKELTRR
FT                   KSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNV
FT                   EKARLHKMLENEEIKTIILALGTNFGEEEFSAEKLRYGKIIIMTDADVDGAHIRTLLLT
FT                   FFFRHMRSLIEAGKVYIAQPPLYLVKSGKEQQYAWDDDERNSISDSMKKMQKGKANVHI
FT                   QRYKGLGEMNPEQLWGTTMDPEHRSLLQVSVENAMEADKVFSTLMGDKVEPRREFIEKN
FT                   ARYVRRLDV"
FT   gene            complement(15317..15943)
FT                   /locus_tag="Plut_0011"
FT   CDS_pept        complement(15317..15943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0011"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22903"
FT                   /db_xref="GOA:Q3B6X8"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22903.1"
FT                   /translation="MMPMDTVREYLLWNDFLRVCGIDEAGRGPLAGPVVAAAVVFPRWF
FT                   SPDEGILRRLNDSKKLTPSLRRELAPAIREEAECWAVEAVDHETIDRINILRATMLAMN
FT                   RAAESLPRQPDLLLIDGNRFTPNIPVPYQTIVGGDALVFSIAAASVLAKTERDRMMEEY
FT                   AERYPEYGFERNAGYGTREHVEAIRRHGRSPIHRTSFRLRQLGEK"
FT   gene            16195..17907
FT                   /locus_tag="Plut_0012"
FT   CDS_pept        16195..17907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0012"
FT                   /product="Ribonuclease E and G"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22904"
FT                   /db_xref="GOA:Q3B6X7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22904.1"
FT                   /translation="MKKSVKKQLLMNKTGDEIQVALVEDGRLAELIIERPESRRSIGDI
FT                   YLGRVHKVIEGLKAAFVDIGQKSDGFLHFSDVGTTTEDYRALIEDDDDDDETAADETGT
FT                   AEDGADEEEAPVAAGAPQEQQGSRQSSRSGGRKPQPQQRKEDGAEKRQSYTQLIAGKLK
FT                   ANDSILVQVIKEPISTKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVVSRKERARLKK
FT                   LVRSMLPEGFGAIIRTVAEMQEETLLKQDLEKLLAKWTQIEEKLKDAAPPQLIFKEDTI
FT                   ISSVLRDSLTSDVTEIVANSPSIHKETLNYIEWAAPEMVKNVSLYQGKLPLFEGYGIAK
FT                   DVESIFSRKVWLKSGGYIIIEHTEAMVVVDVNSGRYAAKREQEENSLRTNMEAAREVVR
FT                   QLRLRDIGGIIVVDFIDMMDARNSKKVYDSMKGELRNDRAKSNILPMSDFGIMQITRER
FT                   IRPSLMQRMGDQCPACGGSGVVQARFTTINQIERWLRKYALQHAMKFQQLDLYVSPTVA
FT                   EPLKNSDMNTELKWFLQHMLFVRVKQDESLRSDDFRFYTRKDSRDITAEYGDL"
FT   gene            17924..18787
FT                   /locus_tag="Plut_0013"
FT   CDS_pept        17924..18787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0013"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22905"
FT                   /db_xref="GOA:Q3B6X6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22905.1"
FT                   /translation="MGAYDALREEILGFSALGAQALQEMAAAREAFLRFKALLNDGSIR
FT                   AAEKGASGWTVNTWVKQGILLGMKLGRLEAGRVETGVPGSSFSFIDKDTWPLKSFTLES
FT                   GVRIVPGGSSVRDGSYLAPSVVMMPPAYVNVGAYVDEGTMIDSHALVGSCAQVGRRVHL
FT                   SAGVQVGGVLEPIGAVPVIIEDDVMVGGNCGIYEGTIVKERAVIGTGVIINGSTPVYDL
FT                   ARGTVHRKTADSPLVIPEGAVVVAGSRGLKGDFAEEHGLSIYTPVIIKYRDTKTDAATA
FT                   LEDALR"
FT   gene            18792..20486
FT                   /locus_tag="Plut_0014"
FT   CDS_pept        18792..20486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0014"
FT                   /product="C-terminal processing peptidase-3, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22906"
FT                   /db_xref="GOA:Q3B6X5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22906.1"
FT                   /translation="MGTAPFGSLKAVAFIAAGLFALGAAAPGAASTRDDRYFETARSID
FT                   LMGDVTRQVAESYVDTVDISRMLYSGIDGMLETLDPYSVFLDSEESRELGDLTSNQYAG
FT                   IGVTIAALDGSIYVTSVEKGWPAETAGLRTGDRLTAINGVLLAGKSLDAVRELIRGNVG
FT                   SPVTLRVQRHGTEPFTCRLVREEVRLSTVGHAAFLDGNGGIAYISLTSFADRSGVDLKS
FT                   ALGQLQREAVSRAIPMQGIILDLRENPGGLLDAAVDVTGSFVAKGSPVVSIRGRSAAAS
FT                   RSYATSGPPFDASLPLAVLINARSASAAEIVAGAVQDLDRGVIIGERSFGKGLVQSVIR
FT                   LPYENALKLTTAKYYTPSGRLIQKEAGDAHGSRDVLPRKKAGEGSAEVFRTASNRKVFG
FT                   GGGILPDIIATDPEPSPYLESLERKGLLFLHAALWRASHPQPPAPADSAALVQSFSGFL
FT                   ETQEFTYRSLADRKLEELKKLLAGEKTDAAKQAMAVYRTMEVEIAAGREREIGRASGEV
FT                   YTALREEVLRHYDERLAAMEGLRHDPVVRKASEIIARSRTYRKLLSR"
FT   sig_peptide     18792..18881
FT                   /locus_tag="Plut_0014"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.434 at
FT                   residue 30"
FT   gene            complement(20476..21171)
FT                   /locus_tag="Plut_0015"
FT   CDS_pept        complement(20476..21171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22907"
FT                   /db_xref="GOA:Q3B6X4"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22907.1"
FT                   /translation="MLLSLPNWIIHVFSSLEWGGAAFLLFRHGSLSGRPALRIFGLSML
FT                   PHWVGSFFVLGYHATGDAIPFMLDMSEVINLFGSIALLLATMNILRRLPKPAESGITAS
FT                   VFIGTMLIAGRPQSWMGEDVFDLILQLSSVVYLTFLVLLVMVWKRDRTVFSGVTVGGFW
FT                   FVLVFILVTVGCMYVATGIRGYPTLSHDDLLHGAAESLLSISNLLIAIGAQKSITQDRL
FT                   KRTGRPLSG"
FT   gene            complement(21172..22314)
FT                   /locus_tag="Plut_0016"
FT   CDS_pept        complement(21172..22314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0016"
FT                   /product="Geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22908"
FT                   /db_xref="GOA:Q3B6X3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22908.1"
FT                   /translation="MRYDVAVIGGGPSGAVAAAVLAKAGLSTILLERNLENVKPCGGAI
FT                   PLGLIEEFSIPPELVEKKLSHMRARSPKGRTIEMHMPNGYVGMVRREKFDRWLRSEAEK
FT                   AGAVVMEGLMDSLMPTGEGWLISTLGNKVEPFEATHIIGADGANSKTADELGFPPNELK
FT                   VIAMQQRFHYTPEIEKFRDIVEIWFDGEVSPDFYGWIFPKADHLAIGTGTEDRKHSIKA
FT                   LQKRFVEKIGIKTESYLDEAAKIPMKPRKMFAAEKNILVGDAAGLVTPANGEGIFFAMR
FT                   SGKLGAEAMVRHIKSGAPLSAYEQEFRKLYQPIFFGLEALQAIYYRNDRLRESFVAICA
FT                   DDDVQRITFDSYLYKKMVPAPWSVQMKIFSKNIYHLLKGR"
FT   sig_peptide     complement(22246..22314)
FT                   /locus_tag="Plut_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.895) with cleavage site probability 0.493 at
FT                   residue 23"
FT   gene            complement(22335..23804)
FT                   /locus_tag="Plut_0017"
FT   CDS_pept        complement(22335..23804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0017"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22909"
FT                   /db_xref="GOA:Q3B6X2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22909.1"
FT                   /translation="MTTPDTTRVQGTSLSPDKVMHKLVSLAKRRGFIFPSSEIYGGLSS
FT                   CFDYGPLGSEMKRNIKELWWNAMTRRHQNIVGIDASIMMNPTVWEASGHVASFNDPMID
FT                   DRTTKRRYRADHLIENHIEKLRRDGKDADALRVQMTYEACGASEEPNRALYELIIDEGI
FT                   KAPDTGSGDWTEVRQFNLMFQCNMGAVADSSGVVYLRPETAQGIFVNFHNVRESSRMKV
FT                   PFGIAQIGKAFRNEIVKGNFIFRMVEFEQMEMQYFVKPGTQAEAFEAWREERYQWYTRQ
FT                   LGIRPEKLHWYKHDKLAHYADLAYDIKFEFPFGIEEIEGIHSRTDFDLSRHQEYSGKNM
FT                   EYVDQVTNERFIPYVVETSAGCDRLFLAILSDAYSEDVVDGEERVVLKLAPKVAPVKAA
FT                   VLPLMKKGGMGEAAMKLRDELAESFPVQYDDAASIGKRYRRQDEIGTPFCITVDHQSIE
FT                   DGTVTVRFRDTAQQERIDMSQTAAFITAKMA"
FT   gene            complement(23865..24194)
FT                   /locus_tag="Plut_0018"
FT   CDS_pept        complement(23865..24194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22910"
FT                   /db_xref="GOA:Q3B6X1"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22910.1"
FT                   /translation="MKPLRISRDMYTCIDPGTKHETLESPATPGTDTGDAYRVVLFNDE
FT                   EHSFDEVIFQIILAVRCSRQKAQQLTMEVHNSGRAIVFSGLIERCIRVSAVLEEIALKT
FT                   EIQSV"
FT   gene            complement(24249..25199)
FT                   /locus_tag="Plut_0019"
FT   CDS_pept        complement(24249..25199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0019"
FT                   /product="Muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22911"
FT                   /db_xref="GOA:Q3B6X0"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6X0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22911.1"
FT                   /translation="MTQLLPHALAPGETIGLISPSSHSTRPERIEQAVSYLEKNGYRVK
FT                   PSRHLNRISTDPEVADREKLYDLHAMFQDPAVRAVICLRGGAGASRLLGSIDYELIRKH
FT                   PKIFIGYSDITALSLAILAKTGLVNFSGPMLATELHDPTPCTEEHFWGMLTSPLFALSI
FT                   RNCPAHRISVLRPGTAEGPLIGGNLTMLSSMVGTPFLPSLDGALLFLEDVNEASYRIDR
FT                   MLAQLLNAGQLEGCRAILFGQFSNGGVQQEEEDRLLRIFNYYADRCRNLGPVVTGLSYG
FT                   HVADLMTLPVGAHCRVEVSGSGAFSLGATAPVITA"
FT   gene            complement(25266..25532)
FT                   /locus_tag="Plut_0020"
FT   CDS_pept        complement(25266..25532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0020"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22912"
FT                   /db_xref="GOA:Q3B6W9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22912.1"
FT                   /translation="MAKSDKGFDVDIVTPQKLHFSGEVVSVIAPGQDGLFQVMKNHAPL
FT                   LSALKGGKVRLSLADKTEKTFTISDGFFEVSANKAILLTESVS"
FT   gene            complement(25546..26994)
FT                   /locus_tag="Plut_0021"
FT   CDS_pept        complement(25546..26994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0021"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22913"
FT                   /db_xref="GOA:Q3B6W8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22913.1"
FT                   /translation="MTTGSLNSKLYNINPIHTVTMQEGKISQIIGPVVDVDFPEGQLPS
FT                   ILDALTITRPDGSRLVLETQQHLGEERVRTVAMESTDGLIRGLSVANTGRPIQAPVGEG
FT                   VLGRMLNVVGDPIDGRGPVNATKTYSIHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSR
FT                   GGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVID
FT                   KTALVFGQMNEPPGARARVALTGLSIAEYFRDEEHRDVLLFIDNIFRFTQAGSEVSALL
FT                   GRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDA
FT                   TTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQSVKQILQRYKDLQDIIAI
FT                   LGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDSIKGFKEIIAGKH
FT                   DNLPEGAFYLVGTIEEAIEKAKTL"
FT   gene            complement(27006..27078)
FT                   /gene="tRNA-Thr3"
FT                   /locus_tag="Plut_R0048"
FT   tRNA            complement(27006..27078)
FT                   /gene="tRNA-Thr3"
FT                   /locus_tag="Plut_R0048"
FT                   /product="tRNA-Thr"
FT   gene            27264..27791
FT                   /locus_tag="Plut_0022"
FT   CDS_pept        27264..27791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0022"
FT                   /product="thiol:disulfide interchange protein, thioredoxin
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22914"
FT                   /db_xref="GOA:Q3B6W7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22914.1"
FT                   /translation="MKMIRRTVFLLTAALLLVVRPAATLSAEPSTAQGVKAPVFSGITL
FT                   EGKRISSASLAGKPYIVNFFASWCPPCRHEIPDMVALQKVYGPKGFTFIGVAVSDSEPA
FT                   IRAFVSKAGITYPVMMGDEKIVGAFSGQVRGGMRSIPTSFVINSSGRITEVITGARSRD
FT                   EFEKKILQSFKK"
FT   sig_peptide     27264..27347
FT                   /locus_tag="Plut_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.489 at
FT                   residue 28"
FT   gene            27941..29806
FT                   /locus_tag="Plut_0023"
FT   CDS_pept        27941..29806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0023"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22915"
FT                   /db_xref="GOA:Q3B6W6"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22915.1"
FT                   /translation="MSATQINAPDFVTNKKLLQWVQETADMCCPDNVYWCDGSQEEYDS
FT                   LCQQMVESGTFIKLSEEKRPNSYLCRSDPSDVARVEDRTYICSIRRQDAGPTNNWVAPK
FT                   EMKETLRGLYTGCMKGRTMYVIPFSMGPLGSHIAHIGVEITDSPYVVTNMRIMTRMGRK
FT                   VLDLIGSDSEFVPCLHSVGAPLEPGQADVPWPCSDTKYIVHFPEERAIMSFGSGYGGNA
FT                   LLGKKCFALRIASSMARDEGWLAEHMLILGVESPEGEKTYVGAAFPSACGKTNFAMLIP
FT                   PQAYDGWKVTTIGDDIAWIKPGEDGRLHAINPEYGFFGVAPGTSMKSNPNAMASLSRDT
FT                   IFTNVAMTLDGDIWWEDMTDEPPAELIDWQGKPWTPGCGRPSSHPNARFTSMASNCPSI
FT                   DPDWENPKGVPISAFIFGGRRRDTVPLVYQSANWNFGVYLAATMGSEMTAAAAGTIGQV
FT                   RRDPFAMLPFCGYHMGDYFNHWLHVGRTIQDPPRIFGVNWFRKDENGKFLWPGFGENMR
FT                   VLQWIVGRVRGRATAVESPLGWMPKYDALNWSGLDAMTPEKFSKLMEVDSEAWKKELLS
FT                   HEELFEKIYDRLPKEFPHIRELMLSTLWLSPAHWAMAPERFSGEN"
FT   gene            29961..31346
FT                   /locus_tag="Plut_0024"
FT   CDS_pept        29961..31346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0024"
FT                   /product="toluene transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22916"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22916.1"
FT                   /translation="MFRKSFAGAAIALSVCCTSTAMATNGMNLEGYGAKSHAMGGAGMA
FT                   FDTGNSAVMNNPATLGYMKDGVSEIGIGIRGLHPNVDLNYSGMTDESGATGFYMPSLSY
FT                   MQKDGNITWGAAVLSQGGMGTDYGNDSPLYQGGYSDASDANDPILLSGKDIRSEVGVGR
FT                   VMFPIAYNLTENTTIGVSADFVWASMDLQMDMDGMHFGMMETGGSMLPTVTEGTLNYVR
FT                   YDFSNGTPFIGSAVGYGTGFKLGFTHKLSKLLTIGGTYHSQTMMSDLESSNAKLTVVNT
FT                   VDNTARTQEVSGKIKVNDFEWPATFAAGVALHPTNRLMIAGDIKYVDWSSVMDKFSTTF
FT                   VADNTTANGAYAGKTLDMSMKQDWRDQTVYSIGVEYKATKRLALRGGASLSTNPVPDAY
FT                   LNPMFPAITKDHYTCGFGYRVTDDTKVGAAFSYAPKVTETNGEGMVISHSQANWSFNLV
FT                   HNL"
FT   sig_peptide     29961..30032
FT                   /locus_tag="Plut_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.977 at
FT                   residue 24"
FT   gene            complement(31450..31728)
FT                   /locus_tag="Plut_0025"
FT   CDS_pept        complement(31450..31728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22917"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22917.1"
FT                   /translation="MRAGRASCPSRNHDFFQSIKSLAPMSAHVYKKIEIVGSSATSIEE
FT                   AINNAVAKAAESVRNIRWVEVLETRCHVEDQKVAYFQVTCKIGFTLD"
FT   gene            31996..33567
FT                   /locus_tag="Plut_0026"
FT   CDS_pept        31996..33567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0026"
FT                   /product="Fe-S-cluster-containing hydrogenase components
FT                   1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22918"
FT                   /db_xref="GOA:Q3B6W3"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22918.1"
FT                   /translation="MNYGFVIDARKCIGCHACSVACKSENQVPLGVNRTWVKYVEKGTF
FT                   PDTRRYFTVLRCNHCEEPPCVDICPVEALHKRPDGIVDFDSRRCIGCKACAQACPYNSV
FT                   YIDPETQTTAKCSYCSHRVEIGLKPACTVICPQQAIISGDLDDPQSEISKLVANERTVV
FT                   RKPEKGTGPNVFYINGDGASLDPFQAPEEDAYMWSAQSRGVGHFAKHAVHGEGHGVPDR
FT                   SAVGSHGAKPKAGAPRRVYDAPSKGSVWGWEVPAYVWSKAVSAGAFLLLFAFALMPDAA
FT                   LSPAMQWGLWAISLVFLALTGAFLVKDLDRPDRFTSVMLRPQFGSWLVRGGLTITGYGA
FT                   FLALWGAGTWLALPMLASAGLWGGAAMALLTAVYTAFLFGSAKGRDFWQSPMLSLHMLL
FT                   NSVIAGGAAMALLSLFTGIDEGAAGQLRMVLTGAFVLHLLVMATELYGRHPSVGAERAA
FT                   EAIRSGSLKNDFWFGSVLLGNLLPLLAVLVPTGSLTLAVASIFALAGVFYTEKVWVKAP
FT                   QTISLS"
FT   gene            33587..36454
FT                   /locus_tag="Plut_0027"
FT   CDS_pept        33587..36454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0027"
FT                   /product="molybdenum enzyme related to thiosulfate
FT                   reductase and polysulfide reductase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22919"
FT                   /db_xref="GOA:Q3B6W2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22919.1"
FT                   /translation="MSYKHKPTVIETLAEKVGIIADLHSDTATGAVPMPIEGPPVACPP
FT                   PEKWDNWVEYDSKSWPERKSNEYMLIPTACFNCEAGCGLLAYVDKKDMKIRKLVGNPYH
FT                   PASRGRNCAKGPATLNQVEDQDRVLYPMKRVGKRGAGKWERVSWDSVLDDIAGRMRKAI
FT                   MEGRNNEISYHVGRPGHDGFMEWVFRAWNVDGHNSHTNVCSSGARFGYAIWEGFDRPSP
FT                   DHANAKFILLVSAHLESGHYFNPHAQRIVEARMKGAKLAVLDPRLSNTASMSDYWMPTY
FT                   PGTEPAVMLAMAKVIIEEGLYNRDYLENWVNWKEYLANEYPGSQVSFEAFIEALAKEYA
FT                   KYTPEYAEKESGVPAATIIDVARQIGAAGTQFSTHVWRSASSGNLGGWAVSRTLHFLNV
FT                   LTGSVGTVGGTAPSAWNKFKPTVPASPKPQTHWNELHLPNEYPLAHFEMSFLLPHFLKE
FT                   GRGKLDVYFTRVFNPVWTYPDGFSWIEALEDESKIGMHAALTPTWSETAYFADYVLPMG
FT                   HSPERHDIISYETHAGKWIAFRQPVLRVASEKMGKPVTFTWEANPGEVWEEDEFWIELT
FT                   WRIDPDGSLGIREHVTSPYRPGEKITIGEYYRYIFEHTPGLTEAAAKEGLGAFEYMQKF
FT                   GAFEIENKVYDVNRKSPSPTELQGAEVNPESGLITSNGKAVGVEVKGEACTGFPTPSRK
FT                   QEFYSQTMVDWKWPEYRLPGYIKSHIHEEKMDHSKGEFVLVPTFRLPVLIHSRSGNAKW
FT                   LAEIAHRNPVWVNATDAAMLGLENGQLIRVNTDIGFFINRALVTEGIRPGVLACSHHIG
FT                   RWRREEDASCNRWAANTVKITKEGGSKWKMRVEKDVQAHESADADTSRIFWSDGGVHQN
FT                   ITFPVHPDPISGMHCWHQKVRIEPAHEGDEYGDVFVDTDRSQAVYREWLAMTRPAPGPG
FT                   GLRRPLWLNRPFRPEEKTFYLNEGK"
FT   gene            37506..37934
FT                   /locus_tag="Plut_0030"
FT   CDS_pept        37506..37934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22920"
FT                   /db_xref="GOA:Q3B6W1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22920.1"
FT                   /translation="MKQDTLGKPPVQNEQLAYAGVLDKMSHFGMLFLGGSYAAYVFLLL
FT                   PQEVTISDMAANWHLKASVMQAKLNAPVGWSFMASPESFLRGEALSYLAIIMICMIPVV
FT                   CLLVTAPAFFREKRPIFGVIALLQVLILLVAATGMLVR"
FT   gene            38093..38602
FT                   /locus_tag="Plut_0031"
FT   CDS_pept        38093..38602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22921"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22921.1"
FT                   /translation="MAETKKLAIIASQGTLDWAYPPFILASTAAAMDMEAVVFFTFYGL
FT                   PLLKKEIDAKVAPHTNPAMPMKMPFGSKDFQSINWPVPNIISGNIPGFDSMATSLMKET
FT                   FKKKGVATVEQLREMCQEAGVRFIACQMTMEVFGFSKEEFIDGVEYGGAATFLEYAADA
FT                   DISLFI"
FT   gene            38626..39099
FT                   /locus_tag="Plut_0032"
FT   CDS_pept        38626..39099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0032"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22922"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22922.1"
FT                   /translation="MTTLSELVEECLPDVQEIMPWHLVERMAGVPGLLIVDVREPYEFE
FT                   AMHIEGSVCVPRGILEAACEWGYEDTLPELAAGRDREIVVVCRSGRRSVLAAYAMQRLG
FT                   FLNVRSLRTGLRGWNDYDEPLVDADGAVVGTNDADSFFLSRLRPDQMPPKAGN"
FT   gene            39148..39384
FT                   /locus_tag="Plut_0033"
FT   CDS_pept        39148..39384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22923"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22923.1"
FT                   /translation="MSAIAAATELDCKGLNCPLPILKTKKAIDALQSGEVLKMMATDPG
FT                   SVNDMASWANRTGNEVVEHTEDGGTHTFFIRKK"
FT   gene            39388..40824
FT                   /locus_tag="Plut_0034"
FT   CDS_pept        39388..40824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0034"
FT                   /product="cobyrinate a,c-diamide synthase /
FT                   hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22924"
FT                   /db_xref="GOA:Q3B6V7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22924.1"
FT                   /translation="MPVKKNEAVIGRLMVSAPGKSSGKTTITLALTHALSAAGDRVMCF
FT                   KKGPDYIDPAWHRLAGAEESHNLDPWMMGEDGCLQSFSRYALRGSAALNLIEGNHGLHD
FT                   GISLDGSDSSAGLASMLKAPVLLVVDALSAGRGIAAIVMGMQQMEPHADIRGVVLNRVR
FT                   TKRQGEKQRLAIERYCKVPVLGAIPVDERLVIPERHLGLTTVDESGEGAEAAIRGASET
FT                   VAAHCDMEAIRNIFFSASPVPLEDMPEAEAGIPLSGRARIGVFRDKAFCFYYPENLEAL
FT                   RDRGAELVFIDSMKDKKLPALDGLYLGGGFPESFIDEIAANRTLCDSVRHAVESGMPLY
FT                   AECGGLIYLSSGATWNGKRHQLAGVLPLEIDFQKHPAGHGYLELKSLHCSPWFSESERV
FT                   RAHEFHYSKAVAINGRPQWQFDVVRGTGISGDYDGILQGNLLASYAHIHAVATPGWAET
FT                   FVSLSALFRSSSRSCTTTSA"
FT   gene            41104..41439
FT                   /locus_tag="Plut_0035"
FT   CDS_pept        41104..41439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0035"
FT                   /product="sulfite reductase, dissimilatory-type, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22925"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22925.1"
FT                   /translation="MGITINGVTVETDENGYLVNLEDWTEEIAGKLAEGEEIDMKDEHW
FT                   ALVKFLRNYYDEYQIAPAVKVLTKAIAAEQGIDKKEASEFLYGLFPKGPALQACKVAGL
FT                   PKPTGCV"
FT   gene            41498..42751
FT                   /locus_tag="Plut_0036"
FT   CDS_pept        41498..42751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0036"
FT                   /product="dissimilatory sulfite reductase alpha subunit"
FT                   /EC_number="1.8.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22926"
FT                   /db_xref="GOA:Q3B6V5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22926.1"
FT                   /translation="MEEAKGAGSCGSHQCGHSGGGCGDKFLNPTPMLDELENGPWPSFV
FT                   GGFKELAERTKKPMLRGVMDQLEYSYNTKMGYWKGGLVTVDGYGAGVITRYSMIKDKIP
FT                   EASEFHTMRIQPAPGLHYNTEMLRELCDIWEEYGSGIITLHGQTGDIMLQGIEQDKVQE
FT                   CFDRLNEKGWDLGGAGAGMRTAVSCAGPARCEQACYDNLELHLHALRHFVSQLHRPEWN
FT                   YKIKFKFSACPNDCTNAIMRSDLAVIGTWKDAIQVEEPAVKEWIEKNGVDALVNQVINL
FT                   CPTRAISLENGGMKIESRDCVRCMHCLNVMPKALSPGKERGISLLMGGKNTLKVGVNMG
FT                   SLIIPFMKMETEEDREAFMELVEEIIDWWDDNGLDHERIGESIERVGLKQFLEGVGIDV
FT                   DINQVARPRDNPYFKAKY"
FT   gene            42893..43972
FT                   /locus_tag="Plut_0037"
FT   CDS_pept        42893..43972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0037"
FT                   /product="dissimilatory sulfite reductase beta subunit"
FT                   /EC_number="1.8.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22927"
FT                   /db_xref="GOA:Q3B6V4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22927.1"
FT                   /translation="MSSPERTWKTIESGPHTYQEALHPVVRKNYGKWKYHEIPRPGVLK
FT                   HVAESGDAIYTVRAGTPRQDTVDMVRRLCEIADRFSDGHLRFTVRNNVEFLTPNPDNVE
FT                   PMIKELESMGFPVGGAGNCVSSVSHTQGWLHCDIPATDASGVVKSMMDTLYHEFKHMEM
FT                   PNKVRLSTSCCSINCGGQADIAVVVKHTRPPRINHEHLSMVCELPKAVARCPVAAIRPT
FT                   VVDGKRSLMVDEAKCICCGACFGACPAMEINHPEHSKFAIWVGGKNSNARSKPSTMSIV
FT                   AHNLPNNPPRWPEVTDAVGRILTAYKAGGRPWERVGEWINRIGWKRFFEETGLTFDEDM
FT                   IDSYRHARTTFNQSAHVRF"
FT   gene            43990..45726
FT                   /locus_tag="Plut_0038"
FT   CDS_pept        43990..45726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0038"
FT                   /product="iron-sulfur cluster-binding protein, GltD family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22928"
FT                   /db_xref="GOA:Q3B6V3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22928.1"
FT                   /translation="MQVESNPILDFATNWKFPAYSELTGEDKIVAFGDHSHKCPVYVRQ
FT                   TPPCSAECPAGEDIRGINRLLNGVDPSDDPMKAAWQRAVDTNPFPAVMGRICPHPCQGG
FT                   CNRQYHDGSVSINAVEQAIGNYGIEKGLQLPAPGPDSGKRVAVVGGGPAGLSAAYQLRR
FT                   MGHAVTIYDANQKLGGMVLYGIMGYRVDRKVLETEIGRITALGIETKMGVRVGRDITQA
FT                   ELEKEYDAVFLGIGAQVGRSLPVPGFEGSLSATNAIEFLRNYEVMGDDVPVGKKVVVIG
FT                   DGNVAMDVARLALRLGSEAILVSGVPREEMACFDNEFLDAVREGTTVHYMSGTVEVLRD
FT                   GEAVRGLRCSKMVKKEKGEEGWNSPIPFLRYKSTGETFDIDADMVVAAIGQGTDFSGLD
FT                   GVIGSGPWMKVDRHFRIPGRENVFGGGDALKVDLITTAVGHGRKAAESIDAFLKGEPLP
FT                   EPVRREVTKAQKQDLLYFLPVAPATRVNRELDVVVGNHDELLEALSPEQVKAESERCMS
FT                   CGLCFDCKQCVSFCPQEAVLRHRDNPSGEKVETDYVKCVGCHLCSLVCPSGYIQMGMGD
FT                   GL"
FT   gene            45713..46156
FT                   /locus_tag="Plut_0039"
FT   CDS_pept        45713..46156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22929.1"
FT                   /translation="MMVCNPQHPIPPPSLRRDMDNRKTMYEELIARITRAVDASEKWAE
FT                   NGWAVTFGPRGEEVLNLKSAEALGRAISFRREAINYWKQAQLTGQDAAASGRKALRALE
FT                   AGDEPAAMNALYFCRYIEAPFAQQANTWSPLYDSLSAKTACCC"
FT   gene            46203..46562
FT                   /locus_tag="Plut_0040"
FT   CDS_pept        46203..46562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0040"
FT                   /product="DsrE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22930"
FT                   /db_xref="GOA:Q3B6V1"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22930.1"
FT                   /translation="MNIGILLKEGPYNHQASDTAYKFAEAAIRKGHRIDAVFLYNDGVI
FT                   NATKLGDPPQDDRNIAERWSALATEHGFEVLACIAASKRRGITDELMIKGGSITGLGTL
FT                   TDIAIRNDRLLTFGD"
FT   gene            46569..46937
FT                   /locus_tag="Plut_0041"
FT   CDS_pept        46569..46937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0041"
FT                   /product="DsrF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22931"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6V0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22931.1"
FT                   /translation="MEENIKKIMHVMRRAPHGSIYTYEGLEMILIMAAYEQDLSVAFIG
FT                   DGVYALKKGQETEGISMKGFAKTFMALDGYDVEKLYVDRTSLEERGLTEEDLLVDVEVL
FT                   DSAEIGRRMNEQDVVIHH"
FT   gene            46995..47288
FT                   /locus_tag="Plut_0042"
FT   CDS_pept        46995..47288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0042"
FT                   /product="DsrH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22932"
FT                   /db_xref="GOA:Q3B6U9"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22932.1"
FT                   /translation="MLHTINKSPFESPSMQECIRFAAPGDPVLFIENGVYAVQSSGRYA
FT                   SDIAALLTTNPVYALQPDLEARAVGSLVEGVERVGYDGFVDLVEAHRVNSWL"
FT   gene            47315..47758
FT                   /locus_tag="Plut_0043"
FT   CDS_pept        47315..47758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22933"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22933.1"
FT                   /translation="MMNNWMQAASRNRSALLDRWISAGLGMFPEHMSQATPAGEALADA
FT                   MGTVLDNIGGGDDCREGIERLTRIFAVQPLPPSKSLALFGALCDLIQELIPEDAGREAC
FT                   RRRMDEMTLEAFDCFMENRENIYRLKVDEARSQMHMLLRRAVS"
FT   gene            47755..48750
FT                   /locus_tag="Plut_0044"
FT   CDS_pept        47755..48750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0044"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrM"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22934"
FT                   /db_xref="GOA:Q3B6U7"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22934.1"
FT                   /translation="MKKVFMPLVMVAVLSCIPYIGVAHFGMGYLFGVIIPYLAVLLFVA
FT                   GFAWRMYDWLSRPVPFCITTTCGQEKSLDWIKHQKLESPATKWQATLRVLMEVFFFRSL
FT                   FRNTKAELHTGPQLAYASSKWLWMGGLAFHWSLLLIGLRHARFFFIEPPLFVQLIERTD
FT                   RFFELTLPAFYMTDAIVLAAITYLVARRLRDAKMRIISLQTDFFPLFLIGGIVIFGMSM
FT                   RYVAKVDVLAIKALMLNLASFSFDAPGAISPLFYIHLFLASVLAAYFPFSKLMHAGAIF
FT                   LSPTRNLANNSREKRHINPWNKKIKFRTYSEYEDDYRDKMKKAGLPVEKD"
FT   gene            48753..50402
FT                   /locus_tag="Plut_0045"
FT   CDS_pept        48753..50402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0045"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrK"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22935"
FT                   /db_xref="GOA:Q3B6U6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22935.1"
FT                   /translation="MSKYAPKKNQLTREFLEKPTPLKGDFAREEWWDMPVEFRDGNWCH
FT                   SAKPEVLGEIGFPNPRKWAAPDEDWQLPEGWEKTIHEGLKERLKKFRSLKLYLDACVRC
FT                   GACADKCHFFLGTGDPKNMPVIRAELLRSVYRNDFPMVEKILKGFSGSRKLTKEVIKEW
FT                   HMYFYQCTECRRCSVFCPLGIDTAEITMVARELLNLIGVNNNWILAPVANCNRTGNHLG
FT                   IEPHTFVQNIESLVDDIEDLTGVTVNPTFNRKGAEVLFITPSGDVFGDPGVYTMMGYMM
FT                   LFEHIGLDYTISTYASEGGNFGLFTTNDMMKKLNAKMYHEAERLKVKWILGGECGHMWR
FT                   VVHQYMNTMNGPAGFLEQPVSPVTGTKFQNAAATKMVHIAEFTADLIHNNKLKLDPRRN
FT                   DHLRTTFHDSCNVARGMGMFEEPRYVLNNVCNSFNEMPEDTIRERTFCCGSGSGINAEE
FT                   FMEMRMRGGFPRANAVRSVKKSHRVNSLVTICAIDRATLPSLMRYWNPGVTVYGLHELV
FT                   GNALVMQGEKKRTVDLRENPMAGTGEGESDAQ"
FT   gene            50392..50772
FT                   /locus_tag="Plut_0046"
FT   CDS_pept        50392..50772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0046"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrJ"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22936"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22936.1"
FT                   /translation="MLNKNTLIGLVIVAMLAAAAYLATGAEINDAVPAADPGTADSTGC
FT                   IYPKEYMQTHHMQVLADWKEHAAHEGPDAVMTTPDGRRFQKDLATCLGCHDNNRFFCFS
FT                   CHNYANVKPNCWNCHISPQDLP"
FT   sig_peptide     50392..50460
FT                   /locus_tag="Plut_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.372 at
FT                   residue 23"
FT   gene            50796..51527
FT                   /locus_tag="Plut_0047"
FT   CDS_pept        50796..51527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0047"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrO"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22937"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22937.1"
FT                   /translation="MRKAGLGLIAGLGAASGIIGNPLFERVSASAWASSPKQPGRRWGM
FT                   LIDTRLCPAGCTACVDACRLTHNVPTFSDPRRRVEWIHKEEGRALLGTACATKQTMPAL
FT                   CNHCAEPSCVRACPTDSIFRRKDGIVAIDYHRCIGCRSCMLACPYGEVSFNWSDPRPAI
FT                   KEPTPDYPTRQQGVVEKCNFCSDRLKKGLEPSCSSRCPEGAMTFGDLNDPKSAIRRLLQ
FT                   ANETMRRKAELGTEPSVFYII"
FT   sig_peptide     50796..50897
FT                   /locus_tag="Plut_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.820) with cleavage site probability 0.262 at
FT                   residue 34"
FT   gene            51561..52736
FT                   /locus_tag="Plut_0048"
FT   CDS_pept        51561..52736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0048"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrP"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22938"
FT                   /db_xref="GOA:Q3B6U3"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22938.1"
FT                   /translation="MFEKALKGNAAYWSWIGFLAILAGAGIHGYRVQGDEGLAATGMGV
FT                   GAVWGIYNAQLPFLAGLAASALFILVPERLLKQTELSAAAPLSAFLAAVASAMSLLFIA
FT                   AGLGMPSRIPTLLMNMSPSSPASWHAPALMAYLVLSLGAGWALLASRRKGTTPPRWLRP
FT                   LVMLALPVGLALPVIAAFMLAVMPTYGLWTSAMLAPRILVSGLAAGMGLLLFMVVALRR
FT                   SAGPDEGKELVERLAGYTALAGLASLIFIGLDAGTAFLGNLPSETYALRLLYSDMARQA
FT                   LPPAYAPFASLPSVLLAAGAVSVVLLLVPAVQRKGGMLPAAAGLLIAISAWFDRGPGLI
FT                   LAGQASPDGGTVYAPAMPDMQVTIGIWAGGALLLTALLKVTISVRRSREAL"
FT   gene            52733..53200
FT                   /locus_tag="Plut_0049"
FT   CDS_pept        52733..53200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0049"
FT                   /product="porphyrin biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22939"
FT                   /db_xref="GOA:Q3B6U2"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22939.1"
FT                   /translation="MSTFIPLNIRIDGRRILFVGGGALVMHKLQSVRLFTGDITVLAPD
FT                   ISPEVSATDVHQLRKSYATSDLDGFFLIYACSEDDRLNRRVLADAQEKGILCNIVDNRM
FT                   DSDFISPALFRHDGMTVAVSSDGRNARRSVEWRNAIRALFLGTECHPASNL"
FT   gene            53176..54579
FT                   /locus_tag="Plut_0050"
FT   CDS_pept        53176..54579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0050"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22940"
FT                   /db_xref="GOA:Q3B6U1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22940.1"
FT                   /translation="MSPSKQPLKYPDMKKKDQQTKGYVYIIGAGPGDPDLLTLKAERAL
FT                   QASDVILYDDLVTSALVDRFEGLKIYTGKRKDSHHFEQDAINEEIVRHALRGKTVARLK
FT                   GGDPFVFGRGGEEIDVLRQHRIDYEIIPGITAAHGASSYSEIPLTMRKVSSSVAFCTGH
FT                   PINKIQAPDADTLVYYMVASSVHAVLEAVLKKGRSESTKVAIVQNATRYNQQVFTGTIG
FT                   EFLRRDRVAYSPALLIIGENINHFIEENWYSRKKKVLTVGGEPAQFSSREYVRVNFPCR
FT                   REEAAERSVLEECFHGIGDWPVVFFPNRFAVKYFFGYLMEFGRDVRHLAGARICTLGRP
FT                   AATELQKYGVLSDLVLEPESPSAIAGMLRDGGICNDRVLLPGSNLVDSYLVNALEEEGN
FT                   TVTPLSVYLHGKHEQEESIDLDFIDEIWFSSPSCVKNFSALYRSIPENITVTTADVETA
FT                   AEYARLFGS"
FT   gene            54569..54832
FT                   /locus_tag="Plut_0051"
FT   CDS_pept        54569..54832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22941"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6U0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22941.1"
FT                   /translation="MAAEPVHQNRTKDPFPMAPEHASALFYRCSLNRSEEAGREPAAGR
FT                   EGEPSVPDSCIGDGCRSCDTAGRERGQGFVDECGRGTEAEAY"
FT   gene            55086..55667
FT                   /locus_tag="Plut_0052"
FT   CDS_pept        55086..55667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0052"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22942"
FT                   /db_xref="GOA:Q3B6T9"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22942.1"
FT                   /translation="MAISGESGSGKSELSHALAQDLKKAGEQPKILHTDNYYRVAPSER
FT                   LALRIADNFKHVGVGEYDWDLLKSNIGDFRSGRMSLMPCIDIVSGQLDRLITDFSKVDV
FT                   LVVDGLYALGIKDADLCVYIDLTWRETRKNQALRGKESDDLYRLRVLEKEHEDVLAFRY
FT                   RADLIIDHDYLVHEAPDPDDAAAEGDYAGF"
FT   gene            55654..56949
FT                   /locus_tag="Plut_0053"
FT   CDS_pept        55654..56949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0053"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22943"
FT                   /db_xref="GOA:Q3B6T8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22943.1"
FT                   /translation="MQGSNDPLRTDGARSIKASLLSAFPAFQSPNFRRYFPGQVVSMVG
FT                   TWIQMVAQGWLVLELTGSAFDVGLAAAASTLPTLFLSLIGGVIVDRYPRRTILFWTQSS
FT                   AMVLAFILGIFALTGTVTMPIILLLSFLLGCVNAINVPALQSFLSEMVEREHLSSAIAL
FT                   NSAIYNGSRVIGPAIAGVLIAAAGTGTAFMLNGFSFFAVLLSLFMIKAGQRNPSGTEPV
FT                   HPVRAITDGLRYSWRHPLIRTIVIFIAIISIFGWSYVTMLPVVAKRSFNMDATGLGYLY
FT                   GVSGIGSVIGTVLISMYSGRVDRLVFIAGGTILFALSLIGFTYTLWLPLALFFLFLCGF
FT                   GLVAAVATMSATIQGTVEDRYRGRVMSLYMMVFMGFMPIGNLQVGWLSEQFGTGPAIRF
FT                   GCLVTLFAAVVIIFYSRRVRSDYQRYREELKL"
FT   gene            complement(56993..58612)
FT                   /locus_tag="Plut_0054"
FT   CDS_pept        complement(56993..58612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0054"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22944"
FT                   /db_xref="GOA:Q3B6T7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22944.1"
FT                   /translation="MKSAAAHPSSMPSVANGSEAHAYETGVRRTIITLTVIVAAMLELI
FT                   DTTIVNVAINHISGNLGASIEDVSWVVTSYAIANVIVIPLSGFLGNLLGRRAYFIGSIL
FT                   LFTLASLLCGLADNIWTLVFFRFLQGIGGGALLPTSQAILYETFRPEERGAATGIFSMG
FT                   LVLGPTIGPLLGGYLVDYFSWEWCFFVNIPVGLLAAWSAFTFIREPKVRHKVQKIDWTG
FT                   IGLLAAGIGSLQFILERGQSKDWFDTPYITWFTLIALTSLVAFVWWELHTEHPAVDLSV
FT                   LSRSKNLAIAAVLTFIVGYGLYGSLFVFPVFVQRLLGFTAVLTGLVLFPSAMLTGAISL
FT                   PLGIALQKGASAKLMMAFGMAAFMVFSWELGQQTLQSGAENFFAVLLLRGLALGFIFIP
FT                   VTMLAVTGLHGRDIGQATGLNNMVRQLGGSFGIAITNTYVAQRVAAHRVELAGHMSAYD
FT                   SAALERLEAIKQAAGARAALSPADAENLANRALEGTVMAQSYHLAYMDAFMLIAVLFLC
FT                   SLPLLLFIREKKGDQGHAPEAH"
FT   gene            complement(58625..59623)
FT                   /locus_tag="Plut_0055"
FT   CDS_pept        complement(58625..59623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0055"
FT                   /product="multidrug resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22945"
FT                   /db_xref="GOA:Q3B6T6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22945.1"
FT                   /translation="METPERQQQAAPEAPKAGSGKKGPVSLVKMAVLGVLASIGLIWAG
FT                   QMIHHSLLYEETDNAQIEGDIYPVISRVPGKVLEVTAEDNRLVKKGERLIALDSLDFVV
FT                   RRDEARAVLKNAEAAAAGARASISAASANEMKLQADLMRSRNLHRQDVISKAELDGVNA
FT                   AALGASAGHEEAESRYRSTLAQVELRQAELRNAELQLSYTSIKAPANGHISRKNVHAGQ
FT                   FVQPGQQLIALVGSGRLWVVANFKETQMEKIRPGQNVLIRVDAFPDEEYEGTIESISAG
FT                   TGAKFSLLPPDNASGNFVKVAQRVPVKIVFDRKPERHLSTGMNVVVDVRVD"
FT   gene            complement(59631..60104)
FT                   /locus_tag="Plut_0056"
FT   CDS_pept        complement(59631..60104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0056"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22946"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22946.1"
FT                   /translation="MNRHCNSTVLCPVDFSADSDNTLQYLAGQHPEQGKLFILHVAEDN
FT                   GTDRETLLRKHLMQFSAYSELLAGSGWEVRFAVEYGTPADVIVDFARKHGAGLILMGSH
FT                   GRNRMPRLLVGSTAETVLRQAHCPVSILRMPEIAAEPMAGSEFREFLSQTANA"
FT   gene            complement(60101..61513)
FT                   /locus_tag="Plut_0057"
FT   CDS_pept        complement(60101..61513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0057"
FT                   /product="outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22947"
FT                   /db_xref="GOA:Q3B6T4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22947.1"
FT                   /translation="MTHFYQMPPWHRNCTGYTALQQKTPPTMNRTFASALILLAATTAG
FT                   LPLSTGARAMELTLDAALSRMDETSPALRSAREGVNAADAGVEAKRSGWFPEIAATATY
FT                   GYHDRVSQFDGMQFMPNDSYDARISASMMLFDFGRTAKSVTIATSGRNAAGYRLALTQR
FT                   DLSWATIQIFYDMLFLREAIGVQEKEITALEKNLDVTMKRYREGVATRFDLLSTEVRLA
FT                   SAKNRKLDLETELANQEISLRRLAAIADGEPLELKGSFSMAEEPSLAPAPESEALQNRL
FT                   EVKLATEHARAAREKKSLAGRQGLPKITGSVSWGSSNGWLPDSDPDLGTMRTSTTAGLQ
FT                   LELPLFTGFRTAAGRREALAMQRAAEQDRIEAEQRVRAEVRQTSRALKTSREKITTTAL
FT                   QVEQARLAAENARIRHMNGLATTLDLLDTEASLAGAELGNLQARYAFVMNTYAFRKASG
FT                   MPLMQEPSIQAK"
FT   sig_peptide     complement(61349..61513)
FT                   /locus_tag="Plut_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.962 at
FT                   residue 55"
FT   gene            61643..63742
FT                   /locus_tag="Plut_0058"
FT   CDS_pept        61643..63742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0058"
FT                   /product="DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22948"
FT                   /db_xref="GOA:Q3B6T3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22948.1"
FT                   /translation="MSAEIHQESLRLMQYISDAVGTLRDPRELFHTLTDKLRLIFEFDS
FT                   AVIITLDKDRRHVSVFFEMLRFELPEGVTREKRLIAGSWFEPFLADPAVTVFSIERELQ
FT                   AHGDEAFPVLKILHGLGMRQIVLSPLRSGGRVIGFLNFVSREENVWSAADRELLAGVSS
FT                   PIAMAVSNAMAYEELREREAQTAMQLAVNNALMTIRDRRKMLLAVCEQINKLVPAAFLG
FT                   IRVFGDDGRARLFDNFMKDEHHRFMPVSVEERLELVEPEVAVRESLELIGRPGVYSGGV
FT                   FSRLAEEYSLVAEVRDKYRISTLISAPLWDLPGSRAGVIISGSESPFGEEDLATVGLIL
FT                   PQLSLALQNWLAFEEIDKLRRKLEGERTYLVEEISAAHNFEEIIGQSPALAAVQRRVSQ
FT                   VAPTDATVLIEGETGTGKELFARAIHTLSPRRNSVLVKVNCAALPATLIESELFGHEKG
FT                   SFTGAGARRIGKFELADGGTIFLDEIGELSLELQAKMLRVLQERELERIGGTRVIPVDV
FT                   RVIAATNRDLQREVDEGRFREDLFFRLNAFPIALPPLRERHGDIPMLVMHFASKFAREF
FT                   GRPARAIRENDMHDLGGRRWKGNIRELAHVVEQAVIVSEGSTLDFSAVLSQPVGISPSA
FT                   SGEMPTMEGFEEEVRRMQRQLILEALKSSNGRVSGRGGAAERLDMHPKTLYTRIEKLGI
FT                   QKHHV"
FT   gene            63849..64655
FT                   /locus_tag="Plut_0059"
FT   CDS_pept        63849..64655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22949"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22949.1"
FT                   /translation="MHTAMKQAVRLLVFSLFFILLFSACKGQNSPDETVLYSGSAQPFE
FT                   GVLTMKTVIAGAGTTTTSIMVGHEGIRTESTASLAGLSGRVPVTVLFRAREAGSIYLLN
FT                   DAAKTYMVFNAESGSPAGDADPLSDAVVANLGEEMVNGYRCTHVRIAEKDGSGVVELWL
FT                   NHDLLDYVAWTRMQATNRNTASLIAEKLRRVGLDGFPVRTLHRPSGVVTDLVKLERMKP
FT                   DPSLFSVPAGYRKAEMPSVEPKMLSDESLDKLKGAAEKLHRQLQGR"
FT   sig_peptide     63849..63932
FT                   /locus_tag="Plut_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.876) with cleavage site probability 0.625 at
FT                   residue 28"
FT   gene            complement(64659..65543)
FT                   /locus_tag="Plut_0060"
FT   CDS_pept        complement(64659..65543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22950"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22950.1"
FT                   /translation="MQQKTVLVAGASGYLGRYAVKEFSERGYRVRALVRNPDSLRAPGP
FT                   NLEPAIAGIADELVQGDATDPASLKDVCRGVDIVFSCMGLTKPQDNVTNEAVDHLGNLA
FT                   LLRDAEECGVRKFVYVSVFNAELMADVEVVEAHERFVRDLKASGMPYAVIRPTGFFSDM
FT                   GMFFSMVRSGHMFLLGDGTNRINPIHGADLATVCVNAAEGTEEEVPVGGPDTYTFQETV
FT                   DMAFEALGKKPWTTHLPVWIGEAALFMAGFVNKSIANVLAFALTVNTIDNVAPAAGTRH
FT                   LKDFYRELVAKQG"
FT   gene            65604..66152
FT                   /locus_tag="Plut_0061"
FT   CDS_pept        65604..66152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22951"
FT                   /db_xref="GOA:Q3B6T0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22951.1"
FT                   /translation="MQTRQTLPFMLQLSSGGMKWLKGIHLIAVACWIGGAVSLLSMYFL
FT                   KDGVSDGGVLYGINRSIHHVDMSIVVVPGAIGCLLTGLVYSMFTRWGFFRHPWLVFKWV
FT                   VTVGAILFGTFFLGPWETAMMEISGRLGTGSFRDAGYQYNQMMNLVFGTLQVVVLVVTV
FT                   FVSIFKPWKLKKGIASASA"
FT   gene            complement(66171..66608)
FT                   /locus_tag="Plut_0062"
FT   CDS_pept        complement(66171..66608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0062"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22952"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22952.1"
FT                   /translation="MDKKKTVLILCTENTARSQMAEGLLRNMAGDRFEVLSAGTQPADA
FT                   VHPLALKAMQEIGIDISGQYPKDIATYLGKTFIHYLFIVCSKANATCPRIWPGMAIQEN
FT                   RIYWPMEDPAATEGGEEERLEAFRRVRDELQTNLADWIEKA"
FT   gene            66945..67412
FT                   /locus_tag="Plut_0063"
FT   CDS_pept        66945..67412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0063"
FT                   /product="conserved hypothetical protein PA5359"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22953"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22953.1"
FT                   /translation="MKKMGLVIAAVVMMLFFWKSGMAAEPDVRVMQKAGVGSYLADAEG
FT                   MTLYWYKNDSKGRSTCTGACLDMWPAFYTGAVLSAAPSMKQDDFGTIRRPEGKMQNTFR
FT                   GMPLYYYSMDRKVGDTMGHKMNNLWFVIDPLKFVAPEKQFYGKSKPSVGKE"
FT   sig_peptide     66945..67016
FT                   /locus_tag="Plut_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(67435..68628)
FT                   /locus_tag="Plut_0064"
FT   CDS_pept        complement(67435..68628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0064"
FT                   /product="aminotransferase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22954"
FT                   /db_xref="GOA:Q3B6S7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22954.1"
FT                   /translation="MATFSKSVSALRSSAIRDLMSLASRPDIISFAGGMPANDLFPVKE
FT                   VEELFMQLDDKTKRAAFQYGPTEGLPMLQESLTGWLEEKGLPVKSNRLLITTGSQQALN
FT                   LLAKAFIDPGDRVLTEYPCFIGAIAAFRAAGADVRSIPLDSEGIDIRTLREETQRTPAP
FT                   KFLYATPYFHNPAGILYSEKRKLELIKLLQGTAIPLIEDDAYGDLWFHEEDRARLMPIK
FT                   AINPDGVDVCYTGSFSKILGPGLRLGWLLAPEPIYEKCELLKQSADACSPSFTQVIADA
FT                   AIRSGMMGGYVETVRKAYLERAALMTAALRQHLPDYVGWSEPRGGFYIWLTLPEEINAA
FT                   DVLKKAIEAGAVFVTGSTFDPEGTRMNAMRLSYCNNSPEEIERGIPLIAKAIRDCCR"
FT   gene            complement(68647..69075)
FT                   /locus_tag="Plut_0065"
FT   CDS_pept        complement(68647..69075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22955"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22955.1"
FT                   /translation="MIIRQLSVFLENRTGRLTELTGVLAENGINISAFSIADSTDFGIL
FT                   RMIVGKPELAENVLRQKGFAVKVTDVICLIVPDKPGSLHHALGILSENDVAIDYMYAFS
FT                   SAEGRATVVIRTAVPQAAIRVLSQHRLELVQAGDIYQL"
FT   gene            complement(69092..70390)
FT                   /locus_tag="Plut_0066"
FT   CDS_pept        complement(69092..70390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0066"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22956"
FT                   /db_xref="GOA:Q3B6S5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22956.1"
FT                   /translation="MIWNRQYECMEREELRKIQGERLSAMVSRVWNTVPFYRRRLQELG
FT                   IEPGDIRSMDDLPKLPFTTKQDLRDNYPFGLFTVPQEGIVRLHASSGTTGKPTVVGYTK
FT                   NDIAMWSEVVARSLTMAGVTRSDIIQVAYDYGLFTGGLGLHYGAETLGASVIPISGGNT
FT                   KKQLQLMEDFGSTVLACTPSYAAFLGEAIIEEKIQKEHIKLKAGIFGAEPWTEGMRTEI
FT                   ERLLGIKAYDIYGLSEIIGPGVSMECRCQTGMHIFEDHFIPEIINPDTGEVLPYGELGE
FT                   LVFTPATKEAMPLIRYRTRDLTRLHAERCECGRTLVRMEKCVGRTDDMLIIRGVNVFPS
FT                   QVEAVLLEMSETRPHYLLTIDRMHNLDSLEIQVEVEESFFSDEVKELEGLRKKIQSAIG
FT                   SMLGISSTVRLVEPGTIERSMGKAKRVIDNRKR"
FT   gene            complement(70387..71004)
FT                   /locus_tag="Plut_0067"
FT   CDS_pept        complement(70387..71004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0067"
FT                   /product="ferredoxin oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22957"
FT                   /db_xref="GOA:Q3B6S4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22957.1"
FT                   /translation="MKKNIILAGVGGQGILSIAAVIDLAALHSGLEIRQAEVHGMSQRG
FT                   GAVESHLRIADREIHSDLIARGTADLVISVEPLEALRQSPWLAPSGRLVTAMEPVVNME
FT                   GYPRIEAVRRSLLETGAPILIDAQQLAEECGSRRASNMVVLGAAAPFIGIPPERLEAGI
FT                   SELFERKGADIAEMNTRAFRKGLEASQQQAASPEGPPTNAMT"
FT   gene            complement(71001..72599)
FT                   /locus_tag="Plut_0068"
FT   CDS_pept        complement(71001..72599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0068"
FT                   /product="ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22958"
FT                   /db_xref="GOA:Q3B6S3"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22958.1"
FT                   /translation="MERQLLLGAEAAALGAIDAGISGVYAYPGTPSTEITEFIQHSPAA
FT                   RNRGVRAAWSTNEKTAYEEALGMSYAGKRVLVCMKHVGLNVAADAFINSALTGVGGGLV
FT                   LAVADDPSMHSSQNEQDSRVYGKFAMIPVIEPSNQQELYDGVRHAFQLSESLSLPVMVR
FT                   LTTRLAHSRAGVVPKEPEPERTLPAADALPSAERFVLMPVNARRQYARLIGLQRDIEQL
FT                   AECSWLNRMVEGTASTGVLAFGIAYNYVMEVREAFDMDFPVLKTGQYPLPLGAAQQLFN
FT                   QCDSVLVAEEGYPVIEELLRGFFGNGQVLGRLDGTLARTGELNTDIIARALGLEPAPAA
FT                   PVPEIVVPRPPELCRGCGHRDLYLALNTVMAGHPHDHVFSDIGCYTLGALAPFSAIHTC
FT                   VDMGASVTMAIGAAEAGLRPAVAVIGDSTFTHSGMTGLLDAVNRRSSVTIIITDNDTTA
FT                   MTGGQNSAATGSRLEAICLGLGVDPLHLRTIVPLKPRLQENIAVISEEIAYEGVSVILA
FT                   RRECVERAAKRNRNT"
FT   gene            72881..74107
FT                   /locus_tag="Plut_0069"
FT   CDS_pept        72881..74107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0069"
FT                   /product="sulfide dehydrogenase, flavoprotein subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22959"
FT                   /db_xref="GOA:Q3B6S2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22959.1"
FT                   /translation="MAKKIVVLGAGTAGTIVSNNLRRHLSDDWEITVIDRDDRHIYQPG
FT                   LLFVPFGIQKSKTLVKSRKKFILPGVKFVLDEITHVDPEKKVVKTRNNSFDYDFLVVST
FT                   GCKVVPEENDGLLDAWGKNAFTFYYLEAADVLHRKLREFDGGKLVMDIAELPFKCPVAP
FT                   IEFVFLADWYFKKRGIRNKVEIELVTPLQAAFTKPKAAAVFSRSAKEKNIKITTGFELN
FT                   RVDGKAGYIESVQGEKVNYDMLVVVPTTVGDKVITDSGMDDGIGYVPTHQNTLQALKHE
FT                   GVYVIGDATNVPTSKAGSVAHYEADVVVFNIMAEIHGVKPEEIFDGHSTCFIVYSKGTA
FT                   SLIDFNYKIEPLPGQFPAPHLGPFSLLKETKANWWGKLAFEPLYWNVLLGGRHLGMPPT
FT                   LVMAGKEVG"
FT   gene            complement(74132..75352)
FT                   /locus_tag="Plut_0070"
FT   CDS_pept        complement(74132..75352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0070"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22960"
FT                   /db_xref="GOA:Q3B6S1"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22960.1"
FT                   /translation="MHMRNIVFTGKGGVGKTSIAAATALMAAESGHRTLIISTDPAHSL
FT                   GDSFDMELGPSPVRIADRLYGQEVSVYGDMSLNWEIVREHFAHLMQVQGIEGIYVEEMG
FT                   VLPGMEELFSLSHIKRYNESNEYDLLVVDCAPTGETLRLLSLPETFGWMLKLMRNLEKY
FT                   VVKPVIRPLAKRVSRLHDYVPDVDVYEQVDSLFSSIEGIIDLLSDGTRTTVRLVMNPEK
FT                   MVIKESMRALTYLNLYGITVDQIVINRVYTDDADGEFLKEWKEIQRGHIEEIERSFAPI
FT                   PITKVPLFKREVLGIDMLRKVGQVVYAGKNPLDIFYHEEHVSIRKDGEGLYTVKLRLPF
FT                   VFDNRMEASVVQVGDSLTLRIGNYQKGVVLPVFLAGMRVGDARYEAGWLAISFTRKEQA
FT                   PPAVPEG"
FT   sig_peptide     complement(75269..75352)
FT                   /locus_tag="Plut_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.617) with cleavage site probability 0.614 at
FT                   residue 28"
FT   gene            75653..77107
FT                   /locus_tag="Plut_0071"
FT   CDS_pept        75653..77107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0071"
FT                   /product="sulfide-quinone reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22961"
FT                   /db_xref="GOA:Q3B6S0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6S0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22961.1"
FT                   /translation="MAKVVVLGAGVSGHTCASFLKKKLGKHHEVVVVTPNSYYQWIPSN
FT                   IWVGVGQMSIDEVRFELKKVYDRWGIVFKQARALEIHPEGDASTGKGYVTIEYTAGDNS
FT                   GVRENVEYDYLVNATGPKLNFEATEGLGPDKNSYSVCTYSHAAHAWEHLQENIKKMQAG
FT                   QKQRFLIGTGHAMATCQGAAFEYILNIAHEISKRGLSKMAQITWISNEYEVGDFGMGGA
FT                   FIKRGGYITPTKVFTESILAEYGINWIRRAGVYKVEDGKAYYETLDGEDKVQEFDFAML
FT                   IPSFSGVGMTAFDREGNDITDTLFAPNKFMKVDADYAQKPFEEWSADDWPSTYQNPTYN
FT                   NIYAVGIAFAPPHAISKPMTSVTGRPIFPTPPRTGMPSGVMGKITALNIAERIHGATEH
FT                   RHKASMSRMGAACIVSGGFGSFDGLGASMTVFPVVPDWDKYPEWGRDMKYSVGEAGLAG
FT                   HWLKVLLHYLFFHKAKGYPFWWLIPE"
FT   gene            77167..77325
FT                   /locus_tag="Plut_0072"
FT   CDS_pept        77167..77325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22962"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22962.1"
FT                   /translation="MGKYRIKAYFDEAYPPVPEKSTLFWRKFVPWQLIRFIILNVKMIR
FT                   IVVGGHS"
FT   gene            complement(77673..78209)
FT                   /locus_tag="Plut_0073"
FT   CDS_pept        complement(77673..78209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0073"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22963"
FT                   /db_xref="GOA:Q3B6R8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22963.1"
FT                   /translation="MNDQALTTMDFHALAASRCSTRSFTQDPIPQDSLNRILETARLAP
FT                   SAKNLQPWRFIVIRTPEVLRTVHACYSRDWLQTAPAILVVTGRRCDAWVRASDGYNSLE
FT                   TDLSIAMDHIILAAENEGISTCWIAAFDLPCLRRALSLTGEDEVFAFTPLGYPAEGYTP
FT                   VPKKRKPLEEIATYL"
FT   gene            complement(78206..78817)
FT                   /locus_tag="Plut_0074"
FT   CDS_pept        complement(78206..78817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22964"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22964.1"
FT                   /translation="MEMDATGRSKGEWIFSDTFDRTLNYLSDQKKILGFNPFCHTVELT
FT                   DETDVYRWHFRVTDPQQNPFDVIFYVKQTDEVMVELPEELHGIGPESITDEMISRHMVG
FT                   RKILWHHHAPSDPVDDPKNYLFEGKAFAEMLLVPMEPKQTKVHFDLRIDVRFVLYPAFR
FT                   IIPEQIIRAMTNAGMSMIMQTATNRMFHSISKDFGHIRHA"
FT   gene            complement(78868..79944)
FT                   /locus_tag="Plut_0075"
FT   CDS_pept        complement(78868..79944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0075"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22965"
FT                   /db_xref="GOA:Q3B6R6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22965.1"
FT                   /translation="MFDKLQSIKERHLDLERMLADPAAAGDQTRFRRLNKEYSDLKEIV
FT                   QAYDRYASARQQLEESRHMQKAEEDPEMKAMAREEMLELEERIPGLEQELRILLLPKDE
FT                   ADSRNVIMEIRAGTGGEEAALFAADLMRMYQRYAERQGWRCEVLDYNESSGPGGFREVT
FT                   LTISGHDVYGTLKYESGVHRVQRVPETETQGRIHTSAASVAVLPEAEEVDVEIRRDDLR
FT                   FDTYRSGGKGGQNVNKVETAVRITHEPTGLVAACQEERSQLQNKERAMKMLMAKLYDIK
FT                   LQEQQQERADMRRTMVASGDRSAKIRTYNYPQSRVTDHRIGFTSHGLPHFMQGEIGELI
FT                   DALKMHDQTERLQEAARA"
FT   gene            complement(79962..81326)
FT                   /locus_tag="Plut_0076"
FT   CDS_pept        complement(79962..81326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0076"
FT                   /product="site-2 protease, Metallo peptidase, MEROPS family
FT                   M50B"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22966"
FT                   /db_xref="GOA:Q3B6R5"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22966.1"
FT                   /translation="MDVLSTTFFFIVAIFILVTVHEFGHFITARIFGMRVDKFYIGFDF
FT                   FDMRLWKKKIGETEYGIGVFPLGGYVKIAGMVDESMDTDFGQGEPQPWEFRAKPVWQRL
FT                   IVLAGGVTMNMMLAAAIFTGVTLTLGESRTSTTAPAFVEEGSVFSKMGMQTGDRFIAVD
FT                   GHPVSSWEEALDPERFASSSPVFTVLRSHGRDTTLATPKHFMSEVSDQDGFGIRPIVPP
FT                   VIDDVLANNPAAGAGIQAGSIITAIEGHPVSDWTEVVGIISRNPSKPITFTWRWLDTPK
FT                   GEPATADEIRMKGEEFTASITPSASGKIGIMLRQTISSERRMLGFMGSVESGISQTWKM
FT                   SAMTVQGFSKIFTGQEDFRKSVGGPIKIAKIASRSAEQGPVSFLYFLAVLSISLAIINI
FT                   LPVPALDGGQFVINAAEGVMGREIPIEVKMRIQQIGMTLLLALFAYILINDILNP"
FT   gene            complement(81413..82561)
FT                   /locus_tag="Plut_0077"
FT   CDS_pept        complement(81413..82561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0077"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22967"
FT                   /db_xref="GOA:Q3B6R4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22967.1"
FT                   /translation="MRALSILGSTGSIGLSTLDVVRQHPDRFKIVGLAEGHDVNMLAEQ
FT                   IREFNPSIVSVRDAGSAELLKTLLGTDLPEICHGIEGAGTVAAAEGSDMVVSAIVGAAG
FT                   LTPTVKAIKAGKDIALANKETLVVAGQLVSDLVKKHNVRLLPVDSEHSAIFQSLQGHRQ
FT                   EDVERIILTASGGPFRNSSFADMEKAGPEQALKHPQWSMGAKITIDSASMMNKGLEVIE
FT                   AHWLFNMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGSPDMRAPIAYALSWPERCESG
FT                   IKKLDLATIGTLTFEEPDMVRFPALRLAFDALKAGRTYPAVLNAANEVAVAAFLNNKIG
FT                   FTAIAETVDKTMQAHEAYTPVELEEYINADGWARRAANAIIG"
FT   gene            82719..82792
FT                   /gene="tRNA-Val1"
FT                   /locus_tag="Plut_R0001"
FT   tRNA            82719..82792
FT                   /gene="tRNA-Val1"
FT                   /locus_tag="Plut_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(82869..84989)
FT                   /locus_tag="Plut_0078"
FT   CDS_pept        complement(82869..84989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0078"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22968"
FT                   /db_xref="GOA:Q3B6R3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22968.1"
FT                   /translation="MAKNSLKPSNPYNSEPETPQPRPKLPMIYYVVVIALLIGLQLAFF
FT                   WSGSSREIPYSTFRTFITENKVESVRIAPEKIYVTLKPGVDSGLPKQEEGNDTTRKLLP
FT                   GAKTPENEVTVNPVRDESLTALLETHGVRYEGSPGTTWISELIQWVLPFALLFGLYFFI
FT                   FRRMGAGGPGAQFMNIGKNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPK
FT                   KYTRLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVR
FT                   DLFRQAKEKAPCIIFIDEIDAVGRSRGKGAMMGGNDERENTLNQLLVEMDGFATDKGVI
FT                   LMAATNRPDVLDPALLRPGRFDRQIMVDKPDLKGRMDTFRVHTKNMSLSPDVNLKALAS
FT                   QTPGFAGAEIANAANEAALLASRRNKESIEMKDFEDAIERVVAGLEKKNKVINPKEKRI
FT                   VAYHEAGHAIVSWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKRELFARICG
FT                   LLGGRIAEESVFGEISTGAQNDLEKITGIAYNMVMVYGMSDKIGNLSYYESNNPYYGAP
FT                   GVEKKFGGETARLIDEEVKAIVESAADTVRTMLKEHRSKLEALARELLTKEMLQYCQIE
FT                   EILGKRPGGQEEDSGEVDCSKKSAENGMVAHEPETTADAESTEKVGLSATELAELEAAA
FT                   ERLRQSRNVSDN"
FT   gene            85228..86052
FT                   /locus_tag="Plut_0079"
FT   CDS_pept        85228..86052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0079"
FT                   /product="Orotidine 5'-phosphate decarboxylase subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22969"
FT                   /db_xref="GOA:Q3B6R2"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22969.1"
FT                   /translation="MNAARDKANHRISTLKSLLCVGLDADREKVPAVFSRFSSPVLEFN
FT                   RSVIRATRDYAAAYKINTAFYEARGIEGFRDMEETLVEIPSECLSIADAKRADIGNTSR
FT                   MYARAFFEHWEFDSVTVAPYMGYDSLEPFFSYSDKLVFVLCLTSNAGSRDFEEQQLEGG
FT                   LPLYRRVLERVSQWGAGGNGGVVVGATKSALLADIRNAAPGLFFLIPGVGAQGGSLEEA
FT                   VDLGVDANREGALVNISRSLIYPPGEFRDIAAYEAAVSMEAERLHSAMRSVL"
FT   gene            86117..87961
FT                   /locus_tag="Plut_0080"
FT   CDS_pept        86117..87961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0080"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22970"
FT                   /db_xref="GOA:Q3B6R1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22970.1"
FT                   /translation="MCGIVGYIGTREAAPLLLGGLHRLEYRGYDSAGIALLNGGLPFMK
FT                   QKGSVAELQKAFDASPARMLGATIGIGHTRWATHGDPSDRNAHPHLNAQEDIAVIHNGI
FT                   IENYSVLKQELQGEGYHFQSDTDSEVLVQLIDRIWKIDPSLSLEAVVRAALRHVEGAYG
FT                   VCVISPRDPDKIVVARKGSPLVIGIGEGEYFIASDAAPIVEHTNRVVYLSDGEMAVITR
FT                   SGYQVRTIENVAMEKDITELDFSLEKIEKGGYEHFMLKEIFEQPDVMHDVMRGRVRTEE
FT                   GRVVLGGIEDYLDRLKQARRIVICACGTSWHAGLIGEYLIEDFARIPVEVDYASEFRYR
FT                   NPIIGPDDVVIVISQSGETADTLAALRAAKEKGAMVMGICNVVGSTIARETMCGIYTHA
FT                   GPEVGVASTKAFTAQVIVLYMLALALSKGRTISHDEMRLSLKELSKVPEHAAKILELDS
FT                   QIQQIADDYKDARNFLYLGRGYNFPVALEGALKLKEISYIHAEGYPAAEMKHGPIALID
FT                   EDMPVVVIATRDSSYQKILSNIEEVRSRKGRVIAIASEGDTEVARLAEHVIYIPQASAQ
FT                   IMPLLTVIPLQLLSYHIATLRGCNVDRPRNLAKSVTVE"
FT   gene            88013..88387
FT                   /locus_tag="Plut_0081"
FT   CDS_pept        88013..88387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22971.1"
FT                   /translation="MSERELGASPDMQGDARFAAILADLETISRELREEGVLDTLTGTE
FT                   GGAVTIEFGVWGEGDEAEPSVIVSIDSPEDFDGDDEMIDDFEDEVLERLEAASRGWSTE
FT                   ATDLLGDDRQVVLLFNGEEV"
FT   gene            88529..90043
FT                   /locus_tag="Plut_0082"
FT   CDS_pept        88529..90043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22972"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22972.1"
FT                   /translation="MTPSSVRMAVQCIAVWVVVLLFLQGAAYAGQKKDIEKFNIFFENA
FT                   QYDQAADFELERIGGKRQDKAKLLQSMQAAAALRYCNRLELSSLLFDECEAIIKEHDEK
FT                   LFASNAASSAGSVLLNDSSLDYKGSVYDGVMVNTYKALNFWQEGKIDLARIEFNRALDR
FT                   QRRAVERFASEIARQKEEIARKQADGSAPVDLEGSANSPQVRRAIENTYSNLFEFAAYP
FT                   DFVNPFTTYAAGLFFMSQGDYPKASTLFKEVAGMTQGNAVVMGDLAEADGLQAKGRHVW
FT                   VVFENGSGPVKEEVRLDLPLFLVTSQIKYTGIALPKLVLRENGCQGLSVMDGAQVVGST
FT                   ELLSSMDRVVQTEFKKRYPAILRRAILSAAMKTVVQNQAQKQFGDIGGILGGLMQRATT
FT                   IADTRMWTALPKEFQIARVRVPKSGVLDIETAGGRVFSVTVPIDGSSMVYVKVPAPGAT
FT                   PFCSVTPMNPVPVAADEERPVAVAGPMEGPDEAHGEEIHSHQDMEK"
FT   sig_peptide     88529..88618
FT                   /locus_tag="Plut_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.938 at
FT                   residue 30"
FT   gene            90046..90429
FT                   /locus_tag="Plut_0083"
FT   CDS_pept        90046..90429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22973"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22973.1"
FT                   /translation="MQRSSRLGVLFMLLLFIGGCASTRLEERRVSFVDGSLKGDMLLTD
FT                   FVSVVNSSGLMEVQVTGRNKTSRYRLLEYRVEWFEGSGLQVPSVMTRWTTCPAFEKANF
FT                   SFSAVAPKPGVSDFRILIRKAKK"
FT   sig_peptide     90046..90123
FT                   /locus_tag="Plut_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.334 at
FT                   residue 26"
FT   gene            90451..91059
FT                   /locus_tag="Plut_0084"
FT   CDS_pept        90451..91059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22974"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22974.1"
FT                   /translation="MKGKNILAALAVAVTMSGCATSVQHIDTSNDRGKAVMGLDYRDFQ
FT                   TAAAEAVGSMLQSGALNKRDGGRYVLVVSRVINDTMQRIDTDQLVKKIRIDLLQSGKVV
FT                   VTTAVGPNGPEDRMAMQTRELRQSEEFNQSTVAGKGRMIAPELSLSGKILQRNIRVSSG
FT                   TQQVEYYFQLTLTDINTGLAFWEGESFIGKRGSNKSVSW"
FT   sig_peptide     90451..90519
FT                   /locus_tag="Plut_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.442 at
FT                   residue 23"
FT   gene            91053..91322
FT                   /locus_tag="Plut_0085"
FT   CDS_pept        91053..91322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22975"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22975.1"
FT                   /translation="MVKRAFITLLVLTGPGALAASPDGGYPATSDPVAVSPAAPADSEM
FT                   PVDSLAVTPILIPMPADSAAIAGSPDEEPVPVSLPPEPEYDCDF"
FT   sig_peptide     91053..91112
FT                   /locus_tag="Plut_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.956 at
FT                   residue 20"
FT   gene            91341..92648
FT                   /locus_tag="Plut_0086"
FT   CDS_pept        91341..92648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0086"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22976"
FT                   /db_xref="GOA:Q3B6Q5"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22976.1"
FT                   /translation="MSIFKQIFLVIVILLLPILAQAEFVVSQLDVKGYGETRSEAVQDA
FT                   LLEAIRQNHGVDIQSKRELVRELPAPGAVTDSAMTTPDRHNAVVRDEVRESVRGAVRQY
FT                   RVLEAHELAAGRWEARVLVAFTHYKSPGLNASNRRRIAVMPFRTAGIPMLLDGQRVPAE
FT                   EVSAELVQQVVTELTQSRKFTVLDRDYMDAYLSEKSLLLSPDGEESEMMKMGRVLGVDY
FT                   MLVGSISGGVERRAEDVLALTGERVQHGAASLNVDYRIIVMPTREVKWSGSERIVLEGS
FT                   AMPREDAVSAAPDAVRRALVLGAARMIVRRSLDNIYPLRVVGRNAAGEVLVNQGGVTLQ
FT                   DGDLLDVFAAGPGVKDHYTGESLGAVESRIGRIRVVRVAAKKSYAAVVDGELALMADGS
FT                   ICRRLSSGGDLPPVNPGRPTDVRLSEDGGAVLPFDR"
FT   sig_peptide     91341..91409
FT                   /locus_tag="Plut_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.949 at
FT                   residue 23"
FT   gene            92766..93707
FT                   /locus_tag="Plut_0087"
FT   CDS_pept        92766..93707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22977"
FT                   /db_xref="GOA:Q3B6Q4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22977.1"
FT                   /translation="MEGHIVITGATGVIGTELVAALEKRGEQVVVLARSPEAAKGTVPG
FT                   AARYVLWDSDMAEGEWTGLVSGAKAVIHLAGKPLLEARWTEEHKQECYNSRILGTRHMV
FT                   AAISKAPVKPAVFISASAIGYYGSMARCADTPDILENGSAGRDFLAKICEDWEREALAA
FT                   EKSGVRLVLLRTGIVLSTRGGMLQKLLGPFNFFVGGPVGTGEQCISWIHLDDEIDCILA
FT                   ALDNEDWSGPVNAVGPKPVSMKEFAQTLGSVLGRPSLLPVPKMAVQVLLGEGAEYAVKG
FT                   QKVLPGFMTAHGFVFRFPSLAAALRDLVQREH"
FT   gene            complement(93825..94124)
FT                   /locus_tag="Plut_0088"
FT   CDS_pept        complement(93825..94124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0088"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22978"
FT                   /db_xref="GOA:Q3B6Q3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22978.1"
FT                   /translation="MHHVYQDLKMNIYIGNLPYSVSEDDLRDAFSQFGQVDSANIIMDK
FT                   FSGRSKGFGFVDMSSDEAGRAAIEAMNEQEFKGRTIKVNEARPREERAPRRSSY"
FT   gene            94422..95753
FT                   /locus_tag="Plut_0089"
FT   CDS_pept        94422..95753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0089"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22979"
FT                   /db_xref="GOA:Q3B6Q2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22979.1"
FT                   /translation="MRKRIATAMLMLPVLMQVSATAAAAPEVYTDSGTTSWMLTSTALV
FT                   LLMIPGLAMFYGGLVRTKNVIGTMMHSFGAMVIIGVLWPMVGYALSFGPGVLGGFVGWD
FT                   SKYFMLQGIDESILPSHIPEYVFAMFQGKFAIITPALIAGAFAERVNFRGYALFIALWS
FT                   IIVYSPICHWVWASDGFLFNLGAAGAIDFAGGTVVHISSGVTALVAALYLGSRRGYPRN
FT                   VMHPNNLVMTLTGAGLLWVGWFGFNAGSAIASDLATARALTVTQVSAAAGAFTWMVIEM
FT                   LQHRKATSLGVASGILAGLVAITPAAGVVQPSGAFALGALASIVCYCAILIKNKMGYDD
FT                   SLDAFGVHGVGGIVGALALVFFIRPAWMADAAEKAGGSWTVMQQLGVQATAVGITVVYA
FT                   AVVSLFLLVLIDKTIGMRISENDEMSGLDHSMHGEHGYGLINLN"
FT   sig_peptide     94422..94490
FT                   /locus_tag="Plut_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.574 at
FT                   residue 23"
FT   gene            95770..96111
FT                   /locus_tag="Plut_0090"
FT   CDS_pept        95770..96111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0090"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22980"
FT                   /db_xref="GOA:Q3B6Q1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22980.1"
FT                   /translation="MKLITAIINPDRLDHVREALIQADITRITVSRVTGHGRQEDIDIY
FT                   RGQKIAPNLIPKIRLDIAVNDEFVDVTVDTIINFASHDPVAIGDGKIFITPLEECIRIR
FT                   TRERGGKAV"
FT   gene            96193..97104
FT                   /locus_tag="Plut_0091"
FT   CDS_pept        96193..97104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0091"
FT                   /product="Peptidase C1A, papain"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22981"
FT                   /db_xref="GOA:Q3B6Q0"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6Q0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22981.1"
FT                   /translation="MYPKQQMLPAAGHPKPVGTGWLPPMPDLRDYTPSHPDIAGMVRKL
FT                   GVAEGSGNLPSSMDLRQWCPPVENQGGIGACTAQAAAGMVEYYERRAFGRHIDCSRLFI
FT                   YKTTRNLMGVVGDGGAWLRNTMGALALCGAPPEKYWPYSDNDTDYDLEPTAFVYALADN
FT                   FEALRYCCHDPMGAGMEPATVLGGVKRFLSAGVPSAFGFFGFPSFDEGAAPGDIPMPCA
FT                   DEQAEWGHAVLAVGYDDSREVGNKRCGTASKGALLVRNSWGREWGEDGYGWIPYGYVTQ
FT                   GLAMDFWSLFSMGWIDTGQFGS"
FT   gene            complement(97111..97671)
FT                   /locus_tag="Plut_0092"
FT   CDS_pept        complement(97111..97671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0092"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22982.1"
FT                   /translation="MKKILLSLALTAIVAMGLASPAAAESANNWFDRGFDCQIQGDIKN
FT                   ALEHYTKAIEIDPAFAMAYQMRGAANQKLKKYQQALSDYSMVINCGETNFRAVGYYNRG
FT                   IVKNMTGDFSGATADFSQAIALDGKMAPAFFHRAIARSKTGDFPGRQEDFRQAARLGDL
FT                   NAEAWLNTYCPGWREMPLAGGPS"
FT   sig_peptide     complement(97597..97671)
FT                   /locus_tag="Plut_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 25"
FT   gene            97897..98664
FT                   /locus_tag="Plut_0093"
FT   CDS_pept        97897..98664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0093"
FT                   /product="condensin subunit ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22983"
FT                   /db_xref="GOA:Q3B6P8"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22983.1"
FT                   /translation="MFRISLEEFEGPLDLLLFFIKRDELDIYNIPISKITNDFVTHIHG
FT                   ARTLNLEVAAEFIYMASMLMSIKAAMLLPRPSMENGDTDEFDPRTELVQRLLEYKRIKE
FT                   ASLQLAEMAEARHELFARGFFEEYDQNVVDEMDEPVNRPTIYHLIKAYRSVLDNMPKPM
FT                   TRNVMEAPVTVHEQTELILRMLGERVQVSFTSVLEGVTQRIILVVTFLAVLEMCKNQRI
FT                   MVLVKEGYDDFWIARRNAPPEIDNNPLVLFADA"
FT   gene            98657..99931
FT                   /locus_tag="Plut_0094"
FT   CDS_pept        98657..99931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22984"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22984.1"
FT                   /translation="MPEIMPFAGLLYSPALLEDASNLICPPYDVIPPALQDELYQRSEV
FT                   NAVRLELPKEADPYAAAAGRIAEWLRSGALRVDDRPALYPYFQTFTDPSGREFTRRGFF
FT                   AAMRLSDFTEKKVLPHEKTLSGPKADRLNLYRRTRTNISPVFGIYADEAGTADQLMKEY
FT                   AEAHQPVLDAMLQGVRNRMWRIDEPGLLQRLQGCLSERTVYIADGHHRYETGLNYRNER
FT                   AAANPGHDGSEPYNFILTYLANMYDEGLVVFPIHRLLHGIDGFDAAAFTRRLGEYFTVT
FT                   ELGGRDALDAFLDGEPSSYAYGVVLPDKVLGIVLAGEPDSVLDSSCPDALRRLGLVVLH
FT                   DLVLGRLLGIGAEALAGQKNVVYRKDEDEVFRAVGAGEAQAGFVVKPTTVRQVIDVSEG
FT                   GDVMPQKSTFFYPKIMTGLVFHSLG"
FT   gene            99939..100379
FT                   /locus_tag="Plut_0095"
FT   CDS_pept        99939..100379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0095"
FT                   /product="Protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22985"
FT                   /db_xref="GOA:Q3B6P6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22985.1"
FT                   /translation="MNDVFRSASAEETRAAGRSFAATLSEGDVVSLSGELGAGKTEFMR
FT                   GVSEYFSCSEQLSSPTFPLMNVYTGSVGGREATLHHFDLYRLETPEELEGIGFGEYLSS
FT                   AWASFVEWAERFPEYEGCYTVRVSIAYDGPSGRTITITGRGR"
FT   gene            100376..101080
FT                   /locus_tag="Plut_0096"
FT   CDS_pept        100376..101080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0096"
FT                   /product="protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22986"
FT                   /db_xref="GOA:Q3B6P5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22986.1"
FT                   /translation="MNILAIECTHGVLGIGLLHGGAVRDMRGAAWQKTAESIVPLIDRI
FT                   MMDAGALPGSLDAVAVSSGPGSFTALRIGMSVAKGVACGLGIPVVPVPTLPSMAASLPS
FT                   GFGAEAVMAVVESRKGEYYYSVFRTADLAAFRWDAPVERGGAEAVLAELASHPHATAVV
FT                   GRHLEPLQDALLAGGARVVGADFFTAAALFPMAGRLLSTGGGADAGSVVPDYHQEFVSG
FT                   STQVGPGGVGGK"
FT   gene            101145..101540
FT                   /locus_tag="Plut_0097"
FT   CDS_pept        101145..101540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0097"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22987"
FT                   /db_xref="GOA:Q3B6P4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22987.1"
FT                   /translation="MGAKKKEVTAAPKGVREVEVGELLARRAAELTLEKKCEEVKILDL
FT                   RALTTMTDFFVIATADSDRKAKAAADHVVDELRHDGERPLNVEGMETMRWILLDYVDVV
FT                   VHIFMPDDRRFYDLESLWSDAPVITVS"
FT   gene            101707..104154
FT                   /locus_tag="Plut_0098"
FT   CDS_pept        101707..104154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0098"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22988"
FT                   /db_xref="GOA:Q3B6P3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22988.1"
FT                   /translation="MRGSYLDYSMSVIVSRALPDVRDGLKPVHRRVLYGMHELGLQAGK
FT                   PHKKSARVVGEVLGKFHPHGDTAVYDSLVRLVQDFSLRYPLIDGQGNFGSIDGDSPAAM
FT                   RYTEVRMKQIAGEMLKDLDKETVDFALNFDDSLEEPTVLPSSIPNLLVNGASGIAVGMA
FT                   TNIPPQNLREVVDGMIALIGNPELEVSDLMKFVIAPDFPTAGIIYGYEGVRQAYLTGRG
FT                   KVVIRARALIEVTQKNGRESIVVTELPYQVNKVRLIEKIVELVHDKKIEGIADIRDESD
FT                   RDGMRLVIELKRDAVAKVVLNNLYKHTPMQDTFGVIMLALVDGVPRILNLKEMMQYYIK
FT                   HRNEIVLRRTRFDLAAAERRAHILEGLKICLDNLDEVITTIRESPDANTAQDRLMERFA
FT                   LSEIQAKAILEMRLQRLTGMERQKIDAEYKETLATIDELRLILQSPERQMEIIRTELLK
FT                   VKEVYGDERRTEIVPQEGDFSIEDMIAQEDVVITVTHDGFIKRFPVSGYRRQARGGKGV
FT                   TGAQAKHDDFIEHMFVASTHNYILFFTNTGRCYWLKVYEIPEAGRAARGRALANIMELH
FT                   PDEKIKAYINIRNFDEPGYIIMATADGIVKKTALEEFSRPRRNGIAAITIDEGDALLDA
FT                   RLTDGDHQVILAKSSGLVVRFPEVQVRPMGRTAMGVKGITLDRGEKCIAMVTTKRTDTA
FT                   LLAVTDNGFGKRSRVEDYRLTKRGARGVITLKAHEKIGSLVGLLDVNDDDDLILITTHG
FT                   IVNRQHVSDIRITGRNTSGVKLIRLMAGDTISALARVPKSDEETDSDVLLEDPDGQMPL
FT                   SFE"
FT   gene            104208..104441
FT                   /locus_tag="Plut_0099"
FT   CDS_pept        104208..104441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0099"
FT                   /product="Zn-finger, CDGSH type"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22989"
FT                   /db_xref="GOA:Q3B6P2"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22989.1"
FT                   /translation="MPMEKKGPYIITEQPGTKYYCACGMSKTPPYCDGSHKGTGKHPSR
FT                   VEILEEKEVAVCSCCRSADFPWCDGSHNAPGN"
FT   gene            104478..106271
FT                   /locus_tag="Plut_0100"
FT   CDS_pept        104478..106271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0100"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22990"
FT                   /db_xref="GOA:Q3B6P1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22990.1"
FT                   /translation="MARPKNVKYVFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKY
FT                   DPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTSQASNLTMGRVYKSVI
FT                   DKERKGEYLGGTVQVVPHVIDEIKDRLAELAKKGNYDVIITEIGGTIGDIESLPFLEAM
FT                   RQMKLDMGERNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPL
FT                   SREIKNKVGHFCNVNDLDVIGLNDCDTIYEVPLTLLQEKLDMRVLKKLGLKQYHEPDLA
FT                   KWTDFCRKVKHPEGGEVNVAICGKYTEYPDAYKSILEALVHAGASNNVKVNIRLIRAED
FT                   GESKSYDFSKELAGINGILVAPGFGDRGIEGKIEFIRYAREQNIPFLGICLGMQCASVE
FT                   FARNVCGLPDANSTEFNKRSRFPVIDLMEQQKKVKEKGGTMRLGSYPCIIREGTKAHAV
FT                   YGKFLINERHRHRFEFNNTFRPAFEEHGMIFSGTSPNGELVEIIEIRDHRWFVAVQFHP
FT                   ELKSRVEKVHPLFHGFVGAAKAYADGVHQPELGARAEVHETPSPAPAPVQQGFAAGENI
FT                   GTPSFFIEEERPAGDGGQGLS"
FT   gene            106313..107329
FT                   /locus_tag="Plut_0101"
FT   CDS_pept        106313..107329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0101"
FT                   /product="conserved hypothetical protein, putative AefA"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22991"
FT                   /db_xref="GOA:Q3B6P0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22991.1"
FT                   /translation="MQVMQSVQEPWSHVEAFLGRPLLAIGRSEVSLLKIITILIALALI
FT                   VMAARYLKRLLVQRLLVEKVHDEGARFALGTITQYLVVIFGVLIVLQSAGINLSSLTVL
FT                   SGTIGIGIGFGLQNIANNFFSGIIILLERPVKVGDRIQVGDVNGDVVRIAIRSTTILTN
FT                   DNINIIIPNSEFVSNQVINWSHNDRNLRVSVPVGVSYSSDPEEVRSILLQVATDHPDIL
FT                   GSPAADVIFSGFGGSSLDFVLRVWTSTRIQTPRILQSEINFRIFEAFGRNGIEIPFPQT
FT                   DIHLRSASVPLFSEQPERKKAGAPYPDSLRASGEGAVLALAERFIGVSAVYYNGWVK"
FT   gene            107760..109122
FT                   /locus_tag="Plut_R0049"
FT   rRNA            107760..109122
FT                   /locus_tag="Plut_R0049"
FT                   /product="16S ribosomal RNA"
FT   gene            109367..109443
FT                   /gene="tRNA-Ile1"
FT                   /locus_tag="Plut_R0002"
FT   tRNA            109367..109443
FT                   /gene="tRNA-Ile1"
FT                   /locus_tag="Plut_R0002"
FT                   /product="tRNA-Ile"
FT   gene            109483..109558
FT                   /gene="tRNA-Ala1"
FT                   /locus_tag="Plut_R0003"
FT   tRNA            109483..109558
FT                   /gene="tRNA-Ala1"
FT                   /locus_tag="Plut_R0003"
FT                   /product="tRNA-Ala"
FT   gene            109699..112448
FT                   /locus_tag="Plut_R0050"
FT   rRNA            109699..112448
FT                   /locus_tag="Plut_R0050"
FT                   /product="23S ribosomal RNA"
FT   gene            112721..112830
FT                   /locus_tag="Plut_R0051"
FT   rRNA            112721..112830
FT                   /locus_tag="Plut_R0051"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(112974..114662)
FT                   /locus_tag="Plut_0102"
FT   CDS_pept        complement(112974..114662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22992"
FT                   /db_xref="GOA:Q3B6N9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22992.1"
FT                   /translation="MHHRHLKRERCNRYRPALLFTTFSIVQLALHLLALVDSPDLRLLM
FT                   PHLVAWTHDLLLLSIVLICCRLALSGLPSKLRSRTELVTLPIIAITILPLSLYPQMLRE
FT                   YLSFPINIFSATPASTSALLTSYLGLSRLFPLIAASASLLLAMLMPPLPIWHERLKRPL
FT                   SALWTIIIATGLLTLSRSPHPVVNSLKEELSSALWHERREVPELHPATQWPDSAPLSSS
FT                   SVSSLNGTLRAGHVYLIVLEGVSSDQFEKTLSAKRSVFLGRIAKHARYFDRYYTTNLDS
FT                   YTSLIAMLTSEQVPYRAYTDTGLYENVNRAPNLVRSFNAAGFHTLFISTYDDQPFIPVR
FT                   HEWSSIMHRQDLPAWKTWVSVESSRMESATEDRAALSTIAALPRQHDRTFILHELAYGH
FT                   TTEWRAKTGIPQLAYYDTYLNELLELLMGQATWQKSLLVIVSDHGDRASAESTGSYRVP
FT                   LLIVGPGVEPGRDHALRSHLDLQHIIASVMTSRNIPQPREDAILVGSTGRWIYGLIDAG
FT                   GNHLMVDDHSGKVLASRGGINPLVVQDRFQKIINHFSRRFDPKRQ"
FT   gene            114836..115846
FT                   /locus_tag="Plut_0103"
FT   CDS_pept        114836..115846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0103"
FT                   /product="Protoheme ferro-lyase (ferrochelatase)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22993"
FT                   /db_xref="GOA:Q3B6N8"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22993.1"
FT                   /translation="MNVSSFANSECLSMRVAVILVAHGEAEGAGFFENYSMIRHTLDHA
FT                   AEVMALPGTVRLVASVVGGMKNCVAFRVSGYRSPQNRITRQQGALLKEHLRIGCDGLHA
FT                   EYEVYSAFHATPPFISDILRDTRSHDARLLVSMSPVDSRMTAGTLHLLAEKCRGTVDGP
FT                   APVVVDGFWGDSGLRRVYVNHVFRYGRNDPGAALLLAFHGTIIRDARGCEPGFHTGADE
FT                   IGSMACALRNAVLADPRNHYARVEVTHYNHDIGGTWTRPAFPASLNALGDAGVDRADVF
FT                   SCGYFSDGTETLLYAGRHAERGPVGDVHFLPCVNDSADFIAHLAARILDTVDAGG"
FT   gene            115954..116205
FT                   /locus_tag="Plut_0104"
FT   CDS_pept        115954..116205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22994"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22994.1"
FT                   /translation="MAQLSLFQCVAFSETKSGTVFMAHKINDTCIMCGACEPECPVNAI
FT                   SPGDDTYVIDATKCVDCVGHHDEPACVAVCPSDSIEKA"
FT   gene            116732..118095
FT                   /locus_tag="Plut_R0052"
FT   rRNA            116732..118095
FT                   /locus_tag="Plut_R0052"
FT                   /product="16S ribosomal RNA"
FT   gene            118340..118416
FT                   /gene="tRNA-Ile2"
FT                   /locus_tag="Plut_R0004"
FT   tRNA            118340..118416
FT                   /gene="tRNA-Ile2"
FT                   /locus_tag="Plut_R0004"
FT                   /product="tRNA-Ile"
FT   gene            118456..118531
FT                   /gene="tRNA-Ala2"
FT                   /locus_tag="Plut_R0005"
FT   tRNA            118456..118531
FT                   /gene="tRNA-Ala2"
FT                   /locus_tag="Plut_R0005"
FT                   /product="tRNA-Ala"
FT   gene            118672..121421
FT                   /locus_tag="Plut_R0053"
FT   rRNA            118672..121421
FT                   /locus_tag="Plut_R0053"
FT                   /product="23S ribosomal RNA"
FT   gene            121694..121803
FT                   /locus_tag="Plut_R0054"
FT   rRNA            121694..121803
FT                   /locus_tag="Plut_R0054"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(121933..122400)
FT                   /locus_tag="Plut_0105"
FT   CDS_pept        complement(121933..122400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0105"
FT                   /product="Bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22995"
FT                   /db_xref="GOA:Q3B6N6"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22995.1"
FT                   /translation="MKGQPKMIEKLNALLAEELTAINQYMVHSEMCDNWGYARLHGADE
FT                   KRAIDEMKHAEQLIGRILFLDGTPDVSTLNKIMIGASVEKQHRSDLHLEGETIISYNEG
FT                   IRLAAELGDNGSKDLLESILKEEEMHLDWIEAQLDQIGQMGVQTYLAEQLS"
FT   gene            122738..123085
FT                   /locus_tag="Plut_0106"
FT   CDS_pept        122738..123085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0106"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22996"
FT                   /db_xref="GOA:Q3B6N5"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6N5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22996.1"
FT                   /translation="MMGELNKTKCVSCSEGLPPLAERESEELLKEIPEWVIVSEDGVSR
FT                   LVRTFTFENFREAMAFAGSVGELAESEQHHPKLVTEWGKVRVEWWTHAVHGLHMNDFVM
FT                   AARTDELFQEL"
FT   gene            complement(123125..123595)
FT                   /locus_tag="Plut_0107"
FT   CDS_pept        complement(123125..123595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22997"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22997.1"
FT                   /translation="MFGKLRYPTVKAFADAMQMSASNLQLYMSDRRRPGAPILTRLEAI
FT                   GCNSSWILTGKGDIIKVGIDSFSRSCRAGMIVKESVSSDLLRIEARGELMTPDSIMEGD
FT                   ALLIDTAGLPEKGDYILKGNNKRRIIKRWELGDKPAGVVIQLIRGPAGLRRM"
FT   gene            123869..124609
FT                   /locus_tag="Plut_0108"
FT   CDS_pept        123869..124609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0108"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22998"
FT                   /db_xref="GOA:Q3B6N3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22998.1"
FT                   /translation="MSNSSRIEQPACQRIVVVVSDPDCRSRLAAKLRGDGHDVDIAGSA
FT                   LEFYGLLAQREFRLAVLEAELSDQNGLVVARFLRRNTPISSIMLAGSVDRKVRLAVYHA
FT                   GSLACFCKPVDLGEFSVLVDNLLNQGQRTSAGAQRTTLEIPQGHAKWKILRNGWVLAGP
FT                   RGTMVKLTINEFEFMSLLASSNQMAVSRKAILEHMGYRNDVHGNKALEAVVHRLRLKTQ
FT                   VAGGSLIETAHGVGWGFSSEVALV"
FT   gene            124762..125910
FT                   /locus_tag="Plut_0109"
FT   CDS_pept        124762..125910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABB22999"
FT                   /db_xref="InterPro:IPR040628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB22999.1"
FT                   /translation="MVTPMQESFQVLVERPPTPCLSLYQETHRSYPDNRQDRLRYKNLV
FT                   NALEESLRRKYPGRDALPLLEPFRVLGDDDGFWNHTHEGLAVFGAEGIFRTYRFPYVPR
FT                   ELAVSADSFHTKPLLRVMQSTERFHLLCLTRQNIKLYDADRYAVEEIELPPDMPRNMLQ
FT                   VLGSETTEPEITIASFGSAGAGGVIRHGHSSKRDEEEVDNEKFFRAVDTAVLERYSIPS
FT                   GLPLMLAALPEHQGLFRKISRNASLLEGGISADPQSMTTDVLRVRAWDVMAPSIAARIR
FT                   AAAESCAAAIALGTGTSDPEDAAVAAVGGRIERLLIDRETLIAGTVDPVTGAVRFVPLE
FT                   DPAVDDVLDDIGEIVRQKGGEVLVLSATEMPSETGLAAIYRY"
FT   gene            126053..126469
FT                   /locus_tag="Plut_0110"
FT   CDS_pept        126053..126469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23000"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23000.1"
FT                   /translation="MQREHHSFTLEMDVRDYECDMQGIVNNSVYQNYLEHARHEYLKSV
FT                   GIDFSEYARMGVNLVVVRAELDYRSPLKSGDRFLVNLQLQRESTLKFAFYQDILRLPDM
FT                   KPALNAKVIGTALNGRGRPEIPTALAALMSAGDA"
FT   gene            126502..127029
FT                   /locus_tag="Plut_0111"
FT   CDS_pept        126502..127029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23001"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024552"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6N0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23001.1"
FT                   /translation="MKPLRSVADAYLALSVGERQLQDGLHAESAASCRSAMDAARSIPA
FT                   EEAFDHAGFDAFVHAVLAGALTGLGDYGTGLESADLALYYFNRRGELEEDGGKLWIRAV
FT                   FSRGAALEGLGRRDEAFQSFRMACEMLDERNGGMGGLEALRNAAAEALTRLGRATEPEK
FT                   PAGYRAWWEFWS"
FT   gene            127034..128041
FT                   /locus_tag="Plut_0112"
FT   CDS_pept        127034..128041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0112"
FT                   /product="heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23002"
FT                   /db_xref="GOA:Q3B6M9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6M9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23002.1"
FT                   /translation="MEAVRSILVVRLSSIGDIILTTPVVRWLRVRWPEAKIDFCTRAPF
FT                   LPLLAGSPRLSGVYSPESLPASSSYDLVVDLQNNRRSHALLGRVGAKKTVRYHKGNWKK
FT                   WILVHWKIDLYGEAPSVVERYGSSLLGLGIKVDDSGCELWPSASDTSLADGILPGEGKV
FT                   LAVCFGARHFTKRWPPRRFAEVILGILNAVPSLRVVLLGGEDDAAHAEEIMGLLPAGVA
FT                   GSVRNLAGACSLMETGALLQRSDAVLTNDTGLMHMASAFQKRLFVLFGSSSLAFGFLPY
FT                   RSTFELFEVSGLGCRPCSHIGRERCPKGHFRCMLDIPPERVSDRIIAFLGGAQR"
FT   gene            128038..128841
FT                   /locus_tag="Plut_0113"
FT   CDS_pept        128038..128841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0113"
FT                   /product="AP endonuclease, family 1"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23003"
FT                   /db_xref="GOA:Q3B6M8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23003.1"
FT                   /translation="MIVASWNVNGIRAREGALESWVRQSSPDVLILQEVKASVEEIPLS
FT                   IMSLDGYRSFWNDSSIRKGYSGTGILMKETPALEGATFEIPPFDIENRTVVLHTGELSI
FT                   IGTYVPRGDSAQHYVLKLGYLEAMHEYVRELLACGRQILVTGDMNVAHRQVDLHRSENR
FT                   PGATGIRPEERSAIDRLIALGLSDVMRELNPERDDLFTWWPYWRMARERNIGWRIDCFY
FT                   LSGYRKDRILRAAVDMPEKSSDHAPIILEFVPESGLHEDTRSFSR"
FT   gene            129007..129408
FT                   /locus_tag="Plut_0114"
FT   CDS_pept        129007..129408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0114"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23004"
FT                   /db_xref="GOA:Q3B6M7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6M7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23004.1"
FT                   /translation="METNKLYECTVIIDGGLQDEAIAAAMEMVQKVITEKGGSISSVLD
FT                   IGRRKTAYPIKKKTIGSYAHIEFTAATPVIAEIERVLRYEEVLLRYLIVHLTSPLLEMR
FT                   KRVEKYSVVIGSPEDNVASETDAADKVAK"
FT   gene            129480..129956
FT                   /locus_tag="Plut_0115"
FT   CDS_pept        129480..129956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0115"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23005"
FT                   /db_xref="GOA:Q3B6M6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6M6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23005.1"
FT                   /translation="MAELKMPEINSVIIAGNLTKDPVFRQTDSGGTPVVNFSIACNRRF
FT                   RDSNHQWQEDVCYVGVVAWNKLAESCRDNLRKSSAVLVDGELQSRTWKAQDGTSRTVVE
FT                   IKARRIQFLNKRKKDDGEDDHDGFIEDDFHDVHHEDAHGEDNDHIYEYKYLSSD"
FT   gene            129983..130255
FT                   /locus_tag="Plut_0116"
FT   CDS_pept        129983..130255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0116"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23006"
FT                   /db_xref="GOA:Q3B6M5"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6M5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23006.1"
FT                   /translation="MKPMRQKNTRAQGNKSISNALASKRKVSKNQVVFFDYRDERKLKR
FT                   FINDQGKIIPRRITGLTAKEQNLLTHSVKWARFLAVIPYVADEYK"
FT   gene            130292..130747
FT                   /locus_tag="Plut_0117"
FT   CDS_pept        130292..130747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0117"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23007"
FT                   /db_xref="GOA:Q3B6M4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6M4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23007.1"
FT                   /translation="MKVILRKDVAALGDAGEVVAVKNGYANNYLIPQGMATRATEGTLK
FT                   ALETEKKQQARKVELQRTSARELAQKIEQMVLKVQAKAGESGKLFGTVTAGDIADALKA
FT                   VGVEIDRRKITLEAPVKLLGKYEAEAKLFSDVTVKVTFEVEAEGTEA"
FT   gene            130913..131317
FT                   /locus_tag="Plut_0118"
FT   CDS_pept        130913..131317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6M3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23008.1"
FT                   /translation="MIQTLLQEKYPVFTTKFDRSETSCRSVDDIIAHFKSCIDANPAVA
FT                   YIGEFDHYAHTAALPGGVIGKGIKAARNLLFCFGKEMPTPYVLAVRPRSIGVGEVEDGF
FT                   VVTFLEAPNPTANEAMESWTKALRDRVVDA"
FT   gene            complement(131329..132354)
FT                   /locus_tag="Plut_0119"
FT   CDS_pept        complement(131329..132354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0119"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23009"
FT                   /db_xref="GOA:Q3B6M2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6M2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23009.1"
FT                   /translation="MENSIRSLREEIAGFRISSADELEAFRLRYTVRKGLIAGLFSQLK
FT                   SVDPARRPEIGNMLNQLKAEAEARVEEAALSLEKTTSPAAPTIDLSLPGRRHFTGSEHP
FT                   VQKVLGEMKQIFSDMGFTVATGPELELGSYNFDMLNFPPDHPARDMQDTFFVKRDGTED
FT                   DILLRTHTSPVQVRVMLDRKPPIRVICPGKVYRNEAISARSYCVFHQLEGLYIDKGVTF
FT                   ADLKATIYSFARQMFGSDVQLRFRPSFFPFTEPSAEVDVTCYLCGGKGCRVCKKSGWLE
FT                   IMGCGMVHPNVMKNAGIDPEVWSGYAFGMGVDRTVLLKYKIDDIRLLFENDLRMLRQFP
FT                   A"
FT   gene            complement(132370..132717)
FT                   /locus_tag="Plut_0120"
FT   CDS_pept        complement(132370..132717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0120"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23010"
FT                   /db_xref="GOA:Q3B6M1"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6M1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23010.1"
FT                   /translation="MPKANNAVASKARRKRVLKKAKGYWGSRGNILTVVKHAVDKGEQY
FT                   AYRDRRAKKRSFRSLWIIRINAAARLNGTTYSRLMDAMIKKNVEIDRKTMAEIAVRDPE
FT                   AFTQLVKTIID"
FT   gene            complement(132746..132943)
FT                   /locus_tag="Plut_0121"
FT   CDS_pept        complement(132746..132943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0121"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23011"
FT                   /db_xref="GOA:Q3B6M0"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23011.1"
FT                   /translation="MPKMKSHRGACKRFKATASGKIKRERMNGSHNLEKKNRKRTRRLH
FT                   QSTMLDNATKEKQIKRMILA"
FT   gene            complement(132988..133608)
FT                   /locus_tag="Plut_0122"
FT   CDS_pept        complement(132988..133608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0122"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23012"
FT                   /db_xref="GOA:Q3B6L9"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6L9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23012.1"
FT                   /translation="MKKQKATSQKPKITYRVNEQIRVPEVRIIFPDGTQQVMKTIDARR
FT                   MAEDRNTDLIEVQPNAEPPVCKFDNLGKLLYKMAQRDKDLKKKQKTTTLKELRFHPNTD
FT                   KHDFDFKTAHLEEFLRKGNRVRATIVFLGRSIIYKDKGLELADRLTERLSVVGNREGEP
FT                   KFEGKKLFVYFEPDKKKIDAYERIRSKTGTPLAPLEESADAED"
FT   gene            complement(133630..135663)
FT                   /locus_tag="Plut_0123"
FT   CDS_pept        complement(133630..135663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0123"
FT                   /product="Ser-tRNA(Thr) hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23013"
FT                   /db_xref="GOA:Q3B6L8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23013.1"
FT                   /translation="MRTATGRRPHRHGLETTRHTMSDNLESQVMLSITLPDGTIKLFPK
FT                   GSTGLDIALSIGRRLADAALAVMIDGKAADLSMPIGMDCTLSIITFDSAEGHEVFWHSA
FT                   SHIMASAVEELFPGARFGAGPAVEQGFYYDIASSHRFNEDDLRSIEKKMLEIAGRDTPI
FT                   VREEMTREAAIEFFKTVRRDPYKVEILEDTLKNVPTVSLYHEGGFTDLCTGPHLPSTSR
FT                   LKAVRLFNISSSFWRGDSSRESMQRIYGIAFPSEKLLKEHLERLEEARKRDHRRLGQEL
FT                   KLFMLSPEIGSGLPVWLPKGAIIRQELETFLKDEQRRRGYLPVYTPHIGNIELYKRSGH
FT                   YPYYSDSQFPPLTYHDEDGKQEQYLLKPMNCPHHHLIYSSEMRSYRDLPIRLTEFGTVY
FT                   RHEQSGELNGLVRARGFTQDDSHIYCRPDQLVDEICNAIDLTQFVFRTLGFDAVETRLS
FT                   MHDPENQTKYGGTPEVWEQAEKDVKEAADRMGIKYFIGIGEASFYGPKIDFIVRDALGR
FT                   KWQLGTVQVDYVMPERFDLTYVGNDGQKHRPVVIHRAPFGSMERFIGVLIEHTAGNFPL
FT                   WLAPVQAVVLPIAEDVHDYAAGVRNAMLAAGIRTELDLRSEKIGKKIRESELSKIPYMV
FT                   VVGQKEEEKGAVSLRRHRKGDEGTLSIQDMIERLREEIDRKA"
FT   gene            complement(135838..137247)
FT                   /locus_tag="Plut_0124"
FT   CDS_pept        complement(135838..137247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0124"
FT                   /product="Chlorophyllide reductase subunit Z"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23014"
FT                   /db_xref="GOA:Q3B6L7"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010244"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23014.1"
FT                   /translation="MGKTIRDESTASAYWAAVNTFCPLSDIHVIADAPVGCYNLVGVAV
FT                   MDYTDAIPYLENFTPTSLTEKEIASSGTTEVVRDTIEKLRGNGRQLILVSSAESEMIGS
FT                   DHEHMLQMHFPEVRFFPSDSLGENEWQGRDRALLWLHSQFDDAKPAIIEPGTVSIIGPT
FT                   YGCFNSPSDLAELKRLIAGTGGRLQHVFPFESSLRDISDLKNSDVIIVMYREFGLALAE
FT                   ALQRPVLYAPMGLDDTATFIMELGRHIQKEQQAAAFLLEEKRTILRPLWDLWRGPQAEW
FT                   FPTVRFGVAAARTYAEGLERFLGREMGMQCMFSLDSAVADNTSLRQEIAANQPQFFFGR
FT                   IIDKIYLAELDAKTRFIPAGFPGPIVRRALGTPFMGHSGAVYILQEIINALYDMLFNFL
FT                   PINRVAASGEAPAPEIPWSPEAGELLDRIVAKAPFISQISLGRELRKKAEALAAKQGKE
FT                   TVTPDIIQLLH"
FT   gene            complement(137258..139015)
FT                   /locus_tag="Plut_0125"
FT   CDS_pept        complement(137258..139015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0125"
FT                   /product="beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23015"
FT                   /db_xref="GOA:Q3B6L6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23015.1"
FT                   /translation="MQPEQPRLPARWLIALIVLSALAGGSLHAEPALPPWHAEAVFREV
FT                   DSGIDAALQAMSLEEKVGQMLMADSPGAYTEKDDPARMKLDRLVSEGKVGGIMFLKGSM
FT                   FSAAMLANHFQSIAPNPLLISADMERGLAMRLEGATRFPSAMAVSAAGSSELSGKMGEA
FT                   IALEAKAAGLQWNFAPSADLNSNPLNPVINTRSYGDTSEGASRMADALIEGMQSKGLLA
FT                   TAKHFPGHGDVTVDSHFALPVLEADSLRLEEYELKPFRSAIRCGVMAVMTGHLAVPKLT
FT                   GTMDPASISAPIVTGLLRKRLGFKGLIVTDALNMKALYDGHNVEEISVRAVAAGNDVLL
FT                   FSPDPERSFHAIVNAVRDSVISEARIDESVRRILQAKRWAGLRPKSLVDLNRVPEMASP
FT                   ARHIELAEAIAARSVTFTGKDRHIIPFRIKKAGPSMLHIILQDRTDPDVGSAFMAGIDS
FT                   TWKSHHLRITPDTDPEKFIEAERLAETAPAIVIAAYITAPSKLTAPQLAFIHSIQKLSR
FT                   GKRPVVFVAFGSPYMLRSFPGLENCICTYDAEKTSEQNALKVLTGRLEPKGKLPVVLRM
FT                   DAPGDITTP"
FT   sig_peptide     complement(138926..139015)
FT                   /locus_tag="Plut_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            complement(139118..139624)
FT                   /locus_tag="Plut_0126"
FT   CDS_pept        complement(139118..139624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0126"
FT                   /product="HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23016"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23016.1"
FT                   /translation="MTRSKVLVLNSSYEPLSICDPQKAILLLFGGKAVPVTHHPERFIC
FT                   TVSKSYPMPSIVRLTVFVRVPYKRIMLNRKNIIRRDRFQCQYCGRTDQQLTIDHITPRS
FT                   RGGEDSWENLITACRKCNAKKGSRTPKEAGMPLMKQAERPNHLMFMQLLTASASEDWKP
FT                   YLYMS"
FT   gene            complement(139771..141297)
FT                   /locus_tag="Plut_0127"
FT   CDS_pept        complement(139771..141297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0127"
FT                   /product="glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23017"
FT                   /db_xref="GOA:Q3B6L4"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23017.1"
FT                   /translation="MSAILDKQHTRQRDSSSPSHSITMKEKLIFDFSASGRKGYSFSGK
FT                   DMPGAAPGSFLPSKFLRKEPAMLPEVPESEVVRHFIRLSNMNYHVDKNMYPLGSCTMKY
FT                   NPKINDYTCDLPGFSALHPLQPEETAGGALQLMYELSLMLAEIAGMKAVTLQPAAGAHG
FT                   ELTGILLIKKYHESRGSKRSTLLVVDSAHGTNPASAALAGYRIVSVKSNEIGRTDLQDL
FT                   EAKLDGEVAALMLTNPNTIGLFEKEIVRISEMVHRNGSLLYMDGANMNALLGIARPGDM
FT                   GFDVVHYNLHKTFSAPHGGGGPGSGPVGVSEKLVEFLPVPVVEKTEGADGPVYRLVSDR
FT                   PESIGRMMNFYGNFAVLVRAYTYIRMLGAEGLKRVSENAIINANYLLSRLTGAYELPFP
FT                   KQVLHEFCLSGDRQKKSHGVKTLDIAKRLLDYGFHAPTIYFPLIVSEALMIEPTETESR
FT                   ETLDLFADALLQIADEAEKSPETVKGAPVTTPVSRLDEAMASRQLNICCI"
FT   gene            complement(141333..142163)
FT                   /locus_tag="Plut_0128"
FT   CDS_pept        complement(141333..142163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0128"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23018"
FT                   /db_xref="GOA:Q3B6L3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6L3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23018.1"
FT                   /translation="MEPLWHKLSALPFFSSRPEKWEGSGAPPSLTAFIRSLFKGKALSL
FT                   ELYATALTHRSMVHDTTAPEITRSNQRLEFLGDSVLGLIISEYLYRRFPEGTEGELSSY
FT                   RAKIVNGKSLAGFARNLDLGIHLIIGESADQQRIRTSTSTLADAFEALTGAIYLDRGLD
FT                   AVREFIEEQIIDSPAFEAMVSTENNHKSRLIEHTQSHQLPPPVYTVLSEEGAEHEKTFT
FT                   IEVSCNGRRLGRGTALRKKDAEQLAAEEAMGALERALTGDVAEDTPAPEETGRG"
FT   gene            complement(142175..143428)
FT                   /locus_tag="Plut_0129"
FT   CDS_pept        complement(142175..143428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0129"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23019"
FT                   /db_xref="GOA:Q3B6L2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23019.1"
FT                   /translation="MGQERKRVVITGIGVLTPIGQTKEDFWSALIAGKSGAAPITYFDT
FT                   ADFATTFACELKDFVVEDYIDKRTADRMDPYCQYAIVSSDQAIKDSGLDLQAIDPLRIG
FT                   VVHGSGIGGMTVYDQQFRQYLNRGPRRISPFFIPMLIPDIAAGQISMRHGLMGPNYATA
FT                   SACATSLHAIIDAYMLIQTGLADYMVCGGSEAPITPMSVGGFNSARALSTANDIPTKAS
FT                   RPYDRDRDGFVMGEGAGSLIMESLDSARARGAKIYAELVGIGATADAHHLTAPHPEGKG
FT                   ALNAMKTALSIAGIGTEKIDYINTHGTATPLGDIAEVTAIKKLFGEHAYKLSISSTKSM
FT                   TGHLLGAAGVVESIACILAMQNQTVPPTINCENLDPEIDVDVTPNEPKKRSIEYALNNG
FT                   FGFGGHNASLIFRNGASL"
FT   gene            complement(143542..143778)
FT                   /locus_tag="Plut_0130"
FT   CDS_pept        complement(143542..143778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0130"
FT                   /product="Acyl carrier protein (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23020"
FT                   /db_xref="GOA:Q3B6L1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6L1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23020.1"
FT                   /translation="MTEAEIRDKVYDIIVSKMGVNKDQIKPESKFSDDLGADSLDTVEL
FT                   IMELENEFDVQIPDEDAEKIGTVQQAIDYIVKK"
FT   gene            complement(143861..144598)
FT                   /locus_tag="Plut_0131"
FT   CDS_pept        complement(143861..144598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0131"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23021"
FT                   /db_xref="GOA:Q3B6L0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23021.1"
FT                   /translation="MFEGKIAVITGAARGIGQAIAWNLAAGGADIVLCDIKEEWLQDTA
FT                   EGVRKAGRKVWCFELDVTNTDAVQKAFNDIAAATGTIDILVNNAGITRDGLLMRMSEED
FT                   WDAVLTVNLKGTFSCTKAVSRIMMKQRSGSIVNIASIIGLMGNAGQANYAASKGGVISF
FT                   TKSVAKELASRNIRVNAVAPGFISSKMTDALSDDVRQKMLEAIPLSRFGNPEDVADVVS
FT                   FLAGDRSAYITGEVINISGGMVM"
FT   gene            complement(144644..145549)
FT                   /locus_tag="Plut_0132"
FT   CDS_pept        complement(144644..145549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0132"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23022"
FT                   /db_xref="GOA:Q3B6K9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23022.1"
FT                   /translation="MKAFVFPGQGSQYCGMGRDIYDTFPAAKALMEQANDILGYRITDI
FT                   MFLGSEEELRQTMHTQPAIFLHSMAAASQLNAEGVAMTAGHSLGEYSALCFAGAISFED
FT                   AVKIVAERGRLMQQAGTEKPGTMAAIIGMQDSALDALLAEAGAEGIVQAANFNSPGQIV
FT                   ISGDIAAVKKAVELAPAHGARMAKELVVSGAFHSPLMKPAEEKLAAALEAVDIKNATIP
FT                   VCMNAVARTVTDAAEIRKNLVLQLTSSVLWTQSIEEMTTAGITRFVEVGPQKVLQGLIK
FT                   RISKGAELEGKDTAADIQGA"
FT   gene            complement(145599..146588)
FT                   /locus_tag="Plut_0133"
FT   CDS_pept        complement(145599..146588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0133"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23023"
FT                   /db_xref="GOA:Q3B6K8"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6K8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23023.1"
FT                   /translation="MNAAISATARYLPEGVLSNLDLERMLDTNDEWIRSRTGISERRIL
FT                   RDPKKATSYMCGEVASQLLRKRGLAAEELELIIVATMTPDMMFPSTACLVQDIIGAKNA
FT                   WAFDINAACSGFLYALNTASQFIKAGTHKNVMVIGGDKMSSIIDYTDRSTAILFGDGAG
FT                   GVILEAAESEGFGVLDARMYSDGTNGKDHLLMKGGGSLHPATHDTVDQHLHYIYQDGRM
FT                   VFKSAVTSMADVAAEIMERNGLTSDDVSWLVPHQANQRIISATAERMGIDESKVISNVG
FT                   RYGNTTAGTIPICLSELDDGGHLEHGSNLVLVSFGAGYTWGGVYVKWQ"
FT   gene            complement(146658..147683)
FT                   /locus_tag="Plut_0134"
FT   CDS_pept        complement(146658..147683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0134"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23024"
FT                   /db_xref="GOA:Q3B6K7"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23024.1"
FT                   /translation="MLTIAVDAMGGDHAPACVIDGALEALRESGNRFEIILIGQSEKVE
FT                   PLLGKHDTAGLNLKFMHAPETVTMDDVPATAVKTKQNSSLVKGLQLCKAKEAEAFVSAG
FT                   NTGAQMAASLFILGRIPGVLRPTIYAYLPRLQEGLTNMVDVGANMDCKPEHLVQFAEML
FT                   SIYQRYGAGIENPQVGLLNIGEEEGKGSDTLKQTHPLLKAAHAAGKINFIGNIEGHDIL
FT                   KGKATVVVCDGLVGNTILKFGESIPEFLGVLFKQALEKNVASGSLDQNAAAAATAMFKG
FT                   MFEPFDVEKFGGVPFLGVDGISIVGHGRSSSRAIKNMIYMAEHMVERKVNEHIAEVLAD
FT                   K"
FT   gene            complement(147710..147901)
FT                   /locus_tag="Plut_0135"
FT   CDS_pept        complement(147710..147901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0135"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23025"
FT                   /db_xref="GOA:Q3B6K6"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23025.1"
FT                   /translation="MANPKAKMSKSRRDKRRAQFNARTKAATTVICPNCGEPTLPHRAC
FT                   RHCGQYRGRAVVTKSANS"
FT   gene            complement(147927..148466)
FT                   /locus_tag="Plut_0136"
FT   CDS_pept        complement(147927..148466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23026"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23026.1"
FT                   /translation="MHKEHALIAIPTTGLMQETRDFEITCTAGDFNDPEIEAAGFSGPI
FT                   RVKVTAERGGSEIALLIETVAGCDFACDICLAPIHRELNGSYRVFFDCSDSGVQATPDA
FT                   DDDEYRILDSNATEIDLTEDVRETLLLSVPMKVTCVGNPDCRLYSGAKEELDIQEPEGS
FT                   GSSWKDSLAKLKKKYR"
FT   gene            complement(148563..148637)
FT                   /gene="tRNA-Asn1"
FT                   /locus_tag="Plut_R0047"
FT   tRNA            complement(148563..148637)
FT                   /gene="tRNA-Asn1"
FT                   /locus_tag="Plut_R0047"
FT                   /product="tRNA-Asn"
FT   gene            148884..149324
FT                   /locus_tag="Plut_0137"
FT   CDS_pept        148884..149324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23027"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23027.1"
FT                   /translation="MFGGRMFIGILIVAAFAGCARHRAALLPDVRLQGTQWRAIELDGS
FT                   RVEFIPGQKLDVSLVLYRSGAFRAASGCSNLSGSYTMTAARMAFASIKVDRRPCPPKIK
FT                   AREKAFLSALSRTAGYRKRGGSLSLFDRSGRRVAAFMAVQTR"
FT   gene            149651..151333
FT                   /locus_tag="Plut_0138"
FT   CDS_pept        149651..151333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0138"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23028"
FT                   /db_xref="GOA:Q3B6K3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23028.1"
FT                   /translation="MKTMNFNKYSAYPAVGLTDRTWPDRTINEAPVWCSVDLRDGNQAL
FT                   PVPMSVDEKIAMFRLLVSVGFKEIEVGFPSASATEFAFVRRLIEGGLIPDDVTIQVLTQ
FT                   AREHLIRKSFDAISGARSAIVHLYNSTSTLQREVVFRKNMEEVKAIAIEGTRLVRQLKD
FT                   ESRNSGIRFEYSPESFTGTELEYALEVCHAVMDTWGASKDEKIILNLPSTVEMSRPNLY
FT                   ADRIEWFCRNIKDRDAVLISVHAHNDRGTAVATAEFAVMAGADRVEGALFGNGERCGNM
FT                   DIVTMGLNLLTQGVNPGLDFSDLPRIREVYSRCTRMDVHPRHPYAGELVYTAFSGSHQD
FT                   AISKGMKARGQKGDGLWAVPYLPIDPEDVGCTYEAIVRINSQSGKGGVAYVLEKEYGIQ
FT                   IPKWMQPDFAEAVQAVADRTGEELSATQIHDLFHSEYVRLQGALALKKCNISWAEGDGE
FT                   SSGAATTLISSVVAYGDRELSFKAEGNGPLDAFVKGFIREGGLEFTVEEYAEHAIGHSA
FT                   GASAIAYVRICCPDGRISFGAGIDSNISLASIRATQSALNRLH"
FT   gene            151333..152217
FT                   /locus_tag="Plut_0139"
FT   CDS_pept        151333..152217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0139"
FT                   /product="adhesion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23029"
FT                   /db_xref="GOA:Q3B6K2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23029.1"
FT                   /translation="MKRVLWIFLASLLALTSGCNTQPPDERMQVVVSIQPLAWFAGRIA
FT                   GSRAVVQVMVPPGGSPHTYEPLPRQMALLRHAALFLKAGSGVEFELDWMPRFLKLNPAL
FT                   MVCDASEGVQLLEMGGEGHDGSNDHTHNHRMDPHFWLDPSNGLMIADNVARCMAEADPE
FT                   HAGEYLANAGVLKAELRELDASIRTILGPFQGCSFLVFHPAWGYYAHAYGLRQIAAESG
FT                   GKELTPRQMQQVIDQARSEGIRVVFVSPEFSSSQASTIATGIGGLTRSVDPLALDYPGN
FT                   LRLATESFREALR"
FT   sig_peptide     151333..151398
FT                   /locus_tag="Plut_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            152214..152972
FT                   /locus_tag="Plut_0140"
FT   CDS_pept        152214..152972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0140"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23030"
FT                   /db_xref="GOA:Q3B6K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23030.1"
FT                   /translation="MKDPVIASEGLMVRLGGVDVLKGLSLSVYEGDFIGIVGPNGGGKT
FT                   TLLRCILGLVRPSSGSIRVFGGRPGASPGRIGYVPQRLFFDRDFPLDVAGLVLMGRLSR
FT                   KRLLERYGTADRLKVDEVLELTGLSAIRRRAVGALSGGELQRALIARALAGDPELLLLD
FT                   EPTASVDPDMKMSVYDLLDQLRRRMTIMLVSHDIGAISRRVTRVACLNCTLDMHEDGSS
FT                   LPRGALDDLYCYPVDAIHHHEPVSPDRRGD"
FT   gene            152977..153798
FT                   /locus_tag="Plut_0141"
FT   CDS_pept        152977..153798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0141"
FT                   /product="ABC 3 transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23031"
FT                   /db_xref="GOA:Q3B6K0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23031.1"
FT                   /translation="MLHDILTYEFMQNALLAALLSSVACGIIGSFVVVKKIGFISGGIA
FT                   HTAFGGIGLGYWLGVNPLLGIIPFSLAAALGIGLLSKKAKVPEDTAIGTFWAAGMAIGV
FT                   ILIGLTPGYAPNLFSYLFGNILTVPSFDLWMIFLLDVVIVGTVFLCQKELLAIAFDEEY
FT                   AAVSGVPALLFYLLLLCLIALTVVVMVRVVGIVMVIALLTVPAAIARNFSRSLPAMMAI
FT                   ATLLSLVFSTLGLMLSYLFNLASGATIILVATTAFMLVQVAQIFMRSAAAR"
FT   gene            complement(153773..154228)
FT                   /locus_tag="Plut_0142"
FT   CDS_pept        complement(153773..154228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0142"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23032"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23032.1"
FT                   /translation="MKLLAAIDFSELTGSVLEETAKLAKALSAETVLLHVHPPASPAFD
FT                   LYPETEVIPLPAGGAALPDGRQGNGKDKLETMADKFRREGIRATGSTIEGDEVEGIVGE
FT                   GRRIKADMIIVGSHGHGSLFHLLVGSVSEGVVKKAPCPVLIVPRRTS"
FT   gene            complement(154225..155355)
FT                   /locus_tag="Plut_0143"
FT   CDS_pept        complement(154225..155355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0143"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23033"
FT                   /db_xref="GOA:Q3B6J8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23033.1"
FT                   /translation="MLFHPYELAFCGYSGSGKTMLATAVVRHLAGKHTVGYYKHGCHHF
FT                   DIDREGKDSDLAASAGAVTVMVSGPGKKAVISHAPPEPADFERFAFSSCDILIVEGLKE
FT                   LPIPKIILVDEGKKILERIEEGSVSMVAALAVPDDPSSYRLPSLPGVPVFHRDETAAVA
FT                   SFVEQHLMERAAVSAPLTGLVLAGGKSSRMGEDKALIDYHGTSQILHARNLLAPFCREV
FT                   HLSCRIEQAEKYAASGIPLIPDSYLDMGPLGGLLSAQRALPERAFLVVACDLPFLDAGT
FT                   LGKLVAGRNPFRFATAWRDPLSGRFEPLAACYEPKSREPLLLRHAAGLNALSGFLATTG
FT                   IEELESPEPDIMKNINTPGERSRAAMAFSGTKNTRQ"
FT   gene            complement(155382..155552)
FT                   /locus_tag="Plut_0144"
FT   CDS_pept        complement(155382..155552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0144"
FT                   /product="Ric1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23034"
FT                   /db_xref="GOA:Q3B6J7"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23034.1"
FT                   /translation="MDTKRLILAFVLPPAAVMNKEAGTIMLTGILTVFGWVPGVVAALV
FT                   MMAQEQRQVKA"
FT   sig_peptide     complement(155493..155552)
FT                   /locus_tag="Plut_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.636) with cleavage site probability 0.616 at
FT                   residue 20"
FT   gene            155753..156061
FT                   /locus_tag="Plut_0145"
FT   CDS_pept        155753..156061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23035.1"
FT                   /translation="MVNTVHPDIVLDDFDEAVDEPNFNNPNTSPDPPSPYADLEKKYRK
FT                   NRFNKSRNRTSAGAPGVNGQTSRTAPGGAEGNRVQKRKPKKKSAQKSFRSPSGRRNA"
FT   gene            156216..156731
FT                   /locus_tag="Plut_0146"
FT   CDS_pept        156216..156731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23036.1"
FT                   /translation="MLLINRFIRLIENHAETLSAKWVEAVRTSPLTGGYAKLPKQELHD
FT                   IVYSRFRKLGEWVEKKEGQDRQIAGHFLEIGARRAASGIKVSEMTYSLLLERDLIWRYI
FT                   LDEGIITEGIDLNRAIEFSHRLNHFYEKAVYFALVGHENYGDPEPRTKDEGFFESIFEG
FT                   FRHWLVVE"
FT   gene            156743..157651
FT                   /locus_tag="Plut_0147"
FT   CDS_pept        156743..157651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0147"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23037"
FT                   /db_xref="GOA:Q3B6J4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23037.1"
FT                   /translation="MTVVPAGPPVPRPLSGSFEIQAHRGARSLFPENTIAAFIGAADLG
FT                   IRVVELDLIVSADLQLVVSHDPWINVHGGRRPIYAMHSEDVAGYDCGAPDPRFPLQQRI
FT                   RASRPLLCDVFRAVDIHLAGAGPGELMAYNLELKSWPSRDRLFHPPPALFARLVLDAAL
FT                   SAGVLGRIRIQSFDWRVVREAWKRMPAIPYGILVERAGAIRPSLRHLGFRPQWLNPHYC
FT                   LATPALVRHLHASGIQTAPWTVNDPGLMLRLRDIGVDGIITDHPERALRFASEGGNRYL
FT                   YSSSGQTEGPTNLHPYGIHPS"
FT   gene            157632..158567
FT                   /locus_tag="Plut_0148"
FT   CDS_pept        157632..158567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0148"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23038"
FT                   /db_xref="GOA:Q3B6J3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR012247"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23038.1"
FT                   /translation="MAFTHLDDDGNVAMVDVSSKPGTLRTARAEGRISLHPDTLLQLQG
FT                   EGMPKGNVLTAAKIAGIQAAKQASALIPLCHQLNLSWVDLSFSVGPEGIDITATARTKE
FT                   ATGVEMEALTAVSVAALTIYDMCKAVDKGMEIGGIRLVSKTGGKSAAPGYRPRTAILVL
FT                   SDSIAAGTARDRSGEILREGFMAAGCRVEGVRIIADDPAELEGAVDAFVAEGMELIVTS
FT                   GGTGLGPRDITVDTLTPKFSRRLPGIEQALFSWGQGKTRTAMLSRLAAGVIGDSIVVCL
FT                   PGSAGAASDALEVLVPSMFHAFSMMKGEGH"
FT   gene            158567..159796
FT                   /locus_tag="Plut_0149"
FT   CDS_pept        158567..159796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0149"
FT                   /product="molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23039"
FT                   /db_xref="GOA:Q3B6J2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23039.1"
FT                   /translation="MLTSVDDARRIVMESLPLPLIEECRLNALQGRVLAGDVAAPFPMP
FT                   RFTNSAMDGFAFRIADAAGGSPDDHVHLPVSLRIPAGSSAAGALPPGSAAEIMTGAPMP
FT                   EGADTVVPFENTSGFGGDGVEIYRLPKAGANVRYRGEEIAMGQRVLDAGRRISPSEIAV
FT                   LASFGIESARVWRLPSVALVVVGDELQKPGGMLRDAAIYDSNSHMLRAACRSAGIEPVV
FT                   VLHAEDDPEAVRKVLAVALATADVTVTSGGISTGEYDFVQEVLTRLGVEKKFWSVSQKP
FT                   GKPFYFGCSPDGKVVFALPGNPVSSLVCFTEYCVPALMKMQGLPRPAKLHATLDAPFPA
FT                   DRKRHRFLPGVLREEGGRLFCRTAALTESHMATSLVGANCLIESPPADTPVPAGDTIAC
FT                   SLLPWASLPG"
FT   gene            complement(159803..160603)
FT                   /locus_tag="Plut_0150"
FT   CDS_pept        complement(159803..160603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0150"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23040"
FT                   /db_xref="GOA:Q3B6J1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23040.1"
FT                   /translation="MEPLRIGFIGTGRIGRAIIAGLGRQKDAVMFGYDRDPGAVEAIAA
FT                   AHPITGCPSPAALAREAKVIILAVKPYQIEEVLIELRPSLSSDHLIVSVAAGISSEFIR
FT                   KNALEETRVVRVMPNTPAFVGEAMTALCRGKMATEEDIAVARGLFSTIGRVAVLEESQM
FT                   DAATALSGSGPAYMFNILDSLSEGGVRCGLSKEEALLLGAQTMLGAARMVLSGTRSPEE
FT                   LKREVTTPGGTTEAGLRVMDERGIRAILIDAVAAADARSRELRK"
FT   gene            complement(160627..160881)
FT                   /locus_tag="Plut_0151"
FT   CDS_pept        complement(160627..160881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23041"
FT                   /db_xref="GOA:Q3B6J0"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23041.1"
FT                   /translation="MHQSEYIGYAAGIITTLALFPQAIKILSTRHTRDISLIWALAMNA
FT                   GIILWLLYGIAQNDLPMIAANGCSLILLMIILLLKLRYG"
FT   gene            complement(161031..161363)
FT                   /locus_tag="Plut_0152"
FT   CDS_pept        complement(161031..161363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0152"
FT                   /product="cytochrome c-555"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23042"
FT                   /db_xref="GOA:Q3B6I9"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23042.1"
FT                   /translation="MSRFLTAAFCVLIAASFTVDANAAYNAAAGKAVYDGSCAMCHNTG
FT                   MAGAPKAGDKTAWASRIGQGVDKMAAKSIAGFKGTKGMMPAKGGNAKLTNVEVGNAVAY
FT                   MVQLSK"
FT   sig_peptide     complement(161298..161363)
FT                   /locus_tag="Plut_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.524 at
FT                   residue 22"
FT   gene            complement(161548..161943)
FT                   /locus_tag="Plut_0153"
FT   CDS_pept        complement(161548..161943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0153"
FT                   /product="cytochrome c-555, membrane-bound"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23043"
FT                   /db_xref="GOA:Q3B6I8"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23043.1"
FT                   /translation="MKKFLPLLTLGLFFLGGCGLEKPPATLEFPGEETEAEVAAPAAEE
FT                   APVDPKLAAGKEIYTANCAMCHDSAMMGAPKPGDKAAWEARVAQGLDVMVKKSIEGFAG
FT                   MPAKGGNPNLTDEEVANTVAWMTDTVK"
FT   sig_peptide     complement(161878..161943)
FT                   /locus_tag="Plut_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.532 at
FT                   residue 22"
FT   gene            complement(162041..163480)
FT                   /locus_tag="Plut_0154"
FT   CDS_pept        complement(162041..163480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0154"
FT                   /product="Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23044"
FT                   /db_xref="GOA:Q3B6I7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23044.1"
FT                   /translation="MGTLKKVLLVFIPTRSGVDGARSIYAEREQSLPARMLARPLRTLI
FT                   RKSPFSIPPLSLMILASIRVEGVEQTICDLRLELFPDHVEWDLIGISVQTGTASEAFEL
FT                   ADRLRSQGTLVALGGPHVTMFPEASARHADLIVEGEADDLWRRVLTDLRQGTLGKTYRQ
FT                   EERPDLSLPRPVFKEHLDAGRYFTTNLIQTSRGCPHNCDFCNVHVLNGHRLRQRPIEEI
FT                   VGEVARFREHDGRIFFFVDDSINADPDYAEELFRRLTTLRITWFGQATTALGMQQSLLE
FT                   TFARSGCSALLVGIESVEPASRKAHHKNQSRSDELVQSVRNIRSAGISLYGSFIYGLDG
FT                   DTLETPAAILDFINQTELDVPGINILRPTPGTQLFLRLREEGRLLFDPDDPAAFRYTFG
FT                   QEMLYRPKQIPLDRFIESYGELTSRIFTVPASLKRAISAPSAKTAVGIFNLFYTHLYSL
FT                   SRHDLKRQAGQFHQKNHFAIR"
FT   gene            complement(163521..164663)
FT                   /locus_tag="Plut_0155"
FT   CDS_pept        complement(163521..164663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0155"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23045"
FT                   /db_xref="GOA:Q3B6I6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23045.1"
FT                   /translation="MKKRLFTPGPTPVPENVMLSMAAPIIHHRNPEFMEILQRVHENLK
FT                   YLFQTTQPVVVLSCSGTGGMESAISSIFREGDKVIAINAGKFGERWGELVRLYTGGCIE
FT                   ETVPWGRAIEPGRLKELLREHPDAKGVCLTHSETSTGTAADIRALSAVIREESDALVLV
FT                   DGITAIGAHEFHFDDWGIDICITGSQKGLMMPPGLALIAVSERAQDVINAAEDSAKNFY
FT                   LSLAKALKAHSGDDTPFTPAVSLVIGLDEALKMIRQEGIETTWARHESLAAACRAGCTA
FT                   LGMELFSTSPSFAVTPVWLPEGVEWNAFNKALKYSNGITVAAGQDDYKGKIFRISHLGY
FT                   YDELDMLTIVGAMERALKEIGYCFPVGAGVTAVQQAFLGR"
FT   gene            complement(164669..165778)
FT                   /locus_tag="Plut_0156"
FT   CDS_pept        complement(164669..165778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0156"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23046"
FT                   /db_xref="GOA:Q3B6I5"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23046.1"
FT                   /translation="MQSTPAVLVLENGSVYRGTAFGQAGEAAGEVVFNTSHTGYQEILT
FT                   DPSYAGQMVVMTYPLIGNYGITPDDNESSRVWARAFIVREVSNVYSNFEASTSLDDTLK
FT                   KAGVIGLSGIDTRKLVREIREKGAMRGVISTIDTDEASLKDKALAIPEMTGLDLVKTVT
FT                   TDKNYTLETPGARFHVAAFDYGIKTNILRLLQNAGCRVTVLKAGTTADEVIALNPDGVF
FT                   LSNGPGDPAAVDYAIDTIRTLAEYSRTTRPLPIFGICLGHQLLALALGADTYKLKFGHH
FT                   GSNHPVKNMASKRIEITSQNHGFAVGMDSLPESVEMTHLNLYDQTIEGIRHSELPCFSV
FT                   QYHPEAAPGPHDSHYLFDEFTAMMERAKN"
FT   gene            complement(165786..166142)
FT                   /locus_tag="Plut_0157"
FT   CDS_pept        complement(165786..166142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0157"
FT                   /product="protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23047"
FT                   /db_xref="GOA:Q3B6I4"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23047.1"
FT                   /translation="MHDLIQTILLFAPPTQGGPAPNPLVQLVPLVLIFVVFYFFMIRPQ
FT                   QKKQKDREKVLESLKRGDRVVTIGGIHGTVAGIDTEKKTVLVQVSENTKIKFDRSAVAN
FT                   IEKQESGDKLTTGE"
FT   gene            complement(166244..167290)
FT                   /locus_tag="Plut_0158"
FT   CDS_pept        complement(166244..167290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0158"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23048"
FT                   /db_xref="GOA:Q3B6I3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6I3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23048.1"
FT                   /translation="MIILGLETSCDETSGAVLVDGEVRSNVVSSQLCHKGFGGVVPELA
FT                   SREHERLIVPITEAALAEANITKKDIDVIAATAGPGLIGAVMVGLSFAQSMAWALGVPF
FT                   VAVNHVEAHMFSPFIDQETAGGGPIGPFISLTVSGGHTLLAIVREDLTYRIIGRTLDDA
FT                   AGEAFDKTGKMLGLPYPAGPAIDRLAKEGDAGFHRFPRALTSQSQTSRSYRDNFDFSFS
FT                   GLKTSVLTWLRSQKEEFIHEHRADIAASIQDAIVGVLVEKAVGAARRHNIGAIAVAGGV
FT                   SANSELRRAMDAACRKHGIALFIPSATYSTDNAAMIATLAGLKLSRGLQPLCRYDTAPF
FT                   ASFSAAGN"
FT   gene            167317..167550
FT                   /locus_tag="Plut_0159"
FT   CDS_pept        167317..167550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23049"
FT                   /db_xref="GOA:Q3B6I2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23049.1"
FT                   /translation="MQKANKQGGNSNGKPRVKIGILNVLLILAGADLILLLSPEVGFLN
FT                   GLFYIPGIYTWPALLLGVALLLFGFRHLYRPR"
FT   gene            167623..167925
FT                   /locus_tag="Plut_0160"
FT   CDS_pept        167623..167925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23050"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23050.1"
FT                   /translation="MEQQNSAKKILDPIERAKLGVKVLSLPYSEAERVIDEYVSGGDYD
FT                   PASVDFFKDQVETQSRIVEKGSELLSTGSEILRVVAGAVVKNWPKPPAEQAAPRS"
FT   gene            168098..169426
FT                   /locus_tag="Plut_0161"
FT   CDS_pept        168098..169426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0161"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23051"
FT                   /db_xref="GOA:Q3B6I0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6I0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23051.1"
FT                   /translation="MQFDPNRFTIKAQEALQAAASSASSRQHQQVEPEHLLLAMLDDRQ
FT                   GIAVQIAQKLEVSPETLAAALDRELERMAKVTGASASGQYMSQNLGKVFDAALKEAEGL
FT                   KDEYISSEHLLIAMSETGATASRLLTDAGVTRDAILKVLASIRGTQRVTSQSAEETYNS
FT                   LKKYSRNLNDQARKGKLDPVIGRDEEIRRVLQILSRRTKNNPVLIGEPGVGKTAIVEGI
FT                   AQRIVAGDVPENLKSKQIAALDIAQLVAGAKFRGEFEDRLKAVVREVQAADGEVILFID
FT                   EIHLLVGAGSAEGSMDAANILKPALARGELRCIGATTLDEYRKHIEKDAALERRFQTVV
FT                   VDQPSVEDTVSILRGLKEKYEIHHGVRIKDAAIVAAAELSNRYISDRFLPDKAIDLIDE
FT                   ASSRLRLEIDSSPEELDRLNREIRRLEIEREALKRELEAGSAR"
FT   gene            169520..170224
FT                   /locus_tag="Plut_0162"
FT   CDS_pept        169520..170224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23052.1"
FT                   /translation="MMKMMKMALLALFLLGTVGGAAHAGWDPDEAEKGRSAVAYLKKHD
FT                   PSLERFFSKAYGYAVFPDVYKGGLFLFGGGHGRGYVYEYGRLVGRSTITQLNVGPQFGG
FT                   QSFTEVIFFKDRKALEDFKQGNFEINAQMTAVVVTSGIATNADYSDGVALFVLPKAGVM
FT                   ADATVGGQKFSYDPLQQSAAPAAVPAPAQQDVTPLQPYPGAASSSVAKPYEESRPYDDT
FT                   PLEKADQGASQY"
FT   sig_peptide     169520..169594
FT                   /locus_tag="Plut_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            170262..171689
FT                   /locus_tag="Plut_0163"
FT   CDS_pept        170262..171689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0163"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23053"
FT                   /db_xref="GOA:Q3B6H8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6H8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23053.1"
FT                   /translation="MKYELVVGLEVHCQLNTASKAFCSCSAQFGKPANSNVCPVCLALP
FT                   GALPVLNRRVVEDAVKLGLATGCAIAPHSVLARKNYFYPDLPKGYQISQFEEPICIEGH
FT                   LMVDAGEGEKLIRLIRIHIEEDAGKSIHDIGDDTYIDVNRCGVPLLEIVSYPDIRTAKE
FT                   ASTYLQKLRQIVKYLGISDGNMEEGSLRCDANVSLRPVGDEEYGTRTEIKNMNSFKNVE
FT                   KAIEFEAERHRGILEEGGTIVQETRLWDADKGETRSMRGKEFAHDYRYFPDPDLVPVLV
FT                   DDEMLRRIRLELPEFPEARASRFVEQYGIPVYDAAVLTVEREMADYFEAVVEVAGDGKV
FT                   SSNWVMGEVMRTLKEKYLDITAFSVAPSRLGGLIKLIGSGAISNTIAKQVFELMQQSEA
FT                   SAEEIVQREGLAQVSDTGEIERVVDEILAANPDQLAGYREGKVKLFGFFVGQCMARMKG
FT                   KANPKVVNEVLQRKLEG"
FT   gene            complement(171696..172004)
FT                   /locus_tag="Plut_0164"
FT   CDS_pept        complement(171696..172004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0164"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23054"
FT                   /db_xref="GOA:Q3B6H7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23054.1"
FT                   /translation="MLFTYYEWNFNSEHRRHMAETSAKKTSIESLISRLEEITRTMETP
FT                   DTGLERSIALYEEGIAIAEQCKKRLQQARAKIEVINPDTAPSRPEAGQPKGLFDLEP"
FT   gene            172032..173063
FT                   /locus_tag="Plut_0165"
FT   CDS_pept        172032..173063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0165"
FT                   /product="GTP-binding protein Obg"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23055"
FT                   /db_xref="GOA:Q3B6H6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6H6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23055.1"
FT                   /translation="MKFVDSASIFVQAGEGGRGCVSFRREKFVPKGGPDGGDGGNGGNV
FT                   WLRTNSHLTTLLDFKYRKKYLAPRGSHGQGSRKSGRKGADIYIDVPCGTLVRNAATQEL
FT                   LADMTGDGEEVMIARGGHGGRGNQHFATSTNQAPRRSEPGWKGEELQLDMELKLMADVG
FT                   LVGFPNAGKSTLISVLSAARPKIADYPFTTLVPNLGIVRYEEYKSFVMADIPGIIEGAA
FT                   EGRGLGLQFLRHIERTKILAVLVSADAEDVEAEYQTLVGELEKFGRGLDEKPRILVVTK
FT                   MDIAPEDFTLPAPGDEVHVLAISSVAGMGLKELKDELWREVSMRDRPEESSDPEGEGDG
FT                   GTP"
FT   gene            173060..173557
FT                   /locus_tag="Plut_0166"
FT   CDS_pept        173060..173557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0166"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23056"
FT                   /db_xref="GOA:Q3B6H5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23056.1"
FT                   /translation="MTQAEITVRSATLDDASAIAALTKEYAGEGIMLERPLENIIENIR
FT                   NFFVAEYGGEVIGCCAIAFYTPTLAEIRSLAVLSRWKLKGTGRQLVEKAESILRDEGVP
FT                   EVFVLTLSRQFFLRLGYSEVEKEYFPQKIWRDCTHCPKLMACDEIAMMKTLVPSTTNSS
FT                   LQ"
FT   gene            173554..173820
FT                   /locus_tag="Plut_0167"
FT   CDS_pept        173554..173820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0167"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23057"
FT                   /db_xref="GOA:Q3B6H4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23057.1"
FT                   /translation="MIVHEVIVKNRAGLHTRPAAAVVKLASRFKADFFIEMQGVEINAK
FT                   SIIGVMSLAAPKGTKLTLKLAGEDADEAARQLVEFFEQGFGEQ"
FT   gene            173845..174969
FT                   /locus_tag="Plut_0168"
FT   CDS_pept        173845..174969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0168"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23058"
FT                   /db_xref="GOA:Q3B6H3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23058.1"
FT                   /translation="MKQLQIALVSPFPPLKGGISRFTAELSQALSAAGHKPLHIGFRSL
FT                   YPRFILRGRAAAPSATSFPQDALLVLYNPLTWVRTAIMLRRLRPDVVLIAYWAGFLAPL
FT                   CFVLRRLTGLRTVLLLHNLSSHESFFFEPLMRRILKRSADRVITLSPTVDRDVAAYLPS
FT                   MPRLLLSHPDYLPAAELPPPEEARRALGLKPDGHLLLFFGYVRRYKGLDLLLESLALLH
FT                   ACTDLHLVVAGEFYEPLEPYRAMVSRLGIEDRVTLHPGYVQPERSVLYFAAADALVLPY
FT                   RSATQSGVAGLARGCGLPLIVTPAGSLPEAVPPGSGGVVADECSAAGIARAIKAFLDAP
FT                   GGGQRILAGSWTISWAEFADAVAVFLRAAAEDGR"
FT   gene            174966..175841
FT                   /locus_tag="Plut_0169"
FT   CDS_pept        174966..175841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0169"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23059"
FT                   /db_xref="GOA:Q3B6H2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23059.1"
FT                   /translation="MNSPACIVVVNWNGADDTIRCLRSLEPVRSSACMVLVVDNGSDDG
FT                   SAARIRSACPGTEVLELPLNIGYGAGCNAGFRRAEELGARTMIFLNNDTLVDPSFAMAL
FT                   LLVLSEDPTAGMAVPKILYADRPGTIWYAGGEVNLGCGLVQHTGIRRNDGPGYSRPGHT
FT                   GYATGCCFAMRTRDFRAVGGFDEGFGMYAEDVDLSLRVRQLGLSIEYEPSSVVLHRVSA
FT                   SYRGRPLRKLWLRSKGILRLLRKHGSWMGMLMFLLLEPFRLVRGAASMAALSVTEVLHS
FT                   TRCREEGGAV"
FT   gene            175838..176572
FT                   /locus_tag="Plut_0170"
FT   CDS_pept        175838..176572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23060"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23060.1"
FT                   /translation="MSAARMFRTSIDGRYLAEEAHRVRWEKSVRFLEKWRVPAGLHPSG
FT                   LDLGDRTPMTELAEALFGFTFDSSRVDLDEGSLSGCYGVVTAFEVLEHLFNPLHALLEV
FT                   KKVMAGSAARLFVSMPLRQPELLRSPEHFHEMSRTAALALFGRSGFRVERSAEFRIRRP
FT                   LFYLSGFKPLLRFFFERVQVYELSTAEVQRETTAEVQRETTAEVQRETTAEVQRETTAE
FT                   VQRETTAEVQWESAAAVRGGGV"
FT   gene            176572..177747
FT                   /locus_tag="Plut_0171"
FT   CDS_pept        176572..177747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23061.1"
FT                   /translation="MDQQPQSGVERKPEALRRLVWFSEVQWDFLSTRKQRLLARFPEHW
FT                   KILFIEPFTLGRRNHWLPVRRGRVWVICVPFLKRVPFQIGRLLDVSAIRMLAGLPGLLL
FT                   MRFWISFLGFGGRRRIIGLSNLYAAGPASRLQSSLRFYDANDDHLAFPGTPSWLNPELK
FT                   RWLDCSQLVFSVSRTMTKRLQLSSGTKVIELGNGVEFSHFATPRTVVPALLAGTGGPIL
FT                   GYAGAMDWLDVPLLVRTAAAWPDCRIVLVGPAYERGWWERQNALRAAGNVTYAGLVGYK
FT                   ELPAWVQRFDLALLPLERSPLKRASNPNKLYEYAAAGVPVLAINYCDAVYDAREVVMVA
FT                   ETEEEFVRMVPLALGDSRRELRQKFARSHSWDTIAAAMVDELLRTSGEGTL"
FT   gene            177744..179231
FT                   /locus_tag="Plut_0172"
FT   CDS_pept        177744..179231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0172"
FT                   /product="polysaccharide efflux transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23062"
FT                   /db_xref="GOA:Q3B6G9"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23062.1"
FT                   /translation="MSRSLAIAAGAGFSFGGYIIGQAVRFMFSLAVARLLGADALGTYA
FT                   LAMAVIQIAEVAALAGLDSALLRFSGMHRNDPVRRRRLIGFVLKTGFFLSLAVMLLLEL
FT                   LAGSLAGMLNGGRMLQLAIACYAAAVPFNAATMLYGHAMQAAGRIEPKIIATQVLSPLL
FT                   LLSFTLLLNASSGREAALLFPFALSAASAFFWIRPRLSDLTGMEPGDWRRAPFERSVLS
FT                   YAMPFLLVSLLSMTAHWLDIVMLGMLTDPGTVGLYHPAARTAGLIRAVLPAFAGMAAPM
FT                   FAELHAAGSTGELERMYQLVTRWMVTVVVPPVLLFLLFPAPVLSVFGAHFTKAAPVLGL
FT                   LTAGAFLQALFGISATLLAMAGHSRLSLLNALSALTLQVALNLLLIPRMGIEGAASAGL
FT                   IVFGVLALARLVEVRLLLGLHPFSRPLLKPFVAGSAAGMLLIISRGWLLTLPFPALLAV
FT                   AAGAAVAVYMGVLLILGLEEEDREIILRAGFLIGRGR"
FT   sig_peptide     177744..177809
FT                   /locus_tag="Plut_0172"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.749) with cleavage site probability 0.508 at
FT                   residue 22"
FT   gene            179240..181621
FT                   /locus_tag="Plut_0173"
FT   CDS_pept        179240..181621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23063"
FT                   /db_xref="GOA:Q3B6G8"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6G8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23063.1"
FT                   /translation="MLFRYPRGLKNRIVPLIAATFGYTFLAIAMYWPVAILSYVPAVPD
FT                   SLVPGATALALSQLQEASGQYPLWQPWVFSGMPTVGAFSYLSGLYFPNVLFSLFSLGGM
FT                   QLQLLHLVFAGLGTFLFLRRAGLEPPASFFGGAAFMLNPYLSAMLVHGHGSQLMTAAYM
FT                   PWMLWALMRVVQHSKLEDAGVLALIAGFQLQRAHVQVAWYSWLLFAILALFLFVTLKAP
FT                   LREKFRPLGLIVLGLSCGVAMSAAIYLPASAYAPFSVRGMAGGGGGSAMEYATLWSMHP
FT                   IELLTFIVPGMFGFGGITYWGFMPFTDFPNYAGIIVLLFAFIGAYAGRREPFVRFFIIA
FT                   ALLSMFLSFGSFFSPVFDLFYYAAPLFSRFRVPSMALLMLYLSIAGLAAAGLGTLLGSR
FT                   TESLHRPLRYASLAFAAMLLIALAAGGALEGWLRSLFPVPAVSNFDLALMVNRVRIQGI
FT                   ENGALLLGALFGTALLLLWLGLKRFIPFRAAVLLLGALALGDLLWCSVQVVYPSPSSLR
FT                   SASLVPEDAVRPAFAPDEVTLWLARQPGTFRIYPAGSLFGENKFAVFGIESVGGYHPAK
FT                   FSRYEELLAQTGNLASPAVLRMLNVRYVLSLQPVLHPLLEPAMEGELRLASGPARVHVY
FT                   RLQGSLPRAWAALKAERADGLDAVISGLESPGITPGTVFVSPSSPIAGRTFAPASVKIL
FT                   DRTAESSLIEVSSEGEALLVQSEINYPLRWKAEVDGKPAVIEAVNGLLRGVVLQGGTRR
FT                   VRFHYDRTGFETARNVSYGAFGLAFLMAISGLPSRFARRS"
FT   sig_peptide     179240..179329
FT                   /locus_tag="Plut_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.665) with cleavage site probability 0.641 at
FT                   residue 30"
FT   gene            181664..182998
FT                   /locus_tag="Plut_0174"
FT   CDS_pept        181664..182998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23064.1"
FT                   /translation="MPQDSCRKCTANDERDVKKILFLAVSYPPYMTDGSSRAFRMASRL
FT                   PGYGWQPVVVAPPLFVKTGGEDALAESMKEPGPVRVYRSGEAVALGGVDECTLAAFARG
FT                   ERIVQGGRLSGMLPSIFRDAHPCALWEKQAAVVAAEVMKENPDIEAIYAQGPPSAPIRL
FT                   GLELSLRHGVPVIFDLTAPLDAPRPWSRLGDLRSDELFKLEQKVLCSGYGVITPTRALK
FT                   EHFLRKHFGKVSHDDITIIADCGPLVPAAAPPSLSAHSRPLFIIERADEKGAKAFIQAL
FT                   AAVMKECPGGAAFSGATIVDASGDMVPKMLRKAGVEGDLTLSCTASEEEELQLVRTASA
FT                   VGVVSGSHESFGLWLPDRLIDAVFIGKPVFAVAPEGVATRFAEDAGGLHASPGNPAAIR
FT                   DMLCSLSGVIGGSPAPTPSSELFARHSEREVLSEMVKAIALLLPV"
FT   gene            183276..183665
FT                   /locus_tag="Plut_0175"
FT   CDS_pept        183276..183665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0175"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23065"
FT                   /db_xref="GOA:Q3B6G6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23065.1"
FT                   /translation="MPTIQQLIRHGRSVKVSKTASPALEKCPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGTLDT
FT                   SGVSDRKQSRSKYGAKQPKAVAAKK"
FT   gene            183700..184167
FT                   /locus_tag="Plut_0176"
FT   CDS_pept        183700..184167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0176"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23066"
FT                   /db_xref="GOA:Q3B6G5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23066.1"
FT                   /translation="MSKKGGYKGVQVDHRYNDESVARFINAVMLDGKKDVATKIVYDAF
FT                   AIIGEKMVDENPLEVYRRAMSNIAPVVEVRSKRVGGATYQIPMEVKPSRRGALAFRWLK
FT                   QYATKRGGRSMAEKLAAELMDAASEQGASVKKRDEVHRMADANKAFAHFRF"
FT   gene            184210..186324
FT                   /locus_tag="Plut_0177"
FT   CDS_pept        184210..186324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0177"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23067"
FT                   /db_xref="GOA:Q3B6G4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23067.1"
FT                   /translation="MTRQVALDKVRNIGIMAHIDAGKTTTTERILYYTGRLHRMGEVHD
FT                   GGATMDWMDQEKERGITITSAATTCFWAPKFGNYEGEKHRINIIDTPGHVDFTVEVERS
FT                   LRVLDGAVALFCAVGGVEPQSETVWRQANKYGVPRVAYVNKMDRTGADFFDTVKSIKER
FT                   LSANPVPIQIPIGEGEIFAGFVDLIRMKGIIYDKEDGSTYEEVAIPHDLENEARTWRIN
FT                   MLEAVSEVDESLLEKYLNGEDITEMEIRKVLRQATLKVSIIPVLCGSSFKNKGVQFMLD
FT                   AVVDYLASPLDDGEVEGHHPRTEEPVVRHPNDDEPFAGLAFKIATDPFVGKLTFFRVYS
FT                   GTLKAGSYVLNSITGKKERIGRVLQMHSNKREDIDCVYAGDIAAAVGLKEVRTGDTLCD
FT                   ENNPVVLEKMVFPEPVIQIAIEPKTKADSDKLGMSLAKLAEEDPTFRVKTDDETGQTLI
FT                   AGMGELHLEILVDRLKREFKVEANVGQPQVAYRETIRAKVDFEGKFVRQSGGKGQFGLV
FT                   NLTVEPLEEGKGYEFVDAVKGGVIPREYIPAVNAGIQQAMKDGVVAGYPMQDIKVTLYD
FT                   GKYHDVDSSEMAFKIAGSIGFKGGARKASPVLLEPIMKVEVVTPEEYLGDVMGDLSSRR
FT                   GHIEGMGQRAGAQFVHAKVPLSAMFGYSTDLRSMTQGRANYSMEFESYREVPKNIADAL
FT                   QDKRVTKDDY"
FT   gene            186385..187566
FT                   /locus_tag="Plut_0178"
FT   CDS_pept        186385..187566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0178"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23068"
FT                   /db_xref="GOA:Q3B6G3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23068.1"
FT                   /translation="MAKESYKRDKPHVNIGTIGHVDHGKTTLTAAITSVLSKKGFAESR
FT                   AFGDIDKAPEERERGITISTAHVEYQTEKRHYAHIDCPGHADYIKNMITGAAQMDGAIL
FT                   VVAGTDGPMPQTREHILLARQVNVPALVVFLNKVDIADPELLELVEMELRELLTEYGFP
FT                   GDDIPIIKGSALKALEGDPEGEKAILELMDAVDNYIPEPVRDVDKPFLMPVEDVFSISG
FT                   RGTVGTGRIERGRIKINEEVEIVGIKDTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGV
FT                   DKTELERGMVIAKPGTIKPHTKFKAEVYILKKEEGGRHTPFFTNYRPQFYFRTTDVTGA
FT                   VTLPEGVEMVMPGDNLSVDVELIAPIAMDEGLRFAIREGGRTVGAGSVTKISE"
FT   gene            187645..187956
FT                   /locus_tag="Plut_0179"
FT   CDS_pept        187645..187956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0179"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23069"
FT                   /db_xref="GOA:Q3B6G2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23069.1"
FT                   /translation="MAVQQKIRIKLKSYDHSLVDKWALRIIDVVKQTDAIIFGPIPLPT
FT                   KSHVYTVNRSPHVDKKSREQFSFASHKRLIEIINPTSRTIDMLMKLELPSGVDVEIKS"
FT   gene            187978..188607
FT                   /locus_tag="Plut_0180"
FT   CDS_pept        187978..188607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0180"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23070"
FT                   /db_xref="GOA:Q3B6G1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23070.1"
FT                   /translation="MGAILGKKIGMTRLYNDKREAVPCTIIQAGPCFVTQVKNAEKDGY
FT                   DAVQIGIGERKEHKVTKPMLGHYKKAGVTPGYMMAEFDASMFDVELAAGSPVSVESFKE
FT                   GEIVNVLGVSKGKGFAGVVKRHNFGGGSRTHGQSDRLRAPGSVGGSSDPSRTFKGTRMG
FT                   GRMGSDNVTVRNLQVVKIMAESNLIMVKGSVPGPKNSYVKIVSIKK"
FT   gene            188627..189253
FT                   /locus_tag="Plut_0181"
FT   CDS_pept        188627..189253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0181"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23071"
FT                   /db_xref="GOA:Q3B6G0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23071.1"
FT                   /translation="MELKVLNTAGAETGEVVTLRDDIFGAEVSEHAIWLDVKSILANKR
FT                   QGTHKSKTRAEVRGGGRKPYRQKGTGNARQGSTRSPLMIGGGTIFGPTPHGYDQKVNRK
FT                   VKQLARRSAFSAKAQEGRILIVEDFALAEIKTKPVADMLRNLGLDAKKILMLTPDYNMV
FT                   IARSGRNIEALNIMTAEKASTYDILNSHTVLFQKTALKKLEETLG"
FT   gene            189285..189596
FT                   /locus_tag="Plut_0182"
FT   CDS_pept        189285..189596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0182"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23072"
FT                   /db_xref="GOA:Q3B6F9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23072.1"
FT                   /translation="MKNPLLRPWLTEKSTGLTEQKGQYVFQVKLDADKIDIRMAVEEKF
FT                   GVEVKSVRTVNCLGKSRRQYTRKGLIAGKKNDWKKAIVTLREGQSIDYYSGAAPKGEG"
FT   gene            190501..190797
FT                   /locus_tag="Plut_0185"
FT   CDS_pept        190501..190797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0185"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23073"
FT                   /db_xref="GOA:Q3B6F8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23073.1"
FT                   /translation="MPRSLKKGPFIDIKLEKRILDMNSRSEKKVLKTWSRSTMISPDFV
FT                   GHTIAVHNGKTHVPVYVSDNMVGHKLGEFAPTRTFRGHAGGKAEKGGSAPKRK"
FT   gene            190831..191190
FT                   /locus_tag="Plut_0186"
FT   CDS_pept        190831..191190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0186"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23074"
FT                   /db_xref="GOA:Q3B6F7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23074.1"
FT                   /translation="MQAKAILRHTPTSPRKMRLVAGLVRGKAVDQAKAILLNSTKAASR
FT                   NALQTLKSAVANYAQLNPDERVGDQELFVKSVFVDEGATLKRMLPAPMGRAYRVRKRSN
FT                   HLTIIVDKVKNPETK"
FT   gene            191208..191966
FT                   /locus_tag="Plut_0187"
FT   CDS_pept        191208..191966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0187"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23075"
FT                   /db_xref="GOA:Q3B6F6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23075.1"
FT                   /translation="MGQKVNPTGFRLGIIKDWTSRWYDDSPVISGKIKEDHVIRNYVQT
FT                   RLKREKAGIARIIIERTTKHIKINIYAARPGAVVGRKGEEINNLSQELGRITGKEVKID
FT                   VVEVVKPEIESQLIGESIAYQLENRVSFRRAMKMAIQQAMRAGAEGVRIRCAGRLGGAE
FT                   IARAEQYKEGKIPLHTIRANVDYASVTAHTIAGTIGIKVWVYKGEVLNQRIDAIEEEEM
FT                   KRIKERRSDSGPRSRNDRSQKRRRRPNDRG"
FT   gene            192011..192430
FT                   /locus_tag="Plut_0188"
FT   CDS_pept        192011..192430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0188"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23076"
FT                   /db_xref="GOA:Q3B6F5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23076.1"
FT                   /translation="MLMPKRVKYRKTQRGRMKGNAGRGTSVAFGSFGLKAIEPAWITSR
FT                   QIEAARVAMNRYMKRDGKIWIRIFPDKPVSKKAAETRMGSGKGSPEFWVAVVKPGRIMF
FT                   EADGVPMEVATEAFRLAAKKLPIKTRFIVRPDYEA"
FT   gene            192461..192667
FT                   /locus_tag="Plut_0189"
FT   CDS_pept        192461..192667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0189"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23077"
FT                   /db_xref="GOA:Q3B6F4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23077.1"
FT                   /translation="MKKHEIAAMNEKELVERIAELEDRLADINFYKVIEQPQNPMVFRN
FT                   SRREIARMKTRLHQLQAAEPLKG"
FT   gene            192715..192999
FT                   /locus_tag="Plut_0190"
FT   CDS_pept        192715..192999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0190"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23078"
FT                   /db_xref="GOA:Q3B6F3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23078.1"
FT                   /translation="MASSSTEGQAAARGRKKSWTGKVVSDSMDKAIIVAVERRVQHPVY
FT                   KKYFKKTTRLMAHDEKNEAGMGDLVKVVECRPLSKRKSCRLVEIVEKAK"
FT   gene            193039..193407
FT                   /locus_tag="Plut_0191"
FT   CDS_pept        193039..193407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0191"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23079"
FT                   /db_xref="GOA:Q3B6F2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23079.1"
FT                   /translation="MIQKETNLVVADNSGAKKVRCIHVFGGTGRRYASLGDQVIVSVKA
FT                   AVPGGVVKKKEVCKAVVVRCVKEQRRKDGSYIRFDENAVVLLNAQGEPRGTRIFGPVAR
FT                   ELRDRRYMKIVSLAPEVL"
FT   gene            193418..193490
FT                   /gene="tRNA-Gly1"
FT                   /locus_tag="Plut_R0006"
FT   tRNA            193418..193490
FT                   /gene="tRNA-Gly1"
FT                   /locus_tag="Plut_R0006"
FT                   /product="tRNA-Gly"
FT   gene            193525..193767
FT                   /locus_tag="Plut_0192"
FT   CDS_pept        193525..193767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0192"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23080"
FT                   /db_xref="GOA:Q3B6F1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23080.1"
FT                   /translation="MKTGLKRVKLHVKKNDMVVVLSGNDRGKSGKVLRVYPVKNRVIIE
FT                   GVNIRKRHMRPTQSNPQGSIIEREFPIHASNVKKS"
FT   gene            193824..194408
FT                   /locus_tag="Plut_0193"
FT   CDS_pept        193824..194408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0193"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23081"
FT                   /db_xref="GOA:Q3B6F0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6F0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23081.1"
FT                   /translation="MAQKTETAIPSNSKARFETLYREKVTKALSERFGYKNVMNIPRLQ
FT                   KISINIGVGEAASEPKLLETAIQELAQITGQKPQIRKSKKAISNFKLREGQAIGCRVTL
FT                   RRKAMYEFFDRFVSLAVPRIRDFRGLSDTSFDGRGNYTIGVREQIIFPEIDIDKIPKIC
FT                   GMDISFVTSAKTDEEAYVLLAELGMPFKKKN"
FT   gene            194430..194699
FT                   /locus_tag="Plut_0194"
FT   CDS_pept        194430..194699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0194"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23082"
FT                   /db_xref="GOA:Q3B6E9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23082.1"
FT                   /translation="MAKKSVIARNEKRKRLVEQYAAKREELLKAGDYEALRKLPRDSSA
FT                   TRVRNRCVLTGRGRGVYEKFGLCRHMFRKLALEGKIPGVKKASW"
FT   gene            194760..195155
FT                   /locus_tag="Plut_0195"
FT   CDS_pept        194760..195155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0195"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23083"
FT                   /db_xref="GOA:Q3B6E8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23083.1"
FT                   /translation="MPVTDSIADYITRIRNAGRAKNKTTDIPYSKLRENISQLLQDKGY
FT                   IKNFTVITTEKFPFIRIELKYTASGEPSIKEITRVSRPGRRTYEGKDIKKYLGGLGLYI
FT                   LSSSKGVITDKEAREQGVGGEILFRIY"
FT   gene            195184..195723
FT                   /locus_tag="Plut_0196"
FT   CDS_pept        195184..195723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0196"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23084"
FT                   /db_xref="GOA:Q3B6E7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23084.1"
FT                   /translation="MSRIGKMPIAIGNEAKIEVKGGIITVTGPKGVLDQPMVEEVRIVE
FT                   EDGKVLVQRINDSKRARAMHGLYRMLVSNMIQGVTTGFTRKLEIAGVGFRAEMKSDLLA
FT                   LTLGYSHMIYFKAPEGIKMETPDQVTVLISGIDKALVGQVAAKIRSFRKPEPYRGKGIK
FT                   YEGEIIRRKEGKAAGK"
FT   gene            195771..196130
FT                   /locus_tag="Plut_0197"
FT   CDS_pept        195771..196130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0197"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23085"
FT                   /db_xref="GOA:Q3B6E6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23085.1"
FT                   /translation="MSKIDKASRRQKIKDRSRFSVAGTQEKPRLCVYRSLSQIYAQLID
FT                   DSGKKTIMAVSSMSKENKELKGSKTEVCHRVGKQIAEKALANGITNVVFDRNGFRYHGR
FT                   IKALADGAREAGLIF"
FT   gene            196152..196667
FT                   /locus_tag="Plut_0198"
FT   CDS_pept        196152..196667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0198"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23086"
FT                   /db_xref="GOA:Q3B6E5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23086.1"
FT                   /translation="MAKTAKGIRPGELNLKEKLVHINRTAKVVKGGKRFGFNAIVVVGD
FT                   KEGHVGYGLGKANEVQDAIAKGVEDGKKNVVKVPIIKGTIPHQIVAKYGSAKVLMKPAT
FT                   PGTGLIAGGAVRAVLEMAGVRDVLTKSLGSSNPHNVVKAAILGLKSISDANDVAERRSK
FT                   SLKEVFES"
FT   gene            196685..196870
FT                   /locus_tag="Plut_0199"
FT   CDS_pept        196685..196870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0199"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23087"
FT                   /db_xref="GOA:Q3B6E4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23087.1"
FT                   /translation="MSDKKLKITQVRSIIGGTKKQKATIQALGLGRPHYTVERKDNPCT
FT                   RGQIRVVQHLVKVEEV"
FT   gene            196905..197459
FT                   /locus_tag="Plut_0200"
FT   CDS_pept        196905..197459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0200"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23088"
FT                   /db_xref="GOA:Q3B6E3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23088.1"
FT                   /translation="MDLSSLRPAKGAVKNKKRVGRGQGSGNGTTAGKGNKGQQARSGYK
FT                   RPINEGGQIPVYRRLPKFGFTPIDRKSVTTVNLSQITRWIEQGLIENELGVIELKVLCH
FT                   ASNADYFKVLGNGEITAAVKITAHGFSKSAEAKITAAGGEAVTAVRTLEEAARVRDLAV
FT                   EEALLKPKTKLVKRVKKNQKP"
FT   gene            197478..198809
FT                   /locus_tag="Plut_0201"
FT   CDS_pept        197478..198809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0201"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23089"
FT                   /db_xref="GOA:Q3B6E2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23089.1"
FT                   /translation="MKLTESIRNINKIPELRQRILYTLLLLFIYRLGSHITIPGVDASA
FT                   VAGASSSHANDLFGLFDLFVGGAFARASIFSLGIMPYISASIIIQLLGAVTPYFQKLQQ
FT                   EGEEGRQKINQMTRLGTIFIAALQAWGVSVSLSSPSSFGHSVVPDPGFFFSLSAVIILT
FT                   ASTVFVMWLGERITEQGIGNGISLIIMIGILAGFPASLVNEYRSLSLGSKNWIIEIIIL
FT                   AMMVAIVAFVVLLTVGTRRVPVQHAKRVVGRKVYGGGTQYIPMRINTAGVMPIIFAQSI
FT                   MFLPSTFLSFFPDSEAMQSVASIFAYDSWWYALMFGTMIVFFTYFYTAIAFNPKEVADT
FT                   MRRQGGFIPGVRPGKSTADFIDNILTRITLPGAVSLALIAVLPTFLTKFANVTPGFAQF
FT                   FGGTSLLIIVGVGLDTLQQVESHLLMRHYDGFMKAGKTRGRQAR"
FT   gene            198824..199609
FT                   /locus_tag="Plut_0202"
FT   CDS_pept        198824..199609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0202"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23090"
FT                   /db_xref="GOA:Q3B6E1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23090.1"
FT                   /translation="MITIKSEREIELMRESGAIVARTLDMLETEIRAGMTTKMLDEMAE
FT                   EFIRSQDAVPSFLHYAPKGDPDATPYPATLCVSINEEVVHGIPSPKRVIKEGDIVSVDC
FT                   GALKGGYHGDSARTFIIGDVSDEVRQLVDETRESLMCGIRMAVAGNRLHDISSAVEQHA
FT                   RSFGYSVIENMVGHGIGSELHEDPAVPNYGRPNTGVTLREGMTLAIEPMIALGRSRRAV
FT                   SRRGGWVAVTEDGRPSAHFEHTIVVRKGAAEILTGSFLP"
FT   gene            199652..199870
FT                   /locus_tag="Plut_0203"
FT   CDS_pept        199652..199870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0203"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23091"
FT                   /db_xref="GOA:Q3B6E0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23091.1"
FT                   /translation="MAKEEAIEIEGVILEALPNAQFKVKLENSLEVLAHVSGKIRMHYI
FT                   RILPGDKVKVQISPYDISKGRITYRYK"
FT   gene            200136..200513
FT                   /locus_tag="Plut_0204"
FT   CDS_pept        200136..200513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0204"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23092"
FT                   /db_xref="GOA:Q3B6D9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23092.1"
FT                   /translation="MRIAGVNLPLNKHAVIALTHVYGIGNTTAKTILKRAGIAPDRKIS
FT                   DLNDAEAHAIRELVAEEYKVEGQARGEQQLAIKRLMDIGCYRGLRHRRSLPVRGQNTQT
FT                   NARTRKGKRKTVAGKKKAARK"
FT   gene            200561..200944
FT                   /locus_tag="Plut_0205"
FT   CDS_pept        200561..200944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0205"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23093"
FT                   /db_xref="GOA:Q3B6D8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23093.1"
FT                   /translation="MATVSRKKKKVKVTPEGVVHIKASFNNIMVTITDVQGNTVSWSSA
FT                   GKNGFRGSKKNTPYASQVTSEGAAKEAYDLGMRHVDVFIKGPGAGRDAAIRALQGAGLE
FT                   VRSIKDITPLPHNGCRPPKRRRV"
FT   gene            200982..201593
FT                   /locus_tag="Plut_0206"
FT   CDS_pept        200982..201593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0206"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23094"
FT                   /db_xref="GOA:Q3B6D7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23094.1"
FT                   /translation="MARFRGSITKVSRRLGVALSPKAEKYLERRPFAPGQHGQGRRGKI
FT                   SEYALQLREKQKMKYLYGILEKQFRNYYKKAVSQRGVTGDNLVKLIERRLDNVVFRAGF
FT                   APSRAGARQLVSHSHLLVNGRKVNIPSFLVSPGDLIEFRQKSRNMDAVTDALNRAPDAR
FT                   IPAWIQVDKANQKAVFLSVPERVDIQEPYNEQLVVELYSK"
FT   gene            201622..202608
FT                   /locus_tag="Plut_0207"
FT   CDS_pept        201622..202608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0207"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23095"
FT                   /db_xref="GOA:Q3B6D6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23095.1"
FT                   /translation="MIYQMQMPAKIEVDEATHTDQYGRFIAQPLERGYGVTLGNMMRRV
FT                   LLASLPGTAITGIKVDGVFHEFSSIEGVREDVPEIVLNLKKVRFKSTCKRSCKTTLSIV
FT                   GPKDFTAGDIVAQEGEFEVLNKDLYIATVNEGSTLNIDVYIGRGRGYTPAEESRPDSMP
FT                   IGYIAIDAIYTPIRNVKFAVENTRVGQRTDYEKMVLDVETDGSITPDDSISLAGRIINE
FT                   HVTFFANFSPTEEEFTEEEYKQQDDEFETMRRLLNTKIEDLDLSVRSHNCLRLAEIDTI
FT                   GDLVSRKEDELLNYKNFGKKSLTELKEQLEKFELKFGMDITRYQMKG"
FT   gene            202653..203171
FT                   /locus_tag="Plut_0208"
FT   CDS_pept        202653..203171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0208"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23096"
FT                   /db_xref="GOA:Q3B6D5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23096.1"
FT                   /translation="MRKVKPARKLGRTAAHRRATLSSLSTQLILHKRIETTEAKAKETR
FT                   KVVEKIITKALKGTVHAQREIFKDIRDKEAIKTLFGEVVAKVGDRPGGYTRIIKLCPRF
FT                   GDAAKMAVIELVDFAEAPVAAPKAAKQDRAKRVKGSKKVTGDVAPAVAPVPSAPAETQE
FT                   EAKAPESAE"
FT   gene            complement(203232..203948)
FT                   /locus_tag="Plut_0209"
FT   CDS_pept        complement(203232..203948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0209"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23097"
FT                   /db_xref="GOA:Q3B6D4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23097.1"
FT                   /translation="MKPKASHALRSPINTPIMDHDSEARQMLESLCASQGIALDPAQID
FT                   KLVYYGELLGEWNMKINLISRKEDAPVILKHVFHSLLISLHHPFTEGEKVLDLGTGGGL
FT                   PGIPLAIAFPKTDFLLVDATGKKITACQGMITALGLKNATALHSRVEELKGLAFDTVLS
FT                   RQVAPLADLARYARPLLKKGGMLACLKGGNLKKEIAEALREGAETDGFPSSVELHPIDD
FT                   ISPFFSEKQIVIAARQ"
FT   gene            204183..205304
FT                   /locus_tag="Plut_0210"
FT   CDS_pept        204183..205304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0210"
FT                   /product="mannose-6-phosphate isomerase, type 2 /
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23098"
FT                   /db_xref="GOA:Q3B6D3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23098.1"
FT                   /translation="MGKSIESGVYSLIMAGGTERELWPMSRSGMLKPFLDLFGDGPMIQ
FT                   NTIRRAARIARMEHVLVVTDGRGRDMLLASGVIIDPENIIVEPYARGTATCIALGAAHV
FT                   RKRDPDGVLVVMPSDHVILDEDAFQGILHAAIGEARRMESLVTIGIRPKSPEIVYGYIQ
FT                   AGEVLERPDAGDEGKGVTLYRVRIFAEKPDLATAIRFLESRDFYWNSGIFAADVETLFE
FT                   AYRRCLPDLYRDMLSVHDAIGTRKEELVVSALYSWSHPASIDMAIMEKTGDIVLLTGEF
FT                   GWHDPGSWDEVAALITERTVFSGEVGVPGVVAVGAENNFVIKPGGKVVAVVGASELIII
FT                   DTPDALLVCGREASYRVGEAVHLLRREGFEEHL"
FT   gene            complement(205317..206768)
FT                   /locus_tag="Plut_0211"
FT   CDS_pept        complement(205317..206768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0211"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23099"
FT                   /db_xref="GOA:Q3B6D2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23099.1"
FT                   /translation="MPLVIFNSLGREKQLFEPLHPGVVGIYVCGPTVYGHAHLGHAKSY
FT                   VSFDVVVRWLRESGYRVKYVQNITDVGHLSDDADEGEDKIARQARLEKTDPMEIAQFYT
FT                   RSFLDDMDRLGVLRPNISPLATGHIPEQIALVDKLVKRGHAYEVNGNVYFSVESFPGYG
FT                   KLSGRTDLDAVQSGARVGVRSEKHNPSDFALWKKAEEGHLMQWDSPWGMGYPGWHLECS
FT                   AMSMKYLGDTIDIHGGGMENRFPHHECEIAQSEAANEKPYVRYWMHNNMVTVNGTKMGK
FT                   SLKNAVNLKEIFKTVDPLAVRFFILQSHYRSPLDYSDTAVAGSTAGLQKLRETRQRLIE
FT                   ATPGTGLLDAAPFSLRFREAMDDDFNTPVAIAALFDFSKALNTALDRPDGLNASSLEAA
FT                   RELFSTAAVTVLGIMTEDAEGGMHDGGRSAETLDEVMGVLMELRSEARKNKDFATSDLI
FT                   RDHLLAAGIEIKDTREGASWSKTRH"
FT   gene            206924..207547
FT                   /locus_tag="Plut_0212"
FT   CDS_pept        206924..207547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0212"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23100"
FT                   /db_xref="GOA:Q3B6D1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23100.1"
FT                   /translation="MKIINAAFIRSVSALQDLPDERVPEIVFAGRSNVGKSSLLNSLTG
FT                   RKGLAKTSSTPGKTRLLNYFLINDDLYFVDIPGYGYAAVSHTEKDAWGRLLAGYVGGRQ
FT                   AIALVVLLLDSRHPAMESDREMMEFLAYHDRPYGIVLTKDDKLTQKERAKAKRVTASCA
FT                   LNAEFIVSYSSISGKGKKELLAHFDHYLSGESSGAGSDSAVTVT"
FT   gene            207648..208952
FT                   /locus_tag="Plut_0213"
FT   CDS_pept        207648..208952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0213"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23101"
FT                   /db_xref="GOA:Q3B6D0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23101.1"
FT                   /translation="MESKPFTLPSQSATVLIGTQFGDEGKGKLVDYLSDQYDIVVRYQG
FT                   GANAGHTICFDGKSVVLHLIPSGIFNEKCVCVIGNGVVIDPVALLEEIAKVEELGYTVK
FT                   GRLFISHNAHLIMPYHKRLDALHESAQGGQKIGTTGRGIGPSYEDKFARKGIRVVDLLS
FT                   PGLLQEKLRENLAEKNKLFRNIYEGDEIDVESMVREYEEFDKLMDPYITNTQLYLNRQL
FT                   RQGKTVLLEGAQGCLLDVDHGTYPYVTSSSPTSGGACTGSGIAPNHIGKVIGVCKAYMT
FT                   RVGNGAFPTELNDATGEMLGRVGHEFGATTGRKRRCGWIDLVAMRYSVAVNGITELALT
FT                   KLDVLDGFEEIKVCNSYMLNGKEIRDFPTDHQTLSAVQPVYTTLKGWMASNAAARTFEG
FT                   MCPEAREYVAFLERELEVPVTFISVGPGREETVFR"
FT   gene            208977..209288
FT                   /locus_tag="Plut_0214"
FT   CDS_pept        208977..209288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0214"
FT                   /product="Protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23102"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23102.1"
FT                   /translation="MALMDIAVIRLDQKDGSHSAFVAGLQELLADSGCSYRLHDMGTTV
FT                   EGPAAMLFRLAEQLHEYSFTRGGKRVYTVMRIDDRRDRAVRLGEKTASVKAKIAPRAE"
FT   gene            209375..210637
FT                   /locus_tag="Plut_0215"
FT   CDS_pept        209375..210637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0215"
FT                   /product="Light-independent protochlorophyllide reductase,
FT                   N subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23103"
FT                   /db_xref="GOA:Q3B6C8"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23103.1"
FT                   /translation="MLQVPGDVQILKEDNVTHSFCGLASVGWMYQKIRDSFFLILGTHT
FT                   CAHFLQNALGMMIFAKPRFGIALIEEGDLSKNEPTLDEVIAEIKADHNPSVIFLLSSCT
FT                   PEVMKVDFKGLADHLSTQQTPVLFVPASGLVYNFTQAEDSVLHALVPYCPVAPAGEKSV
FT                   VFLGSVNDATADDLRAEAEELGIKVGGFLPESRFDRMPAIGPDTILAPIQPYLSRVAVK
FT                   LERERGSRTLHSLFPFGPDGTRVFWEDLAREFGIEVDLRDREKAAWEKISRQTAMLKGK
FT                   KVFLTADTMMELPLGRFLRSAGAEVVECSSAYINKKFLAKELKALEGVRVVEQPNFHRQ
FT                   LEDIKRLRPDLVVTSLMTANPFVGHGFIVKWSMEFMLMPIHGWSGVITLANLFVSPLDR
FT                   RSKLPAFDKAVWLEGVMPAAE"
FT   gene            210676..212253
FT                   /locus_tag="Plut_0216"
FT   CDS_pept        210676..212253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0216"
FT                   /product="Light-independent protochlorophyllide reductase,
FT                   B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23104"
FT                   /db_xref="GOA:Q3B6C7"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23104.1"
FT                   /translation="MRLAFWLYEGTALHGISRVTNSMKGVHTVYHAPQGDDYITATYTM
FT                   LERTPEFPALSISVVRGRDLAQGVSRLPATLQQVEEHYHPELSVIAPSCSTALLQEDLH
FT                   QLAAQSGVPQDKLMVYAVNPFRVTENEAADGLLTALVKRYAAEGPKTAAPTVNLLGFTS
FT                   LGFHLKANLTSIRRLLTTLGVKVNVVAPWGAGIADLKRLPEAWLTIAPFREIGQTAAAY
FT                   LEETFGVPTEYGTPLGVEPTLRWLRAVIEKLNTVGAKEGATPIAMPELHAFSLDGMSAP
FT                   SGVPWFARTADMESFSNKKAFVFGDATTTVAMVKFLRDELGMQIIGAGTYLERHADWVR
FT                   KELDGYLPGALMVTERFQDVAQVIEDEMPDLVCGTQMERHSCRKLDVPCMVVCPPTHIE
FT                   NHLLGYYPFLGFDGADVIADRVYISCKLGLEKHLIDFFGDAGLEYEEPSASSENGSAPL
FT                   SAGTATPAAAPEEGGMAWTDEAETMLKKVPFFVRKKVRKNTENFAEENGESRVSVEVFR
FT                   RAKESLGG"
FT   gene            212289..213119
FT                   /locus_tag="Plut_0217"
FT   CDS_pept        212289..213119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0217"
FT                   /product="Light-independent protochlorophyllide reductase,
FT                   iron-sulfur ATP-binding protein"
FT                   /EC_number="1.18.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23105"
FT                   /db_xref="GOA:Q3B6C6"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23105.1"
FT                   /translation="MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST
FT                   FPITGKLQKTVIEALEEVDFHHEELTAEDVIETGFAGIDGLEAGGPPAGSGCGGYVVGE
FT                   SVTLLQELGLYDKYDVILFDVLGDVVCGGFSAPLNYADYAIIIATNDFDSIFAANRLCM
FT                   AIQQKSVRYKVKLAGIVANRVDYAKGGGTNMLDQFAEKVGTRLLAKVPYHELIRRSRFA
FT                   GKTLFAMDDSEEGKEECLQPYLQIAEDLLSEAPMSSVPVPIGDREIFEIVGGWQ"
FT   gene            complement(213247..213819)
FT                   /locus_tag="Plut_0218"
FT   CDS_pept        complement(213247..213819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0218"
FT                   /product="Bacteriochlorophyll 4-vinyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23106"
FT                   /db_xref="GOA:Q3B6C5"
FT                   /db_xref="InterPro:IPR010249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23106.1"
FT                   /translation="MSTSFRIGPNSIIQTVAALEASFGKAQAEELLKKIGHSHLIGNLP
FT                   SEMVEESKFHALVTALDTEIGSQKTGAILEESGSRTAQYLLRVRIPGLFQKFLKLLPAR
FT                   PAFNLFLFAISKNAWTFAGSGDFSYTNAKKPTITVVVTHPSVPVVGSFYLGTFTYLLEQ
FT                   LVNPAVKIRADVRQEGESITCRYTCSI"
FT   gene            complement(213816..215525)
FT                   /locus_tag="Plut_0219"
FT   CDS_pept        complement(213816..215525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23107"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23107.1"
FT                   /translation="MKGTTHILKALLILLAVGTAGCASDKPPTGGLPDPTPRQVFFSDP
FT                   DSGAVNISPRKIRFLFSHLTTARELLYSLHFSPQVDNYHVTVNGMEGEIDIFSPLRPNQ
FT                   TYIVTLNKRLFESYTLPFSTGPQIDTSLVRGRVFNEDMTPSASAFVLAYRLRDGEKRAP
FT                   DMRQAKPDYLAQTDGSGNFSFRHLKKGAYSLLAVNDSNGDMRWDRHREAIGITTAAVVH
FT                   PDTTRHIIRMGGIDSETSGMSACRPLERNRLELTFTSPVDVATFNPGAVTINNPRTGKS
FT                   VPVLDWFSSTGSSVSRRITILTGRLDTGGPSLISIHGREGQAISFWPTRHTVEKLPIRV
FT                   TFSPADKSRPGYQGADIPCSPEAVVLRFSEPVPETIVGSAASLSIEGDDSPVTLDCLLK
FT                   KIDAKTFTLRPREGFRPGATYRASVDSALVNGIEVRPGAKRTTFSRFTAASPDDMGSIT
FT                   GSCRASGGPVIVEARGTATWRTEATRDATGRYVYAFPGLPPGSYALSAFIPSMAKKGGA
FT                   CMQQPYPGTLFPFTPADPSAVHEGSVRVRAQWTAENIDITFTNEKTDRNPTP"
FT   sig_peptide     complement(215454..215525)
FT                   /locus_tag="Plut_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.668 at
FT                   residue 24"
FT   gene            215653..217122
FT                   /locus_tag="Plut_0220"
FT   CDS_pept        215653..217122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0220"
FT                   /product="Glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23108"
FT                   /db_xref="GOA:Q3B6C3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23108.1"
FT                   /translation="MSRRNYKVLYVSGEVSPFVRTSALADFMASFPQALEEEGFEARIM
FT                   MPKYGTINDRKFRLHDVLRLSDIEVPLREKTDMLNVKVTALPSSKIQTYFLYNEKYFKR
FT                   NGLFTDVYLGNDLKGNTEKVIFFNVGVLETLVRLGWKPDIIHCHDWYASLIPLLLKTVY
FT                   RDHEFFKGIKTVLTIHNAYRQGVLPFKVFEKLLPEEVSGALHRSAENVNMLYTGVENAD
FT                   MLTTTSKLHADEILHDEIPGCGLQQILAGQNGILHGIVNGIDTRQWNPSTDKLIKKRFA
FT                   TDRMDGKLDNRAALSEEVHMPFEDGRPVVGVIMHFDDFQGAVLIEKSLKKLVALDIHLL
FT                   ICGAGDKKYEKSFRDFADAHPDRVSLSTDCPESFLHLAIAGLDMLVMAGKIESCGMLQM
FT                   FAMSYGTIPVAYAGGGIVETIDEVSEGGGSGFIFREYTPDALVSKLHEAIGLYHDSERW
FT                   QELVMRAMTRDFAWKGAAEEYAGLYRELLGN"
FT   gene            217126..217710
FT                   /locus_tag="Plut_0221"
FT   CDS_pept        217126..217710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0221"
FT                   /product="Histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23109"
FT                   /db_xref="GOA:Q3B6C2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23109.1"
FT                   /translation="MTETIKVLFLDRDGTINEDTGSYVATRPQLKLIARAGEAVALAKA
FT                   AGFRIVIISNQAGIARGIATVEQVEDVNLYLNELLTEAGASFDRCYYCPSHPQHPHPEY
FT                   DRFAGCRKPETGMVERAIADFKAEGLTVDRDASFFIGDKLIDVECGLRASLHPILVRTG
FT                   HNEEEICRRLGVVPEFVADDLYEAVTAHILR"
FT   gene            217752..218867
FT                   /locus_tag="Plut_0222"
FT   CDS_pept        217752..218867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0222"
FT                   /product="Putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23110"
FT                   /db_xref="GOA:Q3B6C1"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23110.1"
FT                   /translation="MLSLYVHIPFCRKRCPYCDFYLVSGTGLLESFFLALEKETAAKAD
FT                   LFKAQSIGAIHFGGGTPSLAPARLLGRWLEQVAGLASFEEGIEIALEANPEDAAALPEL
FT                   SQAGVTRISLGVQSFSASKLRALGRAHSPVEGAEAVRAASALFGSLSVDLICGVPGEDL
FT                   PAWQSDLSTAISLSPHHVSVYMLSVEPKTIMHRDVQAGSVSVPGDALQADCYRHAQNVL
FT                   PAAGFVQYEISNFALPSHQSRYNLASWERQPYIGFGPSAHSFIRSPSGEVRMANTPSLS
FT                   DYLLRPGSAEGFREELGGRERFIEEVFLTLRINRGLDVGFLRKAHKLGHRLSEAVAQFN
FT                   AKGWMREEGGKLYLTDEGFLFADLMAEEFIP"
FT   gene            218889..221534
FT                   /locus_tag="Plut_0223"
FT   CDS_pept        218889..221534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23111"
FT                   /db_xref="GOA:Q3B6C0"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23111.1"
FT                   /translation="MTHRAVNRSIAALLFVLTGAVYLLTMAPTLSFWDCGEFIATARTL
FT                   GVPHPPGAPLFLLTGRLFSMLPFFGDVGARVNLISVLSSAATISLTYLITVRLIILYRG
FT                   TAPTDWDGAEKTAAYGGAVIGALALAFSDSFWFNAVETEVYAASSLFTAVVVWLILRWY
FT                   EEYPREGHERWLLLAMYMIGLSIGVHLLSLLALFAIALAYYFRRFEVTLKSLAILALAS
FT                   SGLFFLIYTLIIKGIPVLLQIASWGGLLVLLSALGWAAWQTQRARMAMANTLVMSVLLI
FT                   IIGYTSYGLIYVRAQAGPPINENNPSTPDAFFSYLNREQYGQMPLWPRRWSPEPLHQYH
FT                   YQQYGSELDYFLSYQLDRMYLRYLGWQFIGRQDQMEGAGVDWSVLWGLPFLLGLGGAFA
FT                   HFRRQWKMGLVVTALFILTGAALVVYLNQTEPQPRERDYSYVGSFFAFALWIGIGIESL
FT                   WYGTVSLLKKPGSSTRLLAALVTVGLAVMLVDARMLMANYHSHDRSGNYVPWDWGWNIL
FT                   ESCPPNAILFTNGDNDTFPLWYLQEVEGIRTDVRVVNLSLANTGWYLLQLKNTSPRGAE
FT                   RVSFGLTDEELRNITYVPIEPVAVSLPSRDAARALKADAERHRYTLPSAPLDTMRWELK
FT                   PGLVYGGQGYLRPQDLAVYDIVTQNFGRRPLCFALTVDPDGMIGLERFLRLDGLVYRVV
FT                   PLQSPDPMSFADPALLYRNLMQTYRYRNLGNPSVNIEETARRLSANYSPLFIRLALELA
FT                   GSEGAALPVRDSSGHEYFVQRRVLALRVLDRATSMLPPGRYPLNPELAGSVVSLYVRLG
FT                   EKDRASAYISYLEKLGSLSSPGSDPRLFFTLAQAYRALGRIDEANRVIDTLSHVLNRPG
FT                   LAKEFEQMKE"
FT   sig_peptide     218889..218966
FT                   /locus_tag="Plut_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.604 at
FT                   residue 26"
FT   gene            221541..222338
FT                   /locus_tag="Plut_0224"
FT   CDS_pept        221541..222338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0224"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23112"
FT                   /db_xref="GOA:Q3B6B9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23112.1"
FT                   /translation="MQKSIHPTAVIAETAVLGDGVTVGPYTVIEDDVTIGEGTTIAPHV
FT                   QIASGARIGAGCRIHAGAVLATEPQDLKFNGEKTELFIGDRTVIRECVTINRGTMASGK
FT                   TVVGSDNLIMSYVHFGHDCVIGNHVVVANSVQFGGHCEVGDYAVVGGLAGIHQFVRIGR
FT                   YAMVGGISRAALDVPPFVMAGGHASFRYEGLNAIGLKRRGFTPEKITRIRDIYRVLFQS
FT                   GLLLSNGLEKVRQEFPEEPEVMEILDFFSSGTHGRKFIRPFNS"
FT   gene            222357..223346
FT                   /locus_tag="Plut_0225"
FT   CDS_pept        222357..223346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0225"
FT                   /product="glucokinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23113"
FT                   /db_xref="GOA:Q3B6B8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23113.1"
FT                   /translation="MSQWAIGIDLGGTAVKAAVAGRTAGIITETTVPTEALQGSSGVLD
FT                   LIAATAADLYRSASVTLDPAEFRGIGLGAPGAVDCLRGTLSHPPNLPGWEVIELRRELQ
FT                   QRLHSGPGIDCEVFLDNDANAAAYGEAVYGAGRAFPDFLMVTLGTGVGGGIVLNHKLYR
FT                   GPNGTAGEVGFMIVDYNGSSLHAGIRGTLEGLIGKDRLVEMARRMIAEHPSPSSVGALC
FT                   GNDWASLSPRHLETAALEGDLAAKDVWTRVGSILGTGLASVTALMDIRKFVVGGGISAA
FT                   GDLLLKPALAALQRSTLPSMHDGLSVVRAELGNRAGMHGAAALCFSGE"
FT   gene            223343..224053
FT                   /locus_tag="Plut_0226"
FT   CDS_pept        223343..224053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0226"
FT                   /product="competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23114"
FT                   /db_xref="GOA:Q3B6B7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23114.1"
FT                   /translation="MMGGAFGNEMLHLLFPDVCVVCSALLGEGEEMCCNTCRQEFSPFA
FT                   SPLESETMLRASIAGRFGSGFVFRQGWCRYLFHKGSPLQEALHMMKYGGVHALGGVFGR
FT                   ELGEWMLVGSGGEVVVDCIVPVPLHRMKKTERTYNQAEKIAEGIGAVMATPVMGKLLVR
FT                   TRHTVSQTGLAAVDRRKNLAGAFRASGVTGGARVLLVDDVVTTGSTMAAAAEALIEAGA
FT                   GSVSLAAVALAAKE"
FT   gene            224065..224808
FT                   /locus_tag="Plut_0227"
FT   CDS_pept        224065..224808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23115"
FT                   /db_xref="GOA:Q3B6B6"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23115.1"
FT                   /translation="MELFYVPEGSVAASVRSLMIEGDEFHHLSRVLRKKEGEHIRVTDG
FT                   SGLSLEVLITSVGKRSLEGEILARSVVERPATGVTVAISLLKAPARFDFFLEKATELGV
FT                   SGVIPMMTQRTVSQPPRERFKGRMERWRNIMLSAARQSGRFHLPVLHEPLSFREALGLK
FT                   GYDLRLIPYEGSGVVPELDFPGKKVLFLIGGEGGFTPGEVEAASETGFREMSFGRSILR
FT                   AESAGIFAVALVRTRLLAGPPSEWL"
FT   gene            224846..225916
FT                   /locus_tag="Plut_0228"
FT   CDS_pept        224846..225916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23116"
FT                   /db_xref="GOA:Q3B6B5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23116.1"
FT                   /translation="MNSIKANRIILLLIVLFISALFFAMIRYFLMAIFLAAIFSALSMP
FT                   VHNRFLQWTGGRKGLSAGLTMLALILIGFLPLALLLGVVALQAVHISSQAVPWLKQILE
FT                   PAFLADQLRTLPYYPELVAYREDILQRVGEIVSNTGSLLFKKLFSFTYSAVNELFLFMI
FT                   FLYTMFFFLRDGKPLLERVLYYLPMSDADQQRLLDKFLSVTRATIKGTMIVGVVQGGLA
FT                   GMALHLGGIESALFWGTIMTVLSVVPVLGPPIIWVPAVISLAASGRFPQAIGVALFCAI
FT                   VVGQIDNILRPILVGRDTRLHELFIFFGTLGGIGLFGLFGFIIGPIIAALFMTVWEMYG
FT                   EAFSDSLRDIKTRSAV"
FT   sig_peptide     224846..224977
FT                   /locus_tag="Plut_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.835 at
FT                   residue 44"
FT   gene            complement(226016..226438)
FT                   /locus_tag="Plut_0229"
FT   CDS_pept        complement(226016..226438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0229"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23117"
FT                   /db_xref="GOA:Q3B6B4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23117.1"
FT                   /translation="MERTLTILKPDCVKKQLIGAVINQIERAGFRVVAMKKTRLTKETA
FT                   GEFYAVHRERPFYGELVDFMSSGPCVPMILEKANAVADFRTLIGATDPAEAAEGTVRKL
FT                   YADSKGENIVHGSDSAENAAVEAGFFFAAEEVVRSN"
FT   gene            complement(226527..226973)
FT                   /locus_tag="Plut_0230"
FT   CDS_pept        complement(226527..226973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0230"
FT                   /product="bacterioferritin comigratory protein, thiol
FT                   peroxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23118"
FT                   /db_xref="GOA:Q3B6B3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23118.1"
FT                   /translation="MIATGTPAPDFTLPDSEGRMVSLSSFRGKKVLLVFYPGDDTPVCT
FT                   AQLCDYRNNVSEFTRRGIEVLGLSADSSESHKSFAGRHQLPFTLLSDSEKEVATAYGAI
FT                   GFLGMSQRAYVLIDEEGTVQLAYSDFLPITYQPMKDLLLKIDEA"
FT   gene            complement(226970..228334)
FT                   /locus_tag="Plut_0231"
FT   CDS_pept        complement(226970..228334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0231"
FT                   /product="CBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23119"
FT                   /db_xref="GOA:Q3B6B2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23119.1"
FT                   /translation="MPPELLEALILACLIAANGFFSMAEFAIISSNATRLHELREAGNL
FT                   SAGTALRLLENPGRFLSAIQVGITLISTFAGAFSGLAFAGPVAAMIAGVPSLAAYAGEL
FT                   AVATVVIGVTFFTLVIGELAPKKIALQHPERIALKIAGAIDMLCRFSAPAITLINGTTN
FT                   LVLKAIGIESSEKPLVSDEDVMLLIRQGAKKGIFESVEYDMVSRIFRLSDKRASAMMTP
FT                   RSETDWLDLEKSDSELTATIMASGRSRFPVGEGSLDHLMGVVRSVDLVSFELSGRGGMK
FT                   DAIRASMKPPLFVPESVPAFHVLELFRKNRVHMALVIDEHGSVEGTITLTDVLESIVGD
FT                   VPADDLERDEKRILRRSNRTWIIDGLLPVDEFLAAFSLEADDFSEEKEAPYETMGGFMM
FT                   TRLGEVPAVSDTLRWHNIQFRVIKMNGQRVGRILVEFDTETAEKINRKPGQTGIQ"
FT   sig_peptide     complement(228260..228334)
FT                   /locus_tag="Plut_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.773) with cleavage site probability 0.485 at
FT                   residue 25"
FT   gene            228439..230577
FT                   /locus_tag="Plut_0232"
FT   CDS_pept        228439..230577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23120"
FT                   /db_xref="GOA:Q3B6B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23120.1"
FT                   /translation="MRKIYAKNIYTNHIHISTGSWRLQSMGIRRKGWLFLPIFFFILAS
FT                   CGSGIEDAGLPSELYRQAREHSHRGEYQQALGCYARGLEGENLSEPSFEAVRALNEKRS
FT                   LEGLTGSYAAAFATTDLLAGLPKGSLTDSLRTSMAVDRSRWLGELGQLKEAADALDTLK
FT                   SLLPEVRLQQASYALRGGFIDRAEGIYGSLVSSQGDPIIQMHAWSGLLQCGARRPGVVE
FT                   NDLLDMARKIVALSGRVMSTKDRTVERVQALRHAASSLQLTQKHRRDASFLLFRALSIA
FT                   GESGRPFLVEVLRLESNAAIVRKSDPFRESASYFEMKNMPYAEAMAKFMLSGSEGVDPE
FT                   ERTTALQGGFVAARDAAPPWPRPWMRQLERDALFQLNGQLLANSRIFELFDASQQSSML
FT                   RLSRALLRRADLFRPKGAEPDTMMAEVRTLLQNMGGLRQRKVDMLVNAGGEERRRAADR
FT                   SLNMQYGRLLELLSSLRISHPVAAEVLSFNPVTLRTVQHALKDDEVVLAPVLSDSLAAL
FT                   LVIGRRNVQIASSRLPFDSEHPAASLDLNLRRELGASSSPEAMRGGEWEWFARSMEQPA
FT                   REAVKNYRRVIVVSDALLPLHLFDGVGNPSSGRQVSFLHSYRELVILRANEALPPAASE
FT                   ICFYDADDQDGPAAHKMFFPRDRVFIIWKPYGEEALEEMKREIGTSMQETVSGAAALQA
FT                   LRRDNPRKWAAVSAYGVQ"
FT   gene            230752..231450
FT                   /locus_tag="Plut_0233"
FT   CDS_pept        230752..231450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23121"
FT                   /db_xref="GOA:Q3B6B0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23121.1"
FT                   /translation="MQEPLSGSSILSRVANDLKAARMQRGLSLDETSRILSIQKSHLEK
FT                   LEAGDFTFFPGAYVLAYIKEYLHEMGLGDEDLLDSCRKELSVSTGLKRHAVPEGAAREA
FT                   ARAFGTSKLQLVFDFVFSRRKSMALVAGALLLAAVFAIVFRFLPSREARLSTVPAAPAE
FT                   LLPDSSSVPSAAESVEPALPAVAASLPAPVAHAAVPAHAKLPTPPPPVPVDAAAESRSE
FT                   ELAIPPAPAQ"
FT   gene            231752..232696
FT                   /locus_tag="Plut_0234"
FT   CDS_pept        231752..232696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0234"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23122"
FT                   /db_xref="GOA:Q3B6A9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23122.1"
FT                   /translation="MKIYDDITATVGETPLVRLGRMSEGCRATVLVKLESFNPMSSVKD
FT                   RIALAMIEDAEQSGRLRSGTTIVEPTSGNTGIGLAFACAAKGYRLIIVMPDTMSVERRR
FT                   LMEIFGAELVLTPGTGGMKQAIMEAERLAGEIPGSLMLQQFQNPANPAMHRRTTGEEIW
FT                   RDTDGSVDVFVAGVGTGGTITGVGQFLKEHKPAVRIIAVEPSDSAVLSGGEPGPHKIQG
FT                   LGAGFVPAVLQREVIDEVITVGSQEAGAAARELARREGILAGISSGAALVAALRVAKRP
FT                   EMDGKTLVVLLPDSGERYLSTWLFDETGDGVRA"
FT   gene            232757..233953
FT                   /locus_tag="Plut_0235"
FT   CDS_pept        232757..233953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0235"
FT                   /product="IscS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23123"
FT                   /db_xref="GOA:Q3B6A8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23123.1"
FT                   /translation="MKVYFDNNATTPLHPEVKKEMTAAMEMYGNPSSMHAYGREAKANV
FT                   EDARQRVASFINADDREIVFVGSGSEANNTVLSLFVCASAQCIPGTTARGTIITTKIEH
FT                   PCVLETSECLMHRGVNVKFLDVDRYGRVDLDQLKDMLNDDIGLVSVMMANNEIGTMQDI
FT                   AAITNMVHECGAFMHTDAVQAVGKVPVDVRALGVDFLTMSAHKIYGPKGVGALYVKQGT
FT                   PYCPLIRGGHQERGRRAGTENTLGILGLGKAVEMRALEMHDEHDRLLGLKELLRKGIED
FT                   KIDDIHFNGHPTESLAGTLNVSFPGAEGESILLYLDLEGIAVSTGSACASGSLDPSHVL
FT                   LATGVDAERAHGSIRISLGRESTTQHVQHMLNVLPGVIERIRNMSTAYIKGGTHAASR"
FT   gene            233937..234548
FT                   /locus_tag="Plut_0236"
FT   CDS_pept        233937..234548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0236"
FT                   /product="IscU protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23124"
FT                   /db_xref="GOA:Q3B6A7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23124.1"
FT                   /translation="MLQAGEWAYSEKLKEHFMNPKNILQGEETDQFDGVGMEGNLQCGD
FT                   QMMVVIKVDREKEIITDCQWKTYGCASAIASTSILSEMVKGMTLTEAFNVSPKDVAKEL
FT                   GGLPENKIHCSVLGDKALRAAINNYYVRNGMEDRVLEEKAKIVCQCMNITDHDIEEAVL
FT                   EGARTYFELQERTKLGTVCGQCKDEAESLLEKFKHLHFGA"
FT   gene            234560..235900
FT                   /locus_tag="Plut_0237"
FT   CDS_pept        234560..235900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0237"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23125"
FT                   /db_xref="GOA:Q3B6A6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23125.1"
FT                   /translation="MPEGRRFYIQTFGCQMNEADSGIIARVLLDAGFRRADTEQDADVV
FT                   LLNTCAVRENAVEKIAHLLEHLKGAKKRRKTLQVGVLGCVPQHQREEMFSRFPAIDFIA
FT                   GPDSYRRLPSLIDDAASAVRSAMLDFDPSETYVGIRQVREGRISAFIPVMRGCNNMCAF
FT                   CVVPFTRGRERSQPLAMVTGEARELAEAGYREITLLGQNVNSYSDPASGATFSALLDAV
FT                   ALAAPDVRIRFTTSHPKDISVGLIDTIARRPNICRHVHLPVQSGSDSVLRRMNRGHGIS
FT                   EYLEKIRIIRDALPGVTLSTDIIAGFCGEREEDHRATLDLLRTVRFDAAFMFHYSTREG
FT                   TLAARTLPDDVAETDKKRRLQEIIDLQQEISAENNRRQVGTVAEVLAESESRRSPGRLL
FT                   GRTDGNRAVVFDRGECMPGDLVRVRLTSSTSATLSGSREGLIRAFLS"
FT   gene            235977..236981
FT                   /locus_tag="Plut_0238"
FT   CDS_pept        235977..236981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0238"
FT                   /product="chlorophyll synthase"
FT                   /EC_number="2.5.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23126"
FT                   /db_xref="GOA:Q3B6A5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23126.1"
FT                   /translation="MPSTPGTGFINKIKAHLELLDPVTWISVFPGLACGAMASGAMQAT
FT                   PHDYLVLFAVFLMYGPLGTGFSQSVNDYFDLELDRVNEPTRPIPSGRLTKQEALLNCII
FT                   VVLLAMGLGIWLGIDTGGMRGMVITTMIFSALFVAYIYSAPPFKLKKNIFASAPGVGFS
FT                   YGFVTFLSGNALFSDIRPEVVWLAALNFFMAIALIIMNDFKSVEGDREGGMKSLTVMIG
FT                   AKNTFIVAFAIIDMVFAVLVWLAWSWGFMVPMALVVLGLVLNIVIQIQLLADPKGGVSF
FT                   LKGTVEDGFGNAIGKSDVQEHNTFLRFQVANNVLFLVNNLVLAAMIGIRYMPS"
FT   gene            237032..237715
FT                   /locus_tag="Plut_0239"
FT   CDS_pept        237032..237715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23127"
FT                   /db_xref="GOA:Q3B6A4"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23127.1"
FT                   /translation="MDTLQHNALVALLTFVYVFSVPPLMDFFVSRHGLPRDISRKITHI
FT                   SAGSVIIFLPLFQDGDWTQYLNVSIFVVWAILLVQKGLFAAEDDQAVKTMTRTGDRREL
FT                   LRGTLYFVVVATLCGTLYYKQFEGVLAMAVLGWGDGLAPIIGTRFGRLKYHVLSPKSVE
FT                   GSLAFFAGSVAAGLFFVNLIVPEAYDPAKIVLISFIATVVEGVCPREVDNIAIPVAVIA
FT                   AASFL"
FT   gene            237739..238467
FT                   /locus_tag="Plut_0240"
FT   CDS_pept        237739..238467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23128"
FT                   /db_xref="GOA:Q3B6A3"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23128.1"
FT                   /translation="MRVLYFISDIHLGLQEEPEERRKLEALSRLFAEIRRTGGALYMLG
FT                   DVFDYWMEYRHVVPKGFTGFFCLLSGLVQAGVEVTYLAGNHDFHLGTFFDRELGVKTRY
FT                   GTYQFDADGRHFTVAHGDGLGEGDLGYRLFAKFIRNPFNLGLLTGFHPDLATGLMKRLS
FT                   RLSRKHKPGDRAMETDRLLDYAHALVKERSMDYFLCGHNHAGGVYELEGGARYVNLGSW
FT                   IDGRFPYAVYMDRLMQLKEL"
FT   gene            238485..239369
FT                   /locus_tag="Plut_0241"
FT   CDS_pept        238485..239369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0241"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23129"
FT                   /db_xref="GOA:Q3B6A2"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B6A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23129.1"
FT                   /translation="MTNSNKVLKLGLPKGSLQDSTLDLFAHAGFHFSVQSRSYFPSIDD
FT                   DELEAILIRAQEMAHYVQLGAFDVGLTGKDWIIETDADVVEVADLVYSKASMRPVRWVL
FT                   AVPESSPVKTVKDLEGKHIATEVVNITKKYLAANGVNASVEFSWGATEVKPPDLADAIV
FT                   EVTETGSSLRANKLRIVETILESNTKLIANRQSWEDPWKREKIESMALLLQGAINAQGK
FT                   VGLKMNAPKSALEKITSIIPALRQPTVSHLANDQWVALEVIVTEKIVRKLIPELKRAGA
FT                   EGIFEYDINKLID"
FT   gene            239468..240604
FT                   /locus_tag="Plut_0242"
FT   CDS_pept        239468..240604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0242"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23130"
FT                   /db_xref="GOA:Q3B6A1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23130.1"
FT                   /translation="MLLFYQILVLLALIIFLAIQLANLLELRPLPPGGPGGGKVSVLVP
FT                   ARNEERSIARCVQSLLMQDYPDFEVIVLDDASTDATLSILQALEAESCGRLRVLRGAVL
FT                   PEGWHGKSWACRQLAEKASGEMLLFTDADTFHRPQALRRAVTALQEGRGDMLSITPRQE
FT                   LGSFFEHLVVPLVYVILMSYLPLRLVRTLRNPAFCFANGQFILFRREFYWKVNGHEAVR
FT                   DALVEDVWLCMAVKKAGGRVLSFNGTDALSCRMYRNFREVWEGFSKNVFAGLGSSIPGL
FT                   AAFVLFTAAFHLAPWGFLLYALFVGASGPALVLLPLLQLAVALSGRVLVARRFDQPTAL
FT                   TLLDPLARGLLLAIALNSLREARWGGGALWKGRRYRFS"
FT   sig_peptide     239468..239536
FT                   /locus_tag="Plut_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.568 at
FT                   residue 23"
FT   gene            240642..241649
FT                   /locus_tag="Plut_0243"
FT   CDS_pept        240642..241649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0243"
FT                   /product="WD-40 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23131"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B6A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23131.1"
FT                   /translation="MVNNGFSTINSTRICLMGFLSKIFGKKEEVLELPKVREDANLQKT
FT                   LEGHLDRVLGVKFSADGKTLLSGGFDELVMLWDVETAKPIFTMKGHETWVECIDYSRDG
FT                   RHLASGSTDSTVRIWDASNGQCLHVCKGHDTAVRMVAFSPDGKTLASCSRDTTIRLWDV
FT                   ESGACRSVLNGHKSYIECLAYSHDGQKLVSCGEEPVIKLWDAASGKNIANYETGDTLSH
FT                   TVLFSPDDRTIALAGRNSKIRILDASDGSLIRVLEGHHDAVRGLAYSPDGHYLASVSND
FT                   ESLRLWNTADGRHLHTYRGHVLEVQSVDISPDGKTIATGSDDRKIKLWALTDTL"
FT   gene            241840..242049
FT                   /locus_tag="Plut_0244"
FT   CDS_pept        241840..242049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0244"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23132"
FT                   /db_xref="GOA:Q3B699"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B699"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23132.1"
FT                   /translation="MDNQVEGTVKWFNEEKGYGFIQQGEGKDVFVHYSAINGSGRKTLV
FT                   EGQKVSMEVTQGEKGLQAANVTPL"
FT   gene            242134..242829
FT                   /locus_tag="Plut_0245"
FT   CDS_pept        242134..242829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0245"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23133"
FT                   /db_xref="GOA:Q3B698"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B698"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23133.1"
FT                   /translation="MRSRQQRMGVRHCRFSGGQPAVMPLFRATEMDIILLDIGNVLVTV
FT                   DFMSFCHGVAVTGPTVPAEIFRKFCSGPIKNRYDKGLIGSGAFLAELAADPLVRPMPEA
FT                   ELIERWQGIFSPFPGADDGVAALETQGRIWIMSDTDPLHFASLHHAFPLLHGRERYYLS
FT                   FRHGFLKSSPSAFIHVLGDSGVDAGRCILIDDREDNCRAAGEAGIRSVLFTSWPQALAA
FT                   LPSDDGGAP"
FT   gene            242826..243230
FT                   /locus_tag="Plut_0246"
FT   CDS_pept        242826..243230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0246"
FT                   /product="release factors family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23134"
FT                   /db_xref="GOA:Q3B697"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B697"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23134.1"
FT                   /translation="MSGVRVSPDEVELRFMRSGGAGGQNVNKVETAVHLSFDIAASSLP
FT                   EAVKERLLLRRDRRISRDGVLVIKAQRFRSQEKNREDALLRLQAVVDGASEEPARRKVT
FT                   RRTKSSTVRRLEEKGRHSEKKALRGKVDKE"
FT   gene            complement(243237..244586)
FT                   /locus_tag="Plut_0247"
FT   CDS_pept        complement(243237..244586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0247"
FT                   /product="peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23135"
FT                   /db_xref="GOA:Q3B696"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B696"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23135.1"
FT                   /translation="MHLLNELVRNVSAKLAHLKQNTTPAFWLPFLAGTLVIVFFVLTLL
FT                   PGFGSYVDELGVTGESQTVQIDETSREPETCVSINTIRSGQSIYTILQSEGVTPAEIHT
FT                   ISQGLKGIFRPRSLRPGKTYETEKDSAGRLLRFSYFQDRATVIHVSRAAQTDPFHIEKE
FT                   LKEYSTRTVALEGVVEKSLSASLTGLGRSGLLPGMKKLLSSRVDLRRDIPPGSTYRVLF
FT                   EEKWLEDDFISSGRILAVEINLKGTTYSAYSYTNNKGENGYYDERGHSVERIARFAAPC
FT                   GYSRVSSRFGYRTHPIFRTRHFHGGVDLVAQTGTPVRATAAGRVIFKGPKGGAGNMVTI
FT                   AHSGGDHSQYLHLSRYAVGTRYGKRVKQGDIIGYVGSTGNSTGAHLDFRIIHRGKPINP
FT                   LTALRSTSSRTIAKVDMMNFLAEVNMLRAKLDDRTIFIAGSAKSSGEPVM"
FT   gene            244719..245450
FT                   /locus_tag="Plut_0248"
FT   CDS_pept        244719..245450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B695"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23136.1"
FT                   /translation="MSSTADGPELIPGIYHYCDRWCRRCPFTDRCLQFRLESEKRKTHL
FT                   SLERLDVFGLPFWHELARGLEQATRLIHDATASTAKGAPGGTPFTEEEPVPAPSRRSAR
FT                   AHPLAHASLTYLGMVDDWFRDADAEERHISPAEDAVQVIRHYQYLIYPKIVRAIDGRMH
FT                   ALSPDDPAAKRDSEGSAKITLLAIDRSLAAWSILYGAHPGAEDGTIEILLHLDRIRRSL
FT                   AVIFPDARDFMRPGFDTEVLT"
FT   gene            245484..246407
FT                   /locus_tag="Plut_0249"
FT   CDS_pept        245484..246407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23137"
FT                   /db_xref="InterPro:IPR029433"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B694"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23137.1"
FT                   /translation="MLNTNADRLVEFLLQCNPGQPRTRGNWEVDHEGIPFILPSIGGIT
FT                   LNIQAGDPAFGWQGDHIEPGVSCTADTSKPFEHPNVGLQIYSCAGNTATVMTGDAKGSE
FT                   GRVLGHHGGSEHVIVDFPRDVKEQLLYTDTIIIRGRGQGLKLTDYPEIALFNLDPGLLQ
FT                   KMEIREAGEGILEVPVTTIVPAVCMGSGIGSAHVAKGDYDIMTSDPETVAEYGLDRIRL
FT                   GDFVALMDHDNRYGRAYRRGAVSIGIVVHSDCREAGHGPGVTTLLTSASPLLRPVLDPE
FT                   ANIADRLGIGTMLKGSVKQAKQKKRK"
FT   gene            246510..246929
FT                   /locus_tag="Plut_0250"
FT   CDS_pept        246510..246929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0250"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23138"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B693"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23138.1"
FT                   /translation="MAMKLYGRDPLKMFEDVFSEKVSPFFSSIVTPAFKVDISEDDNAI
FT                   FIEADMPGMKKEDVHVSMEDDVLCINAEREQKEEEKKKGFHRIERSWGSLSRSFTLGDN
FT                   VDEKAIEAHYDNGVLKIKVPKKEPEPQRGVEIPVK"
FT   gene            complement(247008..248648)
FT                   /locus_tag="Plut_0251"
FT   CDS_pept        complement(247008..248648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0251"
FT                   /product="Magnesium-protoporphyrin IX monomethyl ester
FT                   anaerobic oxidative cyclase"
FT                   /EC_number="1.14.13.81"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23139"
FT                   /db_xref="GOA:Q3B692"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B692"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23139.1"
FT                   /translation="MKILMVQPNYHSGGAEIAGNWTPSWVAYIGGALKQAGFDQIRFVD
FT                   AMADDLPDEQIEEIIRANKPDVVMATNITPSIFKAQDIMKIAKKVDKNIRTIMGGIHST
FT                   FMYPQVLSEAPETDYVVRGEGEEIAVNLIKAIAAGNDRETRAEITGIAYIDDDGKVFAT
FT                   PAHPVIEDLDSLTPDWSLYDWDKYIYTPLNCRLAVPNFARGCPFTCTFCSQWQFWRRYR
FT                   ARSPKHFVDEIEVLVKKYNVGFFILADEEPTINKQKFVSLCQELIDRKLNVTWGINTRV
FT                   TDIMRDADLLPFFRKAGLVHVSLGTEAASQMNLNRFRKETTIEENKLAIKLLQKNGIVA
FT                   EAQFVMGLEHETPETIEETYQLCKDWDPDMANWTIYTPWPFSDLFKELGDRVEVRDYSK
FT                   YNFVSPIIKPDNMEREDVLKGVLKSYARFYARKTFFGYPWIKDPYVRKYMLGCLKAFAQ
FT                   TTITKRFYDIDRVKTKNRKLEIDLGFDKSRILTEAEVKNLKELRPEMVADMSFGLKEAG
FT                   YQREHDEHDWDEFDETTIKDRQDTTIRNC"
FT   gene            complement(248811..249509)
FT                   /locus_tag="Plut_0252"
FT   CDS_pept        complement(248811..249509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0252"
FT                   /product="Magnesium protoporphyrin O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23140"
FT                   /db_xref="GOA:Q3B691"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B691"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23140.1"
FT                   /translation="MSSTSFNAEEHKNMLRSYFNGQGYQRWASIYGSDKLSTVRNTVRQ
FT                   GHAVMMDRAFGWIEQLGLPKGAHILDAGCGTGLFSIRLAQAGYRVTSADIASQMVEKTK
FT                   ADATAAGVAGNMEFQVESIESVSGSYDAVVCFDVLIHYPSEGFIQAFANLSKLTKGPVI
FT                   FTYAPYNNILAFQHWLGGYFPKKERRTTIQMIRDEQMQQAMQGAGMEIKRKEKISFGFY
FT                   HTMLMETARR"
FT   gene            complement(249557..253447)
FT                   /locus_tag="Plut_0253"
FT   CDS_pept        complement(249557..253447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0253"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23141"
FT                   /db_xref="GOA:Q3B690"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B690"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23141.1"
FT                   /translation="MRPACGHHVYLPAVSMHFVFLTMEATNTGTLRAAAGELNRRFKTD
FT                   LEVSVFSLGLHNSPQLWEELRGALPRADFVFGSMLFSEEIVRPLEMLLEPLSCPVCMIT
FT                   SNPALVNQTRLGRFSLRKPKKEQQGPPGFFKQWTDKLKPKHSGGESQRQLALVRNASRL
FT                   LKHLPGKARDIHTFISAHQFWLNGSRENMEGFLSLLIDRYAEGWKGKLPQADPLFYPDT
FT                   ALFHPDSKEEFQSAHEFLEWQKKHRPELVKGPVAILTMRSTVLSRNMDHIEYLLRSFEE
FT                   KGIKTCLAYTGGLDFRPALSRFFHPEIPGAIRPALLINATGFSLVGGPAENRAQDAVDM
FT                   LRQLDVPCLNLIPLSFQPVEQWKEGSLGLTPLQTALSVSVTELDGTIEPQVYAGTGASS
FT                   DRSLPLKPEIRLITGRIERFLRLKAATNAEKKVAIVLFNFPPNLGNAGTAAFLNVFESL
FT                   HRLLLKMQAEGYSVDVPPSVEALRDRLLEGNRLIYGTDGNVGAHLPVEDYRRLFPAYEE
FT                   IEAFWGDAPGEILNDRRQFHILGCQLGNIFIGQQPSFGYERDPMRLLMAKDAAPNHAFA
FT                   AFYTWLEHQFQADAVVHFGTHGALEFMPGKQVGLSASCWPKRLIGALPNFYCYSVNNPS
FT                   EGAIARRRGMATLVSYLAPPLEQAGLYRELRKLGDLVAAWRAAPSGELAMEIRELARLA
FT                   DIEAGDEGVEDEAYITRLASELYLIEERMIPLGLHVMGEAPSPDSLADQLALIASHPQA
FT                   SLEGKSLPEIIAGKLHLDYQALEEQKNTESKAQQEWQELHAISREAVRRFTGRITRETG
FT                   RERNIPVRDLLEGSMAVRAAEADAYLLEKAGLKSGELQGLWSFLQDIILNLAINTELES
FT                   LLRALDGRYVLPSPGNDLVRDPGVVPTGRNIHSLDPYAMPSMQAARAGRQSAEELLRQY
FT                   RLEHGAYPQSIALVLWGTDNLKSGGEGVAQALTLLGARTKTDELGKISDVELIGLEELG
FT                   RPRIDTVMTVSGIFRDLLSVQVRLLDRAARLAAAADEPLEMNFIRKHVLQEIEERGCSF
FT                   EEASNRLYSNAPGSYGANVNHLVESSSWEGDDELAEAFTSRKGFALTPRGEWTESPDAL
FT                   RSALKHVNLAYQNIDSAEIGISDIDHYYEYLGGVSKTVERLTSARPAIMVGDSSGTGGR
FT                   QRITSLEKMVSLEARTKLLNPKWYEAMLSQGYEGVREIEAHLSNTYGWSATASAVENWT
FT                   YSRVSETYLQDPEMAARLKDLNPHATMAMAGRLLEANSRGFWQADEGTLETLRNLYADL
FT                   ESRIEGVEEEKA"
FT   gene            complement(253528..253953)
FT                   /locus_tag="Plut_0254"
FT   CDS_pept        complement(253528..253953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23142"
FT                   /db_xref="GOA:Q3B689"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B689"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23142.1"
FT                   /translation="MPTRRPNIFRSAWRFFEILLFFGISVLGFGLLFKTSTFGSRSKEK
FT                   VRQQHAATAAAFEATLLSRAAILQPECLELSLQEALSSSEIPTHAEQTEPGTRTSAVTT
FT                   GTTIIPQAQPALTRIPAFRRAIALPANLLQENPVLLI"
FT   gene            complement(254036..257839)
FT                   /locus_tag="Plut_0255"
FT   CDS_pept        complement(254036..257839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0255"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23143"
FT                   /db_xref="GOA:Q3B688"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B688"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23143.1"
FT                   /translation="MHDKIRIAAVVGMEQCNQRVWREVSDMISAHAELTQWTDQDLEHQ
FT                   NPEAAEAIRNADCVFTTLIQFKGQADWLEEQLKASKVKTVFAYESMPEVMQMTKVGTYV
FT                   VSGDGGGMPDIVKKVAKMLVKGRDEDALYGYMKLLKIMRTMLPLIPKKAKDFKNWMQVY
FT                   TYWMHPTAENLAGMFNYIMAEYFEVGVKAEKVQEVPTMGFYHPDAPEYMKDLHHYEKWL
FT                   HKHDKASAKRRNIAMLFFRKHLLQEKEYIDNTIRAIESRGLNPLPVFVMGVEGHVAARE
FT                   WFTHGNVDMLVNMMGFGFVGGPAGATTPGASAAARDEILQKIDAPYVVAQPLFIQDVNS
FT                   WKKEGVVPLQSAMTYSLPEMDGAVCPVVLGAIKDGRLHTVQDRLDRLSLIAKKFSDLRH
FT                   MPNSEKKVAFVVYDYPPGMGKKASAALLDVPKSVYAMLLKLKDEGYNVGELPESPEAML
FT                   AMLDRATDYEIQAHEQDCFSIDREIFNRITTDRERERIEGRWNGFPGDIVPVGPDRLFI
FT                   GGIQFGNVFIGVQPRLGIQGDPMRLLFDKENTPHHQYIAFYRWISREFGANAMIHVGMH
FT                   GTVEWMPGLQLGVTGDCWPDALLGEVPHFYIYPINNPSEANIAKRRGYATMISHNIPPL
FT                   ARAGLYKELPAFKEMLNDYRERGLEKIVDVETEEAIIDKARQLNLTDDCPRVEGEAFQE
FT                   YISRLYTYMMELEGRLISNSLHVFGATPQLETQVTTITEYLKVRGNEKSLPSIILQAIG
FT                   ENGTYGDYATLATRARKGESAAMQVRERVDGHTRDFISGTIFERGNPASVFSTLTGGAQ
FT                   VSKEMAEAINESLKEGLAMKTALEDNSGEMRSFVHALSGGYLPSGPGGDLVRDGAGILP
FT                   TGRNIHAIDPWRIPSELAFKRGKQIADSILQRHVEENNGEYPESIAQVLWGLDTIKSKG
FT                   EAVAVIIHLMGAEPAYDAQGKISHYALIPLEKLKRPRIDVLIQISSIFRDTFGVLVDHL
FT                   DKLVKDAAKADETHEMNHIKKHVDIAMQNGADFEAATSRLFTQAPGSYGSQVEELVEDS
FT                   AWETEQDLDDMFVKRTGFAYGGNRYGDQQTDILKGLLGTVDRVVQQVDSAEFGISDIDR
FT                   YFSSSGALQLSARRRNPKGDNVKLNYVETFTADVKIDDADKALKVEFRTKLLNPKWFET
FT                   MLEQGHSGAAEISNRFTYMLGWDAVTKGVDDWVYKEAAETYAFDPNMRDRLMKANPKAF
FT                   KNIVGRMLEASGRGMWNADPDMIDKLQEIYSDLEDRLEGIEV"
FT   gene            complement(258008..260431)
FT                   /locus_tag="Plut_0256"
FT   CDS_pept        complement(258008..260431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0256"
FT                   /product="ferric siderophore receptor, putative, TonB
FT                   receptor family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23144"
FT                   /db_xref="GOA:Q3B687"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B687"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23144.1"
FT                   /translation="MKSTKTRVRSLARIVATAWCMLAFMVPLTSYGADTGTVKGQVTDR
FT                   ADGEGVYGATVTIGGTTISTATDMDGNFTLRNVPVATQKLSVSIVGYAPASQVVTVAAD
FT                   ATATANISLGHTTIMASEVVVGAAMYGQDRLSVPVTANVVTSEQIKEEPNPTLDAVVEG
FT                   VPGVVVSRAGGTTSSSLQIRGSNVYQGGGIGTRVQALYDGFPINAPESGEIVWQSVNMN
FT                   AADKVELLKGAAATLYGSGAMGGVVNVYGHLPEKEEILAGSSIGFYDAPPSDDQSAYRE
FT                   SYTPVFWNSYVGYGNKDDKWRYSVLYSHSDDNGYRENTDSYLNDLKIKARYDIDATQYL
FT                   QLSAFYNATVGGYGRTWPYVAGAGGTVTSTSPELAYDINNPTAYGDDTTLRKNALVGLN
FT                   YVKMFSDDVSLDTRLYYTHNGTRYEYNPTATAELVTAAAGPIPATYQQPGSFNETYSDR
FT                   VGAGTKLDWKVSDAHRLLFGVDGNFTNVMSTQVTATTPVAGVLNDIQESNFASFLQDEW
FT                   KITDRLTSLASVRYDWNGISDDMAGTTPIQNKSVDAVSPRVALNYKAMDDMSFRASWGR
FT                   SFRAPSLYERFVRDGGFATLTPNPALDKETMTAWEAGVFKQFGERVALDIAGFINNYND
FT                   LIESTVITAPSTYQYQNISKARIWGIETNLNIKPVDEVNVNLAYTYMNAKNESYDPATA
FT                   SSSVTNNPDPDWLAYRPEHTASASTTWKATKDLALNVNGRYVSKYKNINMYNNVAGTNY
FT                   PGDFVVLGVGAKYKVNDNFSTSLVCNNINNTQYEEVMYFRAPGRSYVLGVDFSY"
FT   sig_peptide     complement(260333..260431)
FT                   /locus_tag="Plut_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.973 at
FT                   residue 33"
FT   gene            complement(260667..261869)
FT                   /locus_tag="Plut_0257"
FT   CDS_pept        complement(260667..261869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0257"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23145"
FT                   /db_xref="GOA:Q3B686"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B686"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23145.1"
FT                   /translation="MEKPKDLFKKCFDFTLADEVKAQGVYPFFHPIDENEGPVVSFGGR
FT                   KLVMAGSNNYLGLTSDPRVKASSIAAIEKYGTSCSGSRYMTGTVTLHIELEEQLADFFE
FT                   KERCLLFSTGYQTGQGIIPTLVQRGEYIVSDRDNHASLVAASIMAQGGGANLVRYNHNN
FT                   MDDLERVLQKIPDNAGRMIVSDGVFSVSGEIVDLPRLVELAKKYNARIVIDDAHAVGVI
FT                   GQGGRGTPSEFDLVDDVDLIMGTFSKTFGSLGGYVVGDDKVIDYIKHNASSLIFSASPT
FT                   PASVAAVLTTLKIIREQPELMERLVSNTDYVRQGLLKAGFKLMPSRTAIVTVLISDQMK
FT                   TLYFWKRLFEAGVYVNAFIRPGVMPGHEALRTSFMATHEKEHLDKVITEFCTIGKELGV
FT                   I"
FT   gene            262070..263062
FT                   /locus_tag="Plut_0258"
FT   CDS_pept        262070..263062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0258"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein/3-beta hydroxysteroid dehydrogenase/isomerase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23146"
FT                   /db_xref="GOA:Q3B685"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B685"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23146.1"
FT                   /translation="MAETILVTGSTGFIGRRMLVHPSLCGERVRVLLRAESPVRDMPDG
FT                   VEAIRADFLDPQALHRALSGVDRIIHLAGVTKAPDEPAFDEGNVLPVRNLLLAVRQHNP
FT                   GLRRFVLVSSLAAAGPAREGIDGVREEDAPHPVSAYGRSKLRGEEAALEFAGDVPLTIL
FT                   RPPAVYGPGDRDVLQVFQMLRNGVLVTAGNARRQRFSMIHVDDLVRGIMMAARAESPSG
FT                   RIYNITSSVPWSWDGVVAAARPALGLRNVLRISLPAPAVMLLGTLAGKAASVIGRTSIL
FT                   NRDKAVELLQDYWVSSPRRAAEELGFTSEITPEEGVAGTIAWARRDGLL"
FT   gene            263509..266331
FT                   /locus_tag="Plut_0259"
FT   CDS_pept        263509..266331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0259"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23147"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B684"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23147.1"
FT                   /translation="MKRRILRLILFLAMSIFDDVYAKEFVVSESSDNVPGSLRAAIDGI
FT                   NASSDVDNVITFATPTVTVSSALPTLVNPVMFVVPASGVSVVGSGLINGTALFAASESS
FT                   LGGLVNGMVVSASGGSKIAAIKNATGAVHISGDMAAALTTTTTSSWYSYGIHAGDGSIT
FT                   VDGNLSGSITATAKTNYAYGLRAVGAATIGGDLSGTIAVTAGTGYRAYGISSDNATTIG
FT                   GSLSGAITAVAGSYSAYGIKASALYVGTDISGAVTSTAGTYDACGLTLGGSLTVGGDIS
FT                   GTISASALDGDKAYAIKTKSAISIGGEVSGTLTATASGSDAAGLYCFDSSIHGATSSDP
FT                   ARISGSINAVSSGASAAVMAWTEMNLYVTGTLYAEGASAYAIRSGMFNGTGGFTDNTTE
FT                   RVDTVVLASGAVLTGGVYLGDGDDTLMLSGTADIQSVPSLDGGTGDDRLVFSGWSGSFS
FT                   DAMQGWEHLDVGSGSSLGMDALGSFSGEVSVLEGAVLRPGAAGGRDRIAGSLLNLGLIE
FT                   LRDGNAHGVLTVDGSYTGGGVVGMDVGAGSADLLSVSGAVSGTTTLLLSIAPSVTELAA
FT                   AEPSLLIHTDTAAAADAFVVQDATDYGPYVAGVMVVAEATGSADWYYGVSGLHDDALTA
FT                   QALMPVIAGPLEDFVPRFSDRKAYGGSSGVMPGFGGGWTRAGESWSRTVLSGDAGTLTD
FT                   GTSRFVQLGWDLWYALGAKSYRGAGVFGGTGTQSASVVSTGGRPAGGVEGTNYSGGIYA
FT                   FLVRPRSYRLEVAAVFGYHELSLNYEMSSPEHLATGSRMVSAEGELQLGLGEGLALSPR
FT                   LQAVWRHVDGFGLAPLSTGPLMVEDEDGLIGLAGLGLTLNTDCPGWYLVAEATVRVDGS
FT                   PTNAVRYPLPAVTLSTEAEAVLWGGSLTVGNRAGGMLDPVYWLKAGALGSAGSMESYRL
FT                   SLEAGVKVPF"
FT   sig_peptide     263509..263577
FT                   /locus_tag="Plut_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.669) with cleavage site probability 0.657 at
FT                   residue 23"
FT   gene            complement(266359..267399)
FT                   /locus_tag="Plut_0260"
FT   CDS_pept        complement(266359..267399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0260"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23148"
FT                   /db_xref="GOA:Q3B683"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B683"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23148.1"
FT                   /translation="METLKKNILAGSLSPVYFFHGPESFLKEEFTALIRSTAFPDEAEA
FT                   AANTHILYGPDITPGELVARASEYPMFTPRQLIVVRQFDKIKKPVGKDQQKQHEMKFAG
FT                   YMKNPAEFTILVFDAEQLDKKDVDKPPYSLLKSFRHDFPLLKTPDLFAAARAHEAGWEF
FT                   DPEALKAFTAYIQPSSREICQEIEKLTTYASSRQGERRITAADVYECVGISKTYNVFEL
FT                   EKAVAGRNLRLSSGISLMIMEREGQKEGLGNIVRYLTTFFMRLWKIAQPEVRAMPQGEI
FT                   AKVLGMYGRQEYFVRSYLSYAGAFSSIQAERAITALKDTDAALKGLSPYPDEKYLLLRL
FT                   MQQLLG"
FT   gene            complement(267470..267961)
FT                   /locus_tag="Plut_0261"
FT   CDS_pept        complement(267470..267961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0261"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23149"
FT                   /db_xref="GOA:Q3B682"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B682"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23149.1"
FT                   /translation="MARGLNKVMLIGNLGNDPELRTIPSGQTVANFTLATSESFKDSSG
FT                   AMQERTEWHRIVAWGRLAEICGQYLKKGRQVYVEGRIQTRSWDDQKTGEKKYATDIVVT
FT                   DMQMLGGMREGGSGYGDGGQQSYSPPQQPARQQGPQDAPPPQTAPSAPMIENDKDDLPF
FT                   "
FT   gene            complement(268134..268982)
FT                   /locus_tag="Plut_0262"
FT   CDS_pept        complement(268134..268982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0262"
FT                   /product="dihydroorotate oxidase B, electron transfer
FT                   subunit"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23150"
FT                   /db_xref="GOA:Q3B681"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B681"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23150.1"
FT                   /translation="MTSTDCGRQAVRQLKPNPAMPRESSITDIRATVAASRRISRDVTL
FT                   ITLDCPQISLTAEPGNFVNVRVNDTTQPLLRRPFSIHDAGDGQVKLMVKEIGKGTEIFC
FT                   RCAAGTELSVLGPLGNSFSTGAEGYDTAVLVSGGIGTAPMRFLEKRLAAMGKKVVNLIG
FT                   GRTKDDLLPEGLTGCRFATDDGSEGFHGTVLALLESLVPSLTAEGTPRIFACGPTPMLR
FT                   AVARFSREAGIASEVSLESVMGCGFGICYGCSVEVSAPDGGTKTILLCREGPVIDGGRM
FT                   V"
FT   gene            269127..270347
FT                   /locus_tag="Plut_0263"
FT   CDS_pept        269127..270347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0263"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23151"
FT                   /db_xref="GOA:Q3B680"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B680"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23151.1"
FT                   /translation="MRILTFTGKGGVGKTSVSAATAVRLAELGYRTLVLSTDPAHSLSD
FT                   SFNLPLGAEPTKIKENLHAIEVNPYVDLKQNWQSVQKYYTRIFMAQGVSGVMADEMTIL
FT                   PGMEEIFSLLRIKRYKSSGLYDVLVLDTAPTGETLRLLSLPDTLSWGMKAVKNVNKYIV
FT                   RPLSKPLSKMSDRIAYYIPPEDAIESVDQVFDELEDIREILTDNVKSTVRLVMNAEKMS
FT                   IKETMRALTYLNLYGFKVDMVLVNRLLDTNEDSGYLENWKAIQQKYLGEIEEGFSPLPV
FT                   TKLRMYEQEIVGLKALEQFAHDMYGDTDPSDLMYDEPPIKFVRNGDIYEVQLKLMFANP
FT                   GDIDVWVTGDELYVQIGSQRKIITLPISLTGLEPGDAVFRDKWLHIPFDLNHQGRHQTD
FT                   KQYSNKA"
FT   gene            270448..270867
FT                   /locus_tag="Plut_0264"
FT   CDS_pept        270448..270867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0264"
FT                   /product="chlorosome envelope protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23152"
FT                   /db_xref="InterPro:IPR020995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B679"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23152.1"
FT                   /translation="MSESYQKLRKDFKELEFTDRLTFLAESALLTGQSAVVGGLELAGT
FT                   VVETVSGTVGSLLDATGVGSLLGRTGGVVGETIDRVAITVKDVSRSAGDLYSDAVKNVE
FT                   NVTDNAAKAIGDAGVSASEAVKNITGSFQKQTGKK"
FT   gene            270991..271233
FT                   /locus_tag="Plut_0265"
FT   CDS_pept        270991..271233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0265"
FT                   /product="chlorosome envelope protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23153"
FT                   /db_xref="GOA:Q3B678"
FT                   /db_xref="InterPro:IPR001470"
FT                   /db_xref="InterPro:IPR038387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B678"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23153.1"
FT                   /translation="MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINR
FT                   NAYGSMGGGTSLRGSSPEVSGYAVPSKAVESKFAK"
FT   gene            271488..273071
FT                   /locus_tag="Plut_0266"
FT   CDS_pept        271488..273071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23154"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B677"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23154.1"
FT                   /translation="MANISLYVSGQTELADVTEFFQKQLLGEGEQPIAFFDGVFYESHQ
FT                   ERVGNIAFQDYLIYSDRAVYLWARGASKDYLDRFELSAVTVNSRNKDSAFATLNLKIRR
FT                   EEKEPVYVIFDMVEIQEAELIIRMHTVMESVIEEHLGTGFRKPVPDAIAHRLLDAGRSI
FT                   CIPRQFTIALDAPSPSQQDSSIGYGQDLLEQYKASIGYPPGEALPGQQPGQGSPRGQQG
FT                   RGANQPSGPFGGLENMLPTDPASLKRIAGSIKDLVGEAPFKLRDQVMKDLQHVPGDVAT
FT                   VLTAVNELVANIAGNPQAERFVMTAIKTAVRNDGVLGSIGKMIKVSGIGGGSRKQQPQR
FT                   QEGGAPGGGRFEDDEDNTIRRKKISIRDEEPRTGRSDFDFKDDAFEVPPMNDAPPLGRK
FT                   KIKIQADEGDVPALVKDMMDMDRPADECPEESGVGEVRRKKIKIMEAEGENAPETASED
FT                   AAQEAVFPPVRKKISVRVAGSEEEPILPEDVLLDALGEPAPEKKDAGCYGTIESDPLIT
FT                   APEAQPKEES"
FT   gene            273195..274349
FT                   /locus_tag="Plut_0267"
FT   CDS_pept        273195..274349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0267"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23155"
FT                   /db_xref="GOA:Q3B676"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B676"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23155.1"
FT                   /translation="MRIILYLGKGGVGKTTVSASTATAIARRGGRVLIMSTDVAHSLAD
FT                   AFGVELSQTPIEVEKNLFAMEVNVLAEIRENWNELYSYFSSILMHDGADEVVAEELAIV
FT                   PGMEEMISLRYIWKAAKSGNYDAVVVDAAPTGETMRLLGMPESYGWYSDKIGGWHSKAI
FT                   GFAAPLLSKFMPKKNIFKLMPEVNEHMKELHGMLQDKSITTFRVVLNPENMVIKEALRV
FT                   QTYLNLFGYKLDAAIVNKILPAKSGDKYLQSLIDIQQKYLRVIENCFFPLPIFRAGQAT
FT                   AEVINPDRLYELSQEMFGDKNPADVLYTNDRTQTLEKVDGKYVLSLYLPNVEVQKLNVN
FT                   IKGDELLVDINNFRKSIMLPNVLIGRKTEGADFEAGNLNITFAN"
FT   gene            complement(274477..274986)
FT                   /locus_tag="Plut_0268"
FT   CDS_pept        complement(274477..274986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0268"
FT                   /product="7,
FT                   8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23156"
FT                   /db_xref="GOA:Q3B675"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B675"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23156.1"
FT                   /translation="MKLHTAYIGTGSNIGDRLSHLQEAVCRLGALPETKVLRASPVYMT
FT                   EPVGEEEQERFYNGVVQIETGLTPENLRSATKAIEQELGRPERYRRWSPRVIDLDILLY
FT                   ADCIIETDTLRIPHPELHRRKFVLIPLLDIANPLHPVLRKTILQMLRTCGDRSVPVRLR
FT                   ERLRLH"
FT   gene            complement(274992..275369)
FT                   /locus_tag="Plut_0269"
FT   CDS_pept        complement(274992..275369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0269"
FT                   /product="Dihydroneopterin aldolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23157"
FT                   /db_xref="GOA:Q3B674"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B674"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23157.1"
FT                   /translation="MTHISRSSVRLSNMVFYAHHGVLREEHRIGAKYEVDAELTFDFTG
FT                   AAMNDDITKTVDYGAVYSRIRMALTGKKYFLIEAVAWEIARDLLGDFPAVSEVGIKVRK
FT                   RNPPVDGICDYAEADCTMQRD"
FT   gene            275549..276433
FT                   /locus_tag="Plut_0270"
FT   CDS_pept        275549..276433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0270"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23158"
FT                   /db_xref="GOA:Q3B673"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B673"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23158.1"
FT                   /translation="MKMKNQDCHDFYEGCRSRAVMLALEEDRYTGDVTTMATIDPQQQG
FT                   SAVVRAKEDGVIAGVDVAAQVFAACNPSLKLEVHRNDGERVVQGERVFDVHGLLAPILL
FT                   GERTALNFMQRMSGIATKTRAFVDLVSHTEARILDTRKTAPGLRYFDKEAVRIGGGRNH
FT                   RFGLFDLILIKDNHIDAAGGVGPALNRARMYREKHGLDVKIEAEVRSLDELSAALACRP
FT                   DIILLDNFTIDLMHEAVEYVRSMPSGVLLEASGNMSLYNVKAVAETGVDFISVGELTHS
FT                   VRALDLSMTITLG"
FT   gene            276453..276812
FT                   /locus_tag="Plut_0271"
FT   CDS_pept        276453..276812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0271"
FT                   /product="Holo-acyl carrier protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23159"
FT                   /db_xref="GOA:Q3B672"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B672"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23159.1"
FT                   /translation="MDIVDLVRIEKAYDRYGRKFLERIMTGEEIELCLKKPSPLASIAG
FT                   RFAAKEAVVKALGTGITAAVHWKSFEVLNDPAGKPFVRSSQPGLLPEGCSIKISIAHDR
FT                   HSAVATALLCRGPES"
FT   gene            complement(276946..278256)
FT                   /locus_tag="Plut_0272"
FT   CDS_pept        complement(276946..278256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0272"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23160"
FT                   /db_xref="GOA:Q3B671"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B671"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23160.1"
FT                   /translation="MTIITKPQRALQKNIKNISETEQELEIIFTSDEFANDYEQELEEA
FT                   KKTVQLKGFRKGHAPAGLIRKLAGPAIEASIAEKLASKHFGDIVESDKIKTASRAGMID
FT                   FTFTPEQLTVRLGYEVHPEFDLKDFSSYSFTRSVYTIDDAAVEKEINLILKGHGTMVSV
FT                   DEAATATDTVIGDVVKLTEEGEEGEGKTENHHFNLEYLPEDNPFGKAIAGKKAGETVVV
FT                   ETPGQNEGDAPVNFRVTISEVKRMELPELTDELVKEITGQRFENVADFKADVKIQLDEH
FT                   FSMKSEEDLLESISAKLIDENPVATPKTMVASFSNMLVENAKRQMGGSFPKAFDTDQFQ
FT                   TAMQPNAERHARWLVISQKIAEMNNLEIDEAAIREYAEKEAAKNTAMNAEELMKTYMSA
FT                   DFRDYVTDTITKEKIYEIIKAKVSITDEATPVPDHRG"
FT   gene            complement(278311..279576)
FT                   /locus_tag="Plut_0273"
FT   CDS_pept        complement(278311..279576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0273"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23161"
FT                   /db_xref="GOA:Q3B670"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B670"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23161.1"
FT                   /translation="MMRQQRATHTNEAVIEERLPNGLRVVTDRVASVESVTLGILIEAG
FT                   SRDDPEDAAGLAHFIEHAIFKGTGRRSYLDIARDIEKHGGYLDAWTTKEHTCIYLRCLS
FT                   RHLEASFELLADLVSDPVFPPEEIEKEKEVVLEEISSVEDAPEEMVFEEFDLRSFPRHP
FT                   LGRPILGTMESVEGISASHLTAFIREHYRPSKMILSATGNVRHAEITGLAERFLNRADM
FT                   SSGCATRMMFRPEDYRPFNKTLKKRISQSQIVQGTAAGRNDRLFYATMALNSMLGSGMS
FT                   SLLNLELREKRGLAYSAYSAVSFYDDLTTLNIYTGTDALKIDTALKLIEELLHGPALLH
FT                   PDPGEVETAKAKLLGSHIMGMEKMTRRMSQVATDISYFGRYVPPEEKTAKIEALTPLDI
FT                   REAARDLILEPPLSTLVYRPSR"
FT   gene            279633..280697
FT                   /locus_tag="Plut_0274"
FT   CDS_pept        279633..280697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0274"
FT                   /product="dihydroflavonol 4-reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23162"
FT                   /db_xref="GOA:Q3B669"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B669"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23162.1"
FT                   /translation="MFKNRGAHWRSVRPSGGAELPYSRFMSTASIAITGATGYIGSQLL
FT                   LSLMRGAGGGEGVRIVAREGSDCSFSGTLPVEVVRADILNQPALDLAFRGIDTVFHSAG
FT                   LISYTKRHTGELYDVNVLGTRNVVNACLNAGVRRLVVTSSMAAAGATEDGSPVGESASF
FT                   QDWQRRNGYMESKHLAELEVLRGAAEGLEAVMVSPGVVIGRDPSNPASKSSSNDVLRLI
FT                   YQGRIPVHPTGGTGFVDVSDVVDALIAGWRLGRSGERYLVVGHNMTFKELYLRIAELPG
FT                   SRTRPTIALPGPIGSLAGIGGELYSWISGRPSFISIESIRLAGRRASYSNMKSTEELQV
FT                   SYRPLEETLLSAVT"
FT   gene            280738..281784
FT                   /locus_tag="Plut_0275"
FT   CDS_pept        280738..281784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0275"
FT                   /product="RecA DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23163"
FT                   /db_xref="GOA:Q3B668"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B668"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23163.1"
FT                   /translation="MATPRPAETAPGVDPAKLKQLNLAVEALEKQFGKGAIMRLGDDSA
FT                   VMQVQSISTGSMTLDFALGVGGLPRGRVTEIYGPESSGKTTLALHVIAEAQKAGGIAAL
FT                   VDAEHAFDPSYARKLGVDINAMLISQPESGEQALSIVETLVRSGAVDVVVVDSVAALVP
FT                   QAELEGEMGDSVVGLQARLMSQALRKLTGAISKSSSVCIFINQLRDKIGVMYGSPETTT
FT                   GGKALKFYSSIRLDIRKIAQLKDGDEIIGNRTKVKVVKNKVAPPFRIAEFDILYGEGIS
FT                   LMGELIDLAVEFGVVKKAGSWFSYGPDKLGQGREAVKKALREDPELFKKVHSQVKDVMT
FT                   GNPEALQP"
FT   gene            281789..282853
FT                   /locus_tag="Plut_0276"
FT   CDS_pept        281789..282853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0276"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23164"
FT                   /db_xref="GOA:Q3B667"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B667"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23164.1"
FT                   /translation="MKIGKLDIDRPVILAPMEDVTDRAFRQLCKRHGADIVYTEFVSAE
FT                   ALRRGIEKTVRKLKADPVERPLAVQIFGSTVESMVEAAVIAEEFQPDYLDINFGCPTKK
FT                   VAGKGAGAALLKEPEKMAAIAEAVVKAVRLPVTAKTRIGWDHESINILDVLRRLEDAGI
FT                   QALALHGRTRSDMYKGKADWGWIAEAKRHARIPLIANGDVWSPEDALRMFLETGADGVM
FT                   IGRGSIGNPFIFSGTKHLLKTGTPPPPPDFRLRIKAAIEHLQLSVEFKGEKYGTLEMRR
FT                   HYATYLKGLPKVSVVRNKLVREEDWRAVESILLEYREECEGYAREGRIREHAEYLNDHS
FT                   DKLVLNYKASNTTI"
FT   gene            282850..283872
FT                   /locus_tag="Plut_0277"
FT   CDS_pept        282850..283872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0277"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23165"
FT                   /db_xref="GOA:Q3B666"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B666"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23165.1"
FT                   /translation="MSSSEKKCRVAILGATGLVGRTMLQVLEERNFPATDIIPLASARS
FT                   AGQKVTFRGKEYVICVPSAEAFSGIDIALFSAGASASRQWAPVAAAEGAVVIDNSSAFR
FT                   MDEGIPLVVPEVNPGDIFAADGSAAKIIANPNCSTIQMVVVLKPLMDRYGLSRVIVSTY
FT                   QSVTGKGKAGRDALESELAGERQEQFTHFHQIAFNAVPQIDVFTDNGYTKEEMKMVNET
FT                   RKIMGDSSLSVSPTTVRIPVYGGHGESLNIELKSDFDIEEVKELLGRSPGIVLQDDPSA
FT                   RVYPMPLTSYEKDEVFVGRIRPDYWHPKTLNLWIVADNLRKGAATNAVQIAEVVAAGRP
FT                   "
FT   gene            complement(283873..284730)
FT                   /locus_tag="Plut_0278"
FT   CDS_pept        complement(283873..284730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B665"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23166.1"
FT                   /translation="MTRSIVACAVDAAESSIVRLKTSGGDGFILTECRTVPAGYALLAT
FT                   PKGQRALKKLSEHAAKWSGEPLSLCIAHDTYHPLPAYFPLDATDEECRGYSRLEASYFL
FT                   DEPGHYGCDVLPFLEESAGGLQGKKLLMFWPEAPAKGIAGAFSSRHAISGDSTPLKTAV
FT                   GISKMSEGQTVLLELSGSHVLLVVASCGAISHFSHRRVLNRDETAYFALKEIAEAALPP
FT                   GTPVQTRGALADRAMVELISRESACPLQPQALPRTVSISGMAQKTLQSPSALNAIMSAI
FT                   LVLA"
FT   gene            complement(284727..285239)
FT                   /locus_tag="Plut_0279"
FT   CDS_pept        complement(284727..285239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0279"
FT                   /product="Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23167"
FT                   /db_xref="GOA:Q3B664"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B664"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23167.1"
FT                   /translation="MNPFERLSEKLSLTRAEVVAVSTLLAFLVFGAILRTMHAVELESD
FT                   AVRQAEAAVFSDREADSLIKAARLDEGRVDEAVRKSIALEKSTGGFESTPRRAKKEPFT
FT                   GTVSFTSATSTELQQIPGVGPVMAGRLIDFRTAHHGHIESYDALLEVKGVGKKKLEVLK
FT                   KHLSIDQ"
FT   gene            complement(285439..286557)
FT                   /locus_tag="Plut_0280"
FT   CDS_pept        complement(285439..286557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0280"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23168"
FT                   /db_xref="GOA:Q3B663"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B663"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23168.1"
FT                   /translation="MCPNAPEPMAEALIRLQHLQENARLIRKKAGVPLMAVVKANAYGH
FT                   GARETARALLAEGIGHFGVANIHEAIELRTCGSLKRPAAILSFSSPLPSQIPSYLEHGI
FT                   EMTVCDPATLRAAEAVASGAGATIGVHLKVDTGMGRLGLSPAEAKQVLQELPRCPHIEL
FT                   RGIYTHFADSSFDRAFTRKQLEAFRAFTGEYEHASGRRVLKHAANSGAILSEPDATFDM
FT                   VRPGILLYGCHPSNDAHLRLDVKPVMQVEARVVFLKTVTAGTTISYNRTWKAAGPRIIA
FT                   TIAAGYADGYHRSLSGKATVSINAITYPQVGTITMDQIMVDLGTESDVRVGDRAVLFGW
FT                   DGMRAEELASRAGTISYELLTSVSARVLRTVV"
FT   gene            286805..288184
FT                   /locus_tag="Plut_0281"
FT   CDS_pept        286805..288184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0281"
FT                   /product="CBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23169"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B662"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23169.1"
FT                   /translation="MPMPNNDILGLKTETPMVLLRQMPRQMQAKVMAKLEYMNPACSHY
FT                   YRVAAAVVRDAEEKNLIHPGMTLVDWTYGNSGIALAMAGASRGYKLLLVAPDKISREKQ
FT                   DVLRAIGAELVITPSDALPGEARSCMNVAESLVGNLSNAFFAGMYDHPLNFEVHRDSTG
FT                   PEIFSQTDGAITHVFVPLSSAAMASGVGAFLKSKNPAIRLIGVEPVGSVFAGLLKSGVP
FT                   GPAAFSELEEIGAATPPRFWDPSLIDEVVQVSDEDAMNCGRALLRTEAVFAGSASGAVM
FT                   MAALNAASGLGPDATVVAVLSDFGGYSLSKMYRDEWMRQHGFYRREKSSLEQITAEDIL
FT                   RLKAQRDLIVAYPENTLAEVFEMMKQNDVSQLPIVSYNAPIGSISENRILSILIENDDA
FT                   MNSKVVGFMEPPFPVCQPDAAISELSEKLQQNASGVLISMLDGKLQLLTKSDLIDALTH
FT                   K"
FT   gene            288368..288931
FT                   /locus_tag="Plut_0282"
FT   CDS_pept        288368..288931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23170"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B661"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23170.1"
FT                   /translation="MKVESRKRQFILDGKIKPCYCDGCGQVTEKAFVGEWMPSDKPRED
FT                   DPLLPPPVKKERGGKKKIAETPVPSAENQYWIRCMQCNQVHLLQEWQIQIDRELSPDEL
FT                   RADECQIYSPHGIYATGDALYHQSLDEVGVVREKQATGSGAYVIIVEFCKSGRKQLLEN
FT                   VQLTPAKEKSSDSITDLIKTKLRR"
FT   gene            288961..289158
FT                   /locus_tag="Plut_0283"
FT   CDS_pept        288961..289158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0283"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23171"
FT                   /db_xref="GOA:Q3B660"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B660"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23171.1"
FT                   /translation="MVSVQMNDNESIDKMLKRFKKKYERAGVLKEFRQNAYFVKPSVDG
FT                   RLKRSRSKRRAQRANEERNS"
FT   gene            289245..290546
FT                   /locus_tag="Plut_0284"
FT   CDS_pept        289245..290546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0284"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23172"
FT                   /db_xref="GOA:Q3B659"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B659"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23172.1"
FT                   /translation="MSVFKGEVTSLPPDKSISHRAALIASLSDGETEIMNFSAGFDNQS
FT                   TLGVLQACGIPVRQEEVPGPWGTAILRVVIKSKGLWSLTPPSAPLQCNNSGSTMRMFSG
FT                   ILAGQPFQSELVGDASLLKRPMRRIADPLIQMGAGVSLSPIGTAPVVITGSKDLHAIDY
FT                   RLPVASAQVKSLVAFAGLHAEGETRIYEPLSSRNHTELMLGLEPRVENEERVIVVPGRR
FT                   QREARPFQIPADPSAACFIVSLGLLARGSEIMIRDVCLNPTRAAFLDILIRAGAAVTIE
FT                   NRRTVGGESIGDILVEGTRDMEPLVISDPQEVAIAIDELPMLGVLSAFATERFELMNAG
FT                   ELRTKESDRIEALALNLERLGFVCHQEPGGLSVTGRKGRPSGPVVVECFDDHRIAMSFA
FT                   VASKACGEDIELSDREVAGVSFPNFFSLLDALEV"
FT   gene            complement(290566..291345)
FT                   /locus_tag="Plut_0285"
FT   CDS_pept        complement(290566..291345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0285"
FT                   /product="3-oxoadipate enol-lactonase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23173"
FT                   /db_xref="GOA:Q3B658"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B658"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23173.1"
FT                   /translation="MLSWTGVNTEHDGTDRKSVLLLHAFPLSGAMWHPQLRALDEKGYR
FT                   AVAPNAWGIEGSPERTGWTFDDYADELVRLMDSLKISDATVLGLSMGGYQAFALEKRHP
FT                   ERVRSLVLADTRPEADAPGAAAARADFIAGVAERGAEEAVKRMVPNYFTKEAPKRLQQE
FT                   AAAMIKAQPPGAIISAMRAIMQRSDSTAMQSSISCPTMVICGEHDTLTPPETARAMALA
FT                   IPGATLEIIAEAGHISNLEQPEAFNKALFGHLTGLTR"
FT   gene            complement(291349..291675)
FT                   /locus_tag="Plut_0286"
FT   CDS_pept        complement(291349..291675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23174"
FT                   /db_xref="GOA:Q3B657"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B657"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23174.1"
FT                   /translation="MVQQQDKFYKGMFFGAVLGAAGGTIMGLLFAPNKGSETQQILSGK
FT                   LKHALEKASELYEGDDDGELYGNEAKKRSQEIIDTARQEARKILDEANSIIREIKGQPK
FT                   VGEN"
FT   gene            complement(291758..293167)
FT                   /locus_tag="Plut_0287"
FT   CDS_pept        complement(291758..293167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0287"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23175"
FT                   /db_xref="GOA:Q3B656"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B656"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23175.1"
FT                   /translation="MIAEHLLFRSDGGFIRIPIWGHIPLSGPLKKIISHPSFLRLKGIR
FT                   QLSFSQQVYPGATHTRFEHSIGVYHLMKLILQRMLTNPLALSLQGGEFHFDDHNCRLLL
FT                   AASLLHDIGHYPHAHIIEDQIPVVDGERVFSHHEDLCERFIHEEHPGMPTIADILRLDW
FT                   KVSPEAVITLIKDGSGSRFGKLISGTLDPDKMDYLMRDAHHCNIPYGSIDIERLIESFV
FT                   PDPERERFAITEKGIAPLESLMFAKYMMMRNVYWHHTSRSLSAMLRRLLQDIATEGLVA
FT                   PQALRELFYGNADDRVLFELRELLGDRTHPLQELLQDIIMRRVYKRAITVQPYLEESGE
FT                   ADDRWFAYNNDSTVRRQMEQEICRFLNARHNLSLAGHEVLIDPPSKKDIFDYADLRELR
FT                   VYPTRSEHVHYSLELEGKYIRFDDLNESVFSSGFILAFERYTKKFRLLCRPDLTGYIVA
FT                   AREEIMAMMPR"
FT   gene            complement(293184..293918)
FT                   /locus_tag="Plut_0288"
FT   CDS_pept        complement(293184..293918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0288"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23176"
FT                   /db_xref="GOA:Q3B655"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B655"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23176.1"
FT                   /translation="MSATLSCTGLQKSYNKHLVVRDSNIAVSQGEIVGLLGPNGAGKTT
FT                   TFYMIVGLVRPDRGDVFLDSRNITKEPMYKRARLGIGYLPQEASVFRNMTVEENILAVL
FT                   EFTDMPKARQQEKTDMMLEDLGISAIRKSMGYALSGGERRRTEIARALALDPKFILFDE
FT                   PFAGVDPIAVEDIQQIVEGLVKRNIGVLITDHNVHETLSITNHAYLLFDGSLFMHGTPE
FT                   EIASHPEVRRMYLGEKFSLERY"
FT   gene            complement(294017..294373)
FT                   /locus_tag="Plut_0289"
FT   CDS_pept        complement(294017..294373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23177"
FT                   /db_xref="GOA:Q3B654"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B654"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23177.1"
FT                   /translation="MAIQPDEKYCTECGALINRKAEICPKCGIRQTPAPFTSSLGAIAP
FT                   NGRSRLAAALFALFLGSLGIHKFYLGSIGWGIMYILFCWTGIPTIVGFIEGVLLLIMSE
FT                   ETFNMKYGGSYGGS"
FT   gene            294559..295101
FT                   /locus_tag="Plut_0290"
FT   CDS_pept        294559..295101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0290"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23178"
FT                   /db_xref="GOA:Q3B653"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B653"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23178.1"
FT                   /translation="MGKVMPYKGVWPEVHETVFMTDGSYVIGDVKIGADSSLWFNAVVR
FT                   GDVCPIRIGERTSVQDNVTLHVTHDTGPLEIGSNVTIGHGATLHACTVRDYVLIGMGAT
FT                   LLDDCVVEPWSIVAAGALVRQGFRVPSGMLVAGVPAKVMRPITEEERRNIEESPENYVR
FT                   YAAHYREGRVLSQAVDR"
FT   gene            295216..296454
FT                   /locus_tag="Plut_0291"
FT   CDS_pept        295216..296454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0291"
FT                   /product="protoporphyrinogen oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23179"
FT                   /db_xref="GOA:Q3B652"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B652"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23179.1"
FT                   /translation="MTVFSILFLKLPGQPMMEHDVVIVGGGISGLSMAFYCAEAGMRPL
FT                   LLEQNAEAGGSFASPRYEIGRKTFWLEMGAHTCYSSYQNLLGIVEACGMMGDIIPRAKV
FT                   PFSLFIDGKVKSLVSSLHIGELLLSAPNIFKLKKEDQSVRSYYEKIVGKRNYDEVIRHF
FT                   FNAVPSQPTDDFPADMMFKSRPKRKDVLKNYTFRDGLQSVARSIAGRKGITVATDSEVT
FT                   LVRHEGGNYRVTTAGGEEYAAARLVLATPSAVSSKLLEGMEPELSRHLSVLKAAEVDSI
FT                   GVIVRKDVVALKPVAALISPNDVFYSVVSRDTVPDDHFRGFSFHFRPGLPEKQKKTRIM
FT                   EVLGIPMAKMEHINVKTNTVPSLRLGHRQWLEKTDALLKAKKGLGLSGNYFGGMAIEDC
FT                   VSRSKSEFERMRG"
FT   gene            296461..297543
FT                   /locus_tag="Plut_0292"
FT   CDS_pept        296461..297543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23180"
FT                   /db_xref="GOA:Q3B651"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B651"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23180.1"
FT                   /translation="MEVFLKSWQSVEGGYLLPALLVLSAILLYFGANTVFGRVVRNIRR
FT                   SVRGTGLPVEVAAAPFRLLVELAGITLLLHYLPLPEGLLPVLKHLLIILAIISSAWFMM
FT                   RLLIVLERFVLLHYESKTLENSAARRKVATHASLARKILNVILVVLALSSVLMTFDTVR
FT                   QVGVSILASAGIAGVIMGFAAQKSLATLIAGVQIAITQPISIDDVVVVEKEWGKIEEIT
FT                   LTYVVVNIWDQRRLIVPISRFIDQPFENWSRVSAELLGTVFFYVDYAIPVEELRSELER
FT                   IVSSTPLWDKRVVKLHVTNTSDRSLEVRALMSARNSSDAWELRCLVREEMIGFIRENYP
FT                   GGLPRVRMEMDQGGAAALGI"
FT   gene            297687..298115
FT                   /locus_tag="Plut_0293"
FT   CDS_pept        297687..298115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0293"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23181"
FT                   /db_xref="GOA:Q3B650"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B650"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23181.1"
FT                   /translation="MAQAKTGDKVKIHYTGTLSDGSVFDTSADRDPLEFTLGGGQVIPG
FT                   FDTAVIDMAPGEVKVQVIPVEEAYGPHSVELVTDVQRDRFPPDMELEIGQQLQVGLADG
FT                   QQAIVMIVDLKEDAVTLDANHPLAGQELTFEIELVEIL"
FT   gene            complement(298137..299399)
FT                   /locus_tag="Plut_0294"
FT   CDS_pept        complement(298137..299399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0294"
FT                   /product="collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23182"
FT                   /db_xref="GOA:Q3B649"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B649"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23182.1"
FT                   /translation="MAREHTTTKKRPELIAPAGSHAAMQAALRAGADAVYFGTEGCNMR
FT                   AGSESFTPTDFPAIRKLADSHGARAYLTLNTTVYDSELPMIKSYVAAAKSAGLDAVICW
FT                   DMAVIDACRRESMPFHLSTQASVSNTAAIRYFAAQGATMIVPARELTLQQVQRLTTMVE
FT                   EERLPLKIECFVHGAMCVAVSGRCFLSQELFGKSANRGECVQPCRRSYIVTDPEEGVSL
FT                   ELGSDYVMSPKDLSAVEFLDRLMDAGIGAFKIEGRSRSPEYVQTVTSAYRRALDCCISE
FT                   RSDPGFRARYSALTAELKEELRTVYNRGFSDGFYFGRPLEAWSKSYGSQALERKTYLGK
FT                   VVKYYPKAGVAEILIQAGKLTAGGKLSIQGPVTGVETFTPESFRTNDVEGSPTATKGDT
FT                   ITLRCPKVRKNDAVYLLEERR"
FT   gene            299440..300090
FT                   /locus_tag="Plut_0295"
FT   CDS_pept        299440..300090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23183"
FT                   /db_xref="GOA:Q3B648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B648"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23183.1"
FT                   /translation="MAARYGIIANKAYIFIARISVSGFLPGLSAIFFDTLMNDRLFSSL
FT                   LFAVSLGLALIELALLASLSPPDVSLVVLAVALSLAGMLFSVRMLLGARHAVESVSSRR
FT                   QRAMQDPVMRERLEGYATDEAFRGGACGGGETAAAPSSAPSRLNLETFSLDREGFQEYI
FT                   GRSMGGGGEEEDGGFCVDLDCDALSRGGGVMPSDFSHDPASVMAGLKRAGGKP"
FT   gene            300087..300884
FT                   /locus_tag="Plut_0296"
FT   CDS_pept        300087..300884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0296"
FT                   /product="SpoU rRNA methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23184"
FT                   /db_xref="GOA:Q3B647"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B647"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23184.1"
FT                   /translation="MKNRALPEVSRALLKRIARLQQRKYRDREGLFIAEGLRTVRELLG
FT                   QMAGADMLDCLICTAEGLAFFPESSIYSGSLFLASEDDFNRVAGTSSPQGVLGVFRQPV
FT                   FPLPYERPYSGRALLVALDEVQDPGNAGTILRTAAWLGADGLLAGPGTVDLYNAKTVRS
FT                   SAGSLLGMPHTRAGDLPAALRQLQKAGFKVICSSLEGEDFRSGGAWPERTVLVVGNEAN
FT                   GVGPEVRVLADRLVKIPHGRGPARVESLNAAVSAAILMERILL"
FT   gene            complement(300906..301727)
FT                   /locus_tag="Plut_0297"
FT   CDS_pept        complement(300906..301727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23185"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B646"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23185.1"
FT                   /translation="MIIRQIAVAIDCSPHSIASIKAARELAERMQADIQGIFVEDSNLF
FT                   SLAELPFSSEIRPYSHEPRAIEPAELERAVRLQAEKAEAALLSAIGNSTLRHSFSIRRG
FT                   LVPEEVVEAALECDLLVLGRSGKSPTCRRGLGSTAQKALVEGKKPMLFMRHGVSATKGP
FT                   FITLYDGSEGAEKALQAALFLTPEGALLHVLILEADPEEAARMEASIREQESERAETME
FT                   FHNLRGADAKTLVRFIRMVDSGLVVLCEEMRMAKEDIRELISELDYPVLLV"
FT   gene            complement(301730..304129)
FT                   /locus_tag="Plut_0298"
FT   CDS_pept        complement(301730..304129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0298"
FT                   /product="ATP-dependent protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23186"
FT                   /db_xref="GOA:Q3B645"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B645"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23186.1"
FT                   /translation="MTQLHGKLPPEQLRRECDPLDFNFETTAELDGRTEAAGQKRALDA
FT                   IAFSIAIRHDGFNLFALGRSGTGKQTSLMHHLETVAPKAPVPDDWCHVYNFEKPRHPKA
FT                   LRLPPGKAAELSGGMDRLVEALLTVIPAAFSSEEYQGEEKAIHEKFQEQQAEAIGELEK
FT                   KAADAGIALIRTPAGFAFAPVRKGEVLKPDEFMRLDEQKREEIEEKIGKLKTELQTVMS
FT                   QMPKWQRETQEKINGLNRTIADFAVRPLVDELKSRYEALPEVGTYLDAVENDIVENFYQ
FT                   FLEKGQEAGNPMKKSRTFNRYRVNVAVDNGAAKGAPIVYEDKPACRNLVGDIEHLSEMG
FT                   TLVTDFTLIKPGALHRANGGYLLLDARRLLMEPFAWDALKNALRTRQIRIESLGQLYSL
FT                   ISTVSLEPEPIPLDLKVILFGERRLYYLLNAYDPDFSELFKVAADFEDELEADPEGKHS
FT                   YARIIARVAKQNSLRHFSREAVARAVEYGGRLAGDSRKLTSRLQEISDLVHEADFHAGS
FT                   AGRNTVGADDVDRAVEARVVRASRISEKIREATLKNAILIDTDTEKTGQINGLAIYPAG
FT                   RELFAHPGRITARIRLGKGEVIDIEREAELGGPIHSKGVMILSGFLGARFGMSQPLSLS
FT                   ASLVFEQSYGGVEGDSASSAELYALLSALSDVPIRQWIAVTGSVNQYGELQAIGGVNEK
FT                   IEGFFDLCNARGLTGRQGVLIPASNVLNLMLRRDVVEAVREERFSIYAATHVDEGIELL
FT                   TGVEAGVQNENDEWPAGSINGKIAARLAGMAEKIRQYSSNTETPEE"
FT   gene            complement(304281..305036)
FT                   /locus_tag="Plut_0299"
FT   CDS_pept        complement(304281..305036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23187"
FT                   /db_xref="GOA:Q3B644"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B644"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23187.1"
FT                   /translation="MDWILQPEAWVALATLTILEIVLGIDNIIFISILAGRLPEHQRQR
FT                   GRVMGLGLAMVTRILLLLSISMVMRLTGELFSVADHSVSGRDLILVAGGLFLLAKSTHE
FT                   IHQSLEGGEEGGTRAAPGSFLFTLLQIAVLDIVFSLDSVITAVGLARDLPVMVIAIMIA
FT                   VGVMMLAANSISDFVERHPTIKMLALSFLILVGVTLLAEGAGYEIPKGYVYFAMAFSVG
FT                   VEMLNLRLRPKAAEPVHLRPTLPTDGKEV"
FT   gene            305176..306552
FT                   /locus_tag="Plut_0300"
FT   CDS_pept        305176..306552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0300"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23188"
FT                   /db_xref="GOA:Q3B643"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B643"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23188.1"
FT                   /translation="MGEAFQQPVVPALRAAFDSGLTRPRVWRVRQLEALGRFLLEREEE
FT                   LAAAVQADVGKPPAEVFFTETAFLQSEIRYALQHLGGWMRPKRAALPLLYQPATASYAY
FT                   EPLGVVLIIGAWNYPLQLVLAPLVSAIAAGNCAVLKPSEQAPRTSACIAEGIRHYLDGQ
FT                   AFLVVEGGPLEARQLLRERFEHVFFTGSRAAGREVMRAAAMHPASVTLELGGRCPCIVD
FT                   SGMQLKTVARRIAWAKFLNAGQTCIAPDYVLVRRGLERMLADALREALVSFYGPSPGRS
FT                   PGYARVVGDDRLLRLEERFPGIADESPGGGRSLPPTILEGAGPEYAGAGDEIFGPVLPL
FT                   VSYGEIGEAIGMIRDGEEPLAIYLFSTDRGVQQRVLRETRSGGVCINDLLFQAAVPSLP
FT                   FGGVGRSGFGAYHGRAGFEEFSTRRSVMKRPIVADMSLRYPPYGNRKFRFLRWLLGCFQ
FT                   "
FT   gene            306600..307379
FT                   /locus_tag="Plut_0301"
FT   CDS_pept        306600..307379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23189"
FT                   /db_xref="GOA:Q3B642"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B642"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23189.1"
FT                   /translation="MMNDGKIGLALGGGAVLGAAHVGVLRALDELDIKVSMLSGTSIGS
FT                   FIAALHAFGKTWQEIRDVTLELDWFDLSGPVLSQYGLLSNRKFGRVVHELLGRKNIEDA
FT                   PIPLAMVAANVSTGRKVVIRSGDVAAGVMASTCIPGLFRPVEQNGSMLVDGMLLENVPV
FT                   SPLFELGIHPLICVDLLARHTFTKPDSIIGLLLNSFYAAITNVASVQTGMADLCIAPDL
FT                   GAFNLIDTDQIPEIIEAGYRDALKALSAFRENASFLA"
FT   sig_peptide     306600..306668
FT                   /locus_tag="Plut_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.660) with cleavage site probability 0.317 at
FT                   residue 23"
FT   gene            307476..308063
FT                   /locus_tag="Plut_0302"
FT   CDS_pept        307476..308063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0302"
FT                   /product="outer surface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23190"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B641"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23190.1"
FT                   /translation="MKKGACIMKKFAAGTLFAVLALAGSGRLASAATPYATGSVGLAML
FT                   QDSDVEFAADRSYNTGYTLTGAVGLRSGEYRLEGELGYQENGIESSGDDVSILSFLGNG
FT                   YIDFEMASSSFTPYLTAGFGLASVDDSSGPGSVDDTVFAWQLGAGVGYRFADNMLVDVR
FT                   YRYLGTGDPELAGGREYSIDTHNFMVGLRVEF"
FT   sig_peptide     307476..307571
FT                   /locus_tag="Plut_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.906 at
FT                   residue 32"
FT   gene            308123..308608
FT                   /locus_tag="Plut_0303"
FT   CDS_pept        308123..308608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23191"
FT                   /db_xref="GOA:Q3B640"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B640"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23191.1"
FT                   /translation="MPIRKLREFLDSHGVRYFAVSHSPAYTAQEVAASAHVPGKEMAKT
FT                   VIVRLDGTMAMAVLPASRQLDFDRLREASGAADVCLAGEAEFAGRFPGCEPGAMPPFGN
FT                   LYGMEVFMDEELEDDDDIAFNAGTHRELLRLSYSDFSRLVRPKVAPISAAGGGLPSQ"
FT   gene            308726..309844
FT                   /locus_tag="Plut_0304"
FT   CDS_pept        308726..309844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0304"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23192"
FT                   /db_xref="GOA:Q3B639"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B639"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23192.1"
FT                   /translation="MKIALYAGTFVKDKDGAVKSIYQLVASFRKNGHEVVVWSPDVSPS
FT                   DDHGGVAVHAMPSVPIPLYPDYRLGFFSADTRRQLDLFEPDIVHISTPDIIGRKFLLYA
FT                   LKHRLPVASAYHTDFPSYLNYYRLGFAEGALWRYLAWFYNSCETVLAPNEIVRRNLLSH
FT                   GIRNVGIWSRGIDRELFHPGRRSETLRRSWNADGRKVLVFAGRFVWYKDIRIVMDLYRR
FT                   FQEEGKADRVRFVMIGSGPEEDALRRAMPEAVFTGYLTGTSLPEAYASGDIFLFPSTTE
FT                   AFCNVSLEAISCGLPAIVSDEGGCRDIVELSGGGLVARARDIDSFYRQCLGLLDDARRF
FT                   AIQREAGLAYAASQSWDVVNGALIERYQQMTS"
FT   gene            309968..312871
FT                   /locus_tag="Plut_0305"
FT   CDS_pept        309968..312871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0305"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23193"
FT                   /db_xref="GOA:Q3B638"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B638"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23193.1"
FT                   /translation="MATGRPSYSDLERRIEELERHAVESRIFEQVSLDRQALLRDQNIK
FT                   LVRKSIELSDVKRQLEQKNRELEFSRSQVEEAMDSLRRNENILNSILANSPGTIVSVDS
FT                   AHSIIYMNRPVPGFDAAFHVGDSLYNHLQGPGQDVFRMTVDRVFASERPPSIESEFTLP
FT                   DGGTAEVECRFGPCLQGGEVASVVVIMSDISPRKRMERDLQRSIGDLERFNRIMVGREM
FT                   HAIELQKELDMLSGRAVAHSCDGVSDDAGSPLSAVGADEDTGPDRNLQRTVLLNLIDEA
FT                   NQTRNELLEANRRLEESVLRTQLMAEEAREANAAKGQFLANMSHEIRTPMNGVIGMADL
FT                   LLETDLDQEQQKYVQTIISSGRNLLKIINDILDFSKIEAGRLELEHEEFELAELLEELG
FT                   CMLGPEAQAAGLELTLSIAPDGPTRLKGDPQRLRQVLVNLLGNAVKFTHEGGEVILEST
FT                   VQKETELYAVVRFSVRDSGIGIPQDRIDSIFEPFSQVDGSSVRRYGGTGLGLSISNHLV
FT                   GRMGGRINVQSTLDEGSTFWFDIILEKQPEQLSSSPPVFTGASPIILVAWSMVLGNALS
FT                   AFIESRGHRCLRPAGPEDVPGVLVGFASGPMPMLLLDMRCFGPDAEGFRDFVPVLAAYE
FT                   GLHVVLLVPMGCKEEMKTLAGGLSAIFLEKPVRRADLAGILKDHVREEGDGGIGKADQK
FT                   AARSGASQPPSAASPLNVLVVEDSMVNRNVAVSMLKKLGYSPDVAVCGTAALEAMRRKA
FT                   YDLVFMDCQMPEMDGYEATRHIREDEDLKGSRSVPVVAMTANAMKGDREKCINAGMDDY
FT                   IAKPLRKSDFKTIMDRYFPGMDRSLSEDGREQPLPARQPTADSVFMVEDVLQRLQQDRE
FT                   IIRIILSQFISTAEAELAAIADAAARNDMSRFRLLLHTMKGAAATVGAVELSRNAAELE
FT                   AAERSKDLKTFGRLLGNLNGCFQRFKERASATGWYDE"
FT   gene            312892..313803
FT                   /locus_tag="Plut_0306"
FT   CDS_pept        312892..313803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0306"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23194"
FT                   /db_xref="GOA:Q3B637"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B637"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23194.1"
FT                   /translation="MKIGFIGLGKMGFNMASQLLERGHQLVVFDLLPSAMVRIAEAGAE
FT                   AAASPAELCGSLPTPRIIWMMVPAGEPVDSTLEMLEPSLAPGDILIDGGNSRYLDSEER
FT                   ARRLAMKGIRFLDAGTSGGLDGARHGACLMVGGEKSAYEAVEPILKDLTVENGYGYMGP
FT                   SGSGHFVKMVHNGIEYGMMQAMGEGFGLLEASRYGLDLEDVARVWSHGSVIRGWLMELA
FT                   CDAFSRDGSLSYLEGKVADSGEGRWTVESALQHEVSIPVIAASLFSRYRSRSDNTFSDR
FT                   VVAALRHEFGGHSFTPPPAAEL"
FT   gene            313803..315227
FT                   /locus_tag="Plut_0307"
FT   CDS_pept        313803..315227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0307"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23195"
FT                   /db_xref="GOA:Q3B636"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B636"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23195.1"
FT                   /translation="MDNFTIVIFGATGDLAHRKLFPSVFDLALHQHLPDEYRVIGCGRR
FT                   SFSHQEFRDMVLRSLQDASGNAGFDDGVLNAFLRRLFYVRLDIAESEGYHRLYREIMDA
FT                   AGESGVCTHLLYYLAVSPGLLPVIVGNLSVAGLGGKDLPCTGWRKIIVEKPFGSDLQSA
FT                   RRMNAAVGEVFNEDQIFRIDHYLGKETVQNILVFRFSNGIFEPLWNRHYIASVSITIAE
FT                   DFGIRGRGAFYEEVGLLRDIIQNHALQLLASVAMEPPVDLQADSVRDEKSKVLRSIRRH
FT                   TPADAGSAVVLGQYEGYRNEKDVDPHSTVETFAAIRFFVDNWRWQGVPFYVKAGKNLSE
FT                   TRTQIVITFKCPPQNFFGPADSCSYTANQVIMTIQPEETIALRFGTKRPGEAVVTDPVY
FT                   MKFDYRNAFPGEGLTAYHRLLLDAIAGDRLNFIRQDSVEHAWEVVDAIRHSVDGTPPAP
FT                   YPVHSDGPADASLIYG"
FT   gene            complement(315218..316015)
FT                   /locus_tag="Plut_0308"
FT   CDS_pept        complement(315218..316015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0308"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23196"
FT                   /db_xref="GOA:Q3B635"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B635"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23196.1"
FT                   /translation="MDKSTEIFTGTPEELAEHAAAIIILEAWRSVSGQGFFAMALSGGN
FT                   SPRALYRLLRTGLHASRFLRHDLEPPKDGVQGDGTIGMPWNECLFFWGDERSLPPGDPR
FT                   SNYRMAEESLFHGMEAGGLRVYRMEGEKVPDTAAAAYESLIRQSPAGSGGALREGFPMF
FT                   DLVLLGLGPDGHTASLFPGNTGALEEKSRWVIAVQAPDLEPRVPRLTFTLPVLNHARTV
FT                   LFFVPSVERASLATSIISGQRPELPASRVRPVQGRTLWFKAQP"
FT   gene            complement(316029..318083)
FT                   /locus_tag="Plut_0309"
FT   CDS_pept        complement(316029..318083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0309"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23197"
FT                   /db_xref="GOA:Q3B634"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B634"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23197.1"
FT                   /translation="MKRRQEKPPEPDMAPDASDQLAINTVRILAVDMVERAQSGHPGMP
FT                   LGAAPMLFVLFRHIMRHNPRNPSWLNRDRFVLSAGHASAMLYAMLHLSGYDLTMEDLQQ
FT                   FRQLGSRTPGHPEYGLTPGVETTTGPLGQGIATAVGMAISERHAAAILNRGEIELIDHY
FT                   TYVICSDGDMMEGIGSEAASLAAHLQLGKLICLYDSNGISIEGPTSLAFTEDTSSRYRA
FT                   YGWHVQEVEDGNDTKAIHDAVMLAREESRRPSFIRVRTHIGYGSPNRQDTAKAHGEPLG
FT                   KEETALLKAAFGFPPEARFHVAPEVREHFRPVREQGEVLEATWNSMFGHYALRFPEIAQ
FT                   SLRDRLEGRLPEEWEDALPSFTPPQERATRQASQACLEAMAETIPFLIGGSADLGSSCG
FT                   TFLKGAASFTAENPGGATIHFGVREHSMGAILNGIALSGILRPYGATFLIFSDYMKPAI
FT                   RLSALMRLPVVFIFTHDSIGLGEDGPTHQPVEQLAMLRAMPNLTIIRPADANETKAAWA
FT                   LALGLKGPVALVLTRQKLPVLDRENDSCMEEVAKGGYILSDWSGAPAPEDAAIIIATGS
FT                   EVHISLQAKVMLEKEGIAARVVSMPSRELFLLQPEAWQHRVLPPRVTTRVVVEAASPFG
FT                   WDRFSGPSGCIIAIDRFGASGPGGAVMEALGFTASHIAETVRELRKNKT"
FT   gene            318203..318859
FT                   /locus_tag="Plut_0310"
FT   CDS_pept        318203..318859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23198"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B633"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23198.1"
FT                   /translation="MPLNDGYGVLAGTLGNWYCDHSREAGQYYHCNLRVRARGRYFRCP
FT                   VDLDSKHLPDGLEWRVVDPVPPFPVQLERLADGWHALESRPGTGAIDYYRSPELRPPAP
FT                   DPSPAAWMSGTGARAFRDLEPLLLQCRRIFVFGEPFRHGSGVHNIHQNQGDPPHSRWRR
FT                   ENGSWQDGAIFILRHDGTFAAFLCKFKTQKLFSPSEQDLSHGASEKRDTRPVRKD"
FT   gene            318870..319430
FT                   /locus_tag="Plut_0311"
FT   CDS_pept        318870..319430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23199"
FT                   /db_xref="GOA:Q3B632"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B632"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23199.1"
FT                   /translation="MVIDVAALRVEDLYADFDKKAPYHRKDFDDNLVEYLADCVQEIGR
FT                   SDFVIRFAFDQTPEDVLLEEVRSGINSFFIYLRALELAAIRKLLQVSFILLFSGLLMLV
FT                   ASLWLPGYFEIPPEGAAPSRILVEGITIAAWVAIWEALVRFLVDWPPKIRRVRRFRRIA
FT                   SAPVIFIPARELAEVAATIRSRG"
FT   gene            319524..320231
FT                   /locus_tag="Plut_0312"
FT   CDS_pept        319524..320231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23200"
FT                   /db_xref="InterPro:IPR032676"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B631"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23200.1"
FT                   /translation="MATMRTVAFSALLYIIVLFLPAPVLAAGTPPSRAAHIAAFAAAPA
FT                   LRSEISPKLLTVALSGYYRMLEQGEILREGVMTVIDFNRPSSEKRLFVIDIRNMSIIYS
FT                   SLVAHGSGSGGAKAARFSNEPGSFQSSLGFFTTGDTYAGRHGYSLRLEGLEEGVNDNAA
FT                   MRSIVIHGADYATRGFISKYGRLGRSQGCPALPPGSSRPVIDLIKGGSCLFIYHDSAGY
FT                   AASVPLPDPDRPS"
FT   sig_peptide     319524..319604
FT                   /locus_tag="Plut_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            320264..321904
FT                   /locus_tag="Plut_0313"
FT   CDS_pept        320264..321904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23201"
FT                   /db_xref="GOA:Q3B630"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B630"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23201.1"
FT                   /translation="MLLLLLILFAFSPAPPALEAAQPQNEVQQAAISRCIAGLRVAHPA
FT                   PDPHHTCVRQLYDLYAPREFRPLWTKRRFVDALLREIDSSATDGLDPDDYHRDAVLRLK
FT                   HSPPSTLDERVQAELLLSDAFLTLAAHLRYGKVDPLRLDPHWNFPGSGVRSAIGPGMHR
FT                   EPGEEGPAALLQEFRLRHPKYRMLRRALARYRAIAASGGWPVLPPGPALTPGMQSSRVP
FT                   ALRRRLAIVGDLESTLIRDSSTVFDPELSLAVRRFQERHGITVDGVPGLETRSAMNVPA
FT                   SVRVECLKVNLERYRWFLSDLDSTYVLVNIAGFSLQYVEDGEFRWATRVIVGRPYRKTP
FT                   VFKADMKAVVFNPRWVVPPTILKQDALPAIRKDPGWLRANHISVIDRNGRTVDPISVDW
FT                   SARSAATFPYRLQQAAGDDGALGRLKFLLPNPYLVYLHDTPKRELFLQSARTFSSGCIR
FT                   VENPRRLAQLVLADSVRWSPEQIDAQIDTGRTRTISLPKPVPVLILYLAAMAEGERVLF
FT                   RNDVYRRDTAVLQALQAPLPHYKTESCGF"
FT   sig_peptide     320264..320323
FT                   /locus_tag="Plut_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.551 at
FT                   residue 20"
FT   gene            321909..322379
FT                   /locus_tag="Plut_0314"
FT   CDS_pept        321909..322379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23202"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B629"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23202.1"
FT                   /translation="MSFTVEITVQREFRTASSPEDVFRLLADVPRSASYFPQVLQLVDL
FT                   GDNAYRWEMEKIGVGDYTLQQTIYASRYTSDPATLSVSWTPVEGVGNALVEGHWTLAST
FT                   GGGTAVALYSKGLLTVELPGFLQFLLSPLVTMEFEGLIDRYIRNLSAALGPE"
FT   gene            complement(322445..326122)
FT                   /locus_tag="Plut_0315"
FT   CDS_pept        complement(322445..326122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0315"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23203"
FT                   /db_xref="GOA:Q3B628"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B628"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23203.1"
FT                   /translation="MKATLRELLRERILVLDGAMGTMIQRHKLTENDYRGERFKSHTHP
FT                   LLGNNDILVLTRPDIIYQIHCDFLEAGSDIIETNTFNANPISQGDYGTEDLIKELNLEA
FT                   SRLARKAADSYTAKDPAKPRFVAGSIGPTNKTLSLSPDVNNPGYRAVSFRDVVDNYLLQ
FT                   LEGLMEGGVDVLLVETVFDTLNCKAALFAIEEFFTRTNKRVPVMVSGTVVDQSGRTLSG
FT                   QTTEAFWISIAHMPDLLSVGLNCALGSKQMRPFIEAISTVAESFVSVYPNAGLPNEFGE
FT                   YDDSPEYMADQIAGFAESGFVNIVGGCCGTTPGHIKAIADAVVALQPRKRPTASHELQL
FT                   SGLEPLRVNSTTGFINVGERTNVTGSKKFARLIREGNYDEALSIARQQVESGAQVIDVN
FT                   VDEGMLDSEKVMQEFLNLIASEPEIAKVPVMIDSSKWSVIEKGLQCVQGKSIVNSISLK
FT                   EGEEPFRQRAAKILEYGAATVVMAFDEAGQADSLERRKEICGRAYRILTEEVGFPPEDI
FT                   IFDPNVLTVATGIEEHDTYALDFIESVRWIKESLPHAKVSGGISNVSFSFRGNEPVREA
FT                   MHAAFLYHAIQAGLDMGIVNAGQLAIYEDIDPELLVRVEDVLLNRRSDATERLVSFAET
FT                   IRDGGEKTEAKAAEWRSLPVVERLRHALIKGIVEYIDEDTEEARKLYPSPLQVIEGPLM
FT                   DGMNAIGDLFAEGKMFLPQVVKSARVMKRSVAWLIPFIEEEKARNKDTKAAAKILLATV
FT                   KGDVHDIGKNIVSVVLSCNNYEVIDIGVMMPCEKILEAAVREKADIIGLSGLITPSLDE
FT                   MVHVAKEMERLGMKIPLILGGATTSKIHTAVKIAPVYSGPVVQVLDASRSVPVAGSLLN
FT                   PQLKEGYVAKLKDEQEAMRLGHAERSAAKRFVSVEEARRNRLRPDWNATLPPLPKKPGT
FT                   TVLDNVTAGALRPYIDWTPFFQTWELHGRYPEILSDPKVGAEATKLLGDANAMLDLIEK
FT                   EKLLGIRGVAGLFPAASAGDDIEVYTDETHTAVLATIHTLRQQQEKPAGEPNLALADFL
FT                   APKESGLKDHIGGFAVTTGLGIKPILERYRGMHDDYSAILLQALADRLAEAFAEMLHEK
FT                   VRRELWGYAPAEILGSEALIGEDYQGIRPAPGYPACPDHTEKAGLFTLLNAEANTGITL
FT                   TETYAMDPAASVSGFYFANPEARYFVLGKVQKDQVEDYAGRKGFSLQDAEKWLAPNLSY
FT                   "
FT   gene            326254..327123
FT                   /locus_tag="Plut_0316"
FT   CDS_pept        326254..327123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23204"
FT                   /db_xref="GOA:Q3B627"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B627"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23204.1"
FT                   /translation="MQRPMRILTFKAIVPMLFILQLVLPSSARAALPLGGFSFEAGPHM
FT                   SWFSYDEPGVMEESGLLYGVSGACSYRADNLPAGIDMLRLEAMIARGEVDYSSSGSGDL
FT                   SGIDERMYEIRLLASRDIFKGLRSTLSWYTGIAYRRLDDSSGGMVTTTQYCGYDRHSNY
FT                   WYSPIGMELVARQGAGWSIGGTLEYDAFWGGTQVSDLTDANNASYTYSDDLENSQSSGY
FT                   GWRAALMFRQEVGFGAMSFGPYFRYWNIDRSDVDTIVITENGVQRVTGFVEPDNNSSEY
FT                   GMAVSISF"
FT   sig_peptide     326254..326346
FT                   /locus_tag="Plut_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            complement(327113..327781)
FT                   /locus_tag="Plut_0317"
FT   CDS_pept        complement(327113..327781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0317"
FT                   /product="serine esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23205"
FT                   /db_xref="GOA:Q3B626"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B626"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23205.1"
FT                   /translation="MLKRQHRSLTTLELDPRGPEPAPLVIMLHGYGSNEKDLIQLAPDL
FT                   PATCRYVSPRAPVMLDMEMFGWFPIEFTPTGITVDYAAAALALDRFIAFTGELIETFSP
FT                   AGGKVFLMGFSQGAVMSYLTAFTRPDLLHGVIALSGQLPESSMPEGGGPEGLRALPFLV
FT                   MHGIYDDVLPIEKGRASEHWLKDRVDDISYHEYPVAHQISGEGVAAIRSWIEKRTTAKS
FT                   "
FT   gene            complement(327805..328908)
FT                   /locus_tag="Plut_0318"
FT   CDS_pept        complement(327805..328908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0318"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23206"
FT                   /db_xref="GOA:Q3B625"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B625"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23206.1"
FT                   /translation="MERKKKKVIVGLSGGVDSSVAACMLVREGYEVLGLHLKVLQEGDG
FT                   STVLEPSPMTISSREEFHIPVFTLNLAARFRNEVMDYFKEEYLAARTPNPCMVCNKTIK
FT                   WRGLLEGAAQLGADMVATGHYARTAFIDGRHRLFAGLDRKKDQSYFLWMLAQEELSRTI
FT                   LPLGGLTKPEVRDLARSFGLTAAEKKESQEICFVPDDDYGSYLESAVPGLHRRVEGGEI
FT                   LDPSGQVIGHHKGYPFYTIGQRRGLGTATGEPLYVTAIDPIGNLVHTGPKSALFSTSVE
FT                   VSHLNWIGIDPPFAPMEATAKIRYRDHASPCTIIPLGPGPTGVTARIMFKEPKSALTPG
FT                   QAAVFYRGEEVLGGGIIEGALPMEPHP"
FT   gene            complement(328913..330592)
FT                   /locus_tag="Plut_0319"
FT   CDS_pept        complement(328913..330592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0319"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23207"
FT                   /db_xref="GOA:Q3B624"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B624"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23207.1"
FT                   /translation="MNTEPETVEFDILFIGAGPANLTAAIHLRRLLRHHNAMAPDPLEP
FT                   SIAVIDKGRYPGAHLLSGAILDPRALREFMPDYLERGFPSGPAVSEEGIWYLTKNRKLR
FT                   FPSIPEAFSNRGNTLCSLSRVGAWMAELAEKEGIDLFEGTAAVGTVVEDGRLIGVLTDD
FT                   KGVDKNGTPGPAYEPGLVLKARATVIGEGAGGSLTAELDRIFNLHPPGAARNQETGMKE
FT                   CWRIPSGRISAGTVRHTFGYPLPSSRYGGGWIYALSDTELSVGFVTSVERHAPAADPHL
FT                   NLQRFKEHPFVRSLLEGGTILEAGARTITSGGYDAMGRISGEGFLLVGESAGMLDMRRL
FT                   KGIHLAMKSGMLAAETLFEALCQDDFSAGRLAGYEKQFRTSWAHDELALARSYRQAFDR
FT                   GIYHGLLQTGISLKFPGAGLAAGKAESTTKTSDPALESRKEMAALEKAEQAHRPDGTLT
FT                   FTKADAIYRSGTVHEENQPCHLRISSEDMAAICLDRCRREYGNPCTRFCPAGVYELTDG
FT                   GGALRINASNCLHCKTCEAADPYGIITWTPPEGGGGPGYKIS"
FT   gene            complement(330617..331999)
FT                   /locus_tag="Plut_0320"
FT   CDS_pept        complement(330617..331999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0320"
FT                   /product="Divalent cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23208"
FT                   /db_xref="GOA:Q3B623"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B623"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23208.1"
FT                   /translation="MLGTPLLPEIRELIERRNFSALQRIFNDWLPVDLAELISDLPENE
FT                   QAILFRLLPKDVATETFEYLDLDSQQNLLEALTQKDVTHILNSMSADDRTALLEELPGN
FT                   VTQELLRLLSFKEFKIAKTLLAYAEDSVGRLMSPDYLSVKKDWNINQVLEYIRTYGHES
FT                   ETLNVIYVVDDHGKLKGELMARELLLSSPEKKIRDIVSEDKIVTLTATQDQKDALDAFK
FT                   KYDTVALPVVDSNGYLIGIVTVDDMLDVAEEEETEDIQKFGGIEALEEPYIDLPIPQLI
FT                   KKRAVWLVVLFIGEMLTASAMAFFEEELAKAIVLATFIPLIISSGGNSGSQAATLIIRS
FT                   LALGEITIRDWWNVMRREIISGMALGGLLGLIGVFRVIVWAMVFGQLTMQWVYMSLTVG
FT                   ISLVGIVLFGTLAGSMLPLLLQHWGLDPATSSAPFVATLVDVTGIVIYFSVASLLLGGI
FT                   LL"
FT   gene            complement(332099..332689)
FT                   /locus_tag="Plut_0321"
FT   CDS_pept        complement(332099..332689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0321"
FT                   /product="Methylpurine-DNA glycosylase (MPG)"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23209"
FT                   /db_xref="GOA:Q3B622"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B622"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23209.1"
FT                   /translation="MTRLGKQFFTAPTLALTERLLGKIFVRITPSGTVLKGRIVETEAY
FT                   LGHNDEACHAWRKKTERNRVMFEAPGTLYVYFSYGCHHLLNIVTEPEGTAGAVLIRAME
FT                   PVEGIPCMQERRQTTVETALMSGPAKLTSALGVERSSSGRDLFGNEFFLLDAPSPQPSM
FT                   ICTSTRVGISRSRELPWRKYLADSPHVSKGRPS"
FT   gene            332794..333591
FT                   /locus_tag="Plut_0322"
FT   CDS_pept        332794..333591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0322"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23210"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B621"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23210.1"
FT                   /translation="MGRVIAIANQKGGVGKTTTAVNIAASIAISEFRTLLIDIDPQANA
FT                   TSGFGIDNGEEIDNTFYQVMVKGGEIKDAVMRSSLEYLDVLPSNVNLVGMEVELVNMRD
FT                   REYVMQKALKAVRNDYDYIIIDCPPSLGLITLNALTAADSVLIPVQAEYYALEGLGKLL
FT                   NTISIVRKHLNPKLDIEGVLVTMFDARLRLATQVAEEVKKFFKDKVYRTHIRRNVRLSE
FT                   APSHGMPALLYDAQSIGSKDYLDLVREMFERDGNIKKFKVRQQ"
FT   gene            333616..334503
FT                   /locus_tag="Plut_0323"
FT   CDS_pept        333616..334503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0323"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23211"
FT                   /db_xref="GOA:Q3B620"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B620"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23211.1"
FT                   /translation="MAKNALGKGLKALIPEEGFSRAGRDEVDVPMQDGVIGSLPVESIH
FT                   ANPFQPRKEFDETALEELMNSILENGVIQPVTVQRDGEGYQLISGERRLRAVRKAGYKF
FT                   IPAYVIEARSDSSKLELALIENIQREDLNAIEVALALKSLTTKCSLTQDEVAKKVGKNR
FT                   SSVSNFLRLLKLPLQVQDSIRSREISFGHARALINLPGEQQQLRVWKQVIAHQLSVRQT
FT                   EALVARMFREDGSADKKAKPEREPHVAELESLLRNKLATKVRIIEKKGGKGEIHIQYFS
FT                   GDDLERILEIMGDE"
FT   gene            334549..335295
FT                   /locus_tag="Plut_0324"
FT   CDS_pept        334549..335295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0324"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23212"
FT                   /db_xref="GOA:Q3B619"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B619"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23212.1"
FT                   /translation="MKFTLVGNGRMGREVAAVISRSGIHETAAVLDVDAKITPDSFRGS
FT                   DAIIDFTVRDAFLQNLDAMLASGVPVVAGTTGWDDVRAGVASKVKAAGGSLLYSANFSL
FT                   GVNIFLRTVREASRLIAPFEQFDIAFSEQHHTAKADFPSGTALAAAEHILAANSRKHSI
FT                   VRQLPDGRKIQPDELQVAAIRLGGVFGKHTAFIDSEADEIVISHTAKNRSGFASGAVET
FT                   AAWLALRHKTAPGFYTMDDFLNERLA"
FT   gene            335300..335815
FT                   /locus_tag="Plut_0325"
FT   CDS_pept        335300..335815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23213"
FT                   /db_xref="GOA:Q3B618"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B618"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23213.1"
FT                   /translation="MVFREKLFAVMLTASIVILTTTVPYLTLVNVFLFLGIFMAGSVGL
FT                   NRSILRFQVRLPYNEAFILAFFGGVVGGILSEAVSWVLMETLSYRPGTESLSLVISWVL
FT                   EMARDRPELNQQVQSLLEAEKLALAPLSLSLTDLVQSMLFSAAFYAPIAGFGGMWAVFR
FT                   LKRKAARR"
FT   gene            complement(335790..337277)
FT                   /locus_tag="Plut_0326"
FT   CDS_pept        complement(335790..337277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0326"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23214"
FT                   /db_xref="GOA:Q3B617"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B617"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23214.1"
FT                   /translation="MDPLRSPAPDPVADAASRFGPMPMLLTPDGSRSFKECSAMAGRIA
FT                   AALLNRGLRDGDGVAIISPNTPDMVLILLALLSAGMVAAPLNHRLPEARLRQMLQELQP
FT                   SLCITGAECPAPDTDTASIDAAELLAEASALPDRRSALLNHKGTTVRPITIIHTSASTG
FT                   TAKAAVHSLENHWYNALGSNSNLPFGPGDTWLLSLPLFHVGGYALIFRSLASGGALAID
FT                   RPHASLTDSLERFPISHLSLVPTQLFRLLYRENDPALTAGIKALLLGGSAASGSLVDEA
FT                   AARGLPIYLSYGSTEMASQIATTDAPVARHRSDSGRVLPWREVREAPDGELLVRGKCLC
FT                   TGYLRNGAIDPIGDPDGWFHTGDIGSLAADGTVRVLGRKDDMFISGGENIHPEEVERAL
FT                   REIEGVLEAVVAPVRDPEYGERPAAFIRTAGGDGPDDETLRREMQMRVGRLKTPVVFFR
FT                   VCQWTTLPGSEKTDRAWYRQMAAEYRRGESSGGLPCA"
FT   gene            complement(337265..338338)
FT                   /locus_tag="Plut_0327"
FT   CDS_pept        complement(337265..338338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0327"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23215"
FT                   /db_xref="GOA:Q3B616"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B616"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23215.1"
FT                   /translation="MTASYAYLYRYSLPFNEPVTVRGRRLLQRDGVLLALKTGDGKHTA
FT                   WGEIAPLSGLHRETTESAERQIVETLAMHGESGAALMTEGLFPSVRMGLEMAVMNLEAS
FT                   ISGRHPFSVPGESMLPRVPLNALLMGSTDVVLLRAQASYQEGYRAFKLKVGKENAEEAA
FT                   AAVHALHRLFGSQVELRLDANQSMPLDDAIAFARELPKNSVTYIEEPLLQPRDIPEYHA
FT                   KTGIRSALDETLWQKPGLLGALPPETIGALVLKPNCLGGVAAVLNLVRYAADHNMQAVF
FT                   SSAFESSISLGFYAILAAATSVRPAACGLDTFRHLKEDIQTTAFHAEGGSLDAASLYLD
FT                   TREVRTTNLSLASVWTL"
FT   gene            complement(338335..339156)
FT                   /locus_tag="Plut_0328"
FT   CDS_pept        complement(338335..339156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0328"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23216"
FT                   /db_xref="GOA:Q3B615"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B615"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23216.1"
FT                   /translation="MSSIAWSQCGEFSDILYHKAEGIAKITINRPERRNAFRPQTVEQM
FT                   IEALQDARNDEAVGVVILTGAGELAFCSGGDQKIRGNAGYADAKGVNKLNVLDFQRDIR
FT                   TCPKPVIAMVAGYAIGGGHVLHMLCDLTIAAENARFGQTGPRVGSFDGGWGASYMARLV
FT                   GQKKAREIWYLCRQYTAQEALDMGLVNTVVPLEKLEEETVQWCREILANSPLAIRCLKA
FT                   SLNADCDGQAGLQELAGNATLLYYMSEEGQEGRNAFVEKRKPDFSRFPKRP"
FT   gene            complement(339165..340070)
FT                   /locus_tag="Plut_0329"
FT   CDS_pept        complement(339165..340070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0329"
FT                   /product="thioesterase, menaquinone synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23217"
FT                   /db_xref="GOA:Q3B614"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B614"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23217.1"
FT                   /translation="MALTSACKWITEGAAGSLYCTMDTITPIQVPLRFTTIGDPSLPSV
FT                   VFLHGFLGSGSDWLPFTSGLSGSLHCILVDLPGHGGAVFRDNGPDGLQEESEASSGYFL
FT                   HTVDTLAEGLRKLLPAPGFLVGYSMGGRIGVALLLRHPELFQRAVIVSSSPGLRTEEER
FT                   LARRKSDEGTARKIERNFEGFLEFWYSQPLFSTLKSHPLFHEVETLRQKGSPRSLARAL
FT                   RLLGTGNQPSFWDQCAASPVPVQFMAGEKDPKYLEIGRQMVNLFPHSRLETFPGCGHTL
FT                   HIEARDRFQERLQHFFNQQD"
FT   gene            complement(340071..340793)
FT                   /locus_tag="Plut_0330"
FT   CDS_pept        complement(340071..340793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0330"
FT                   /product="Uridine kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23218"
FT                   /db_xref="GOA:Q3B613"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B613"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23218.1"
FT                   /translation="MLGDVLLINDQHKSAAGAILERVLLDIEQLRKNQPGEKFVVAISG
FT                   ESGAGKSELSHSLALLLKGRGIRVKILHTDNYYRVHPLQRREHRIQSNFEAVGVQEYDW
FT                   EQLHRNIGDFRQGRSVSIPCIDIITEEVDQLFTDFSKIQLLIIDGLYAIRTEGVDLRVF
FT                   IDLTYHDTKLSQMLRAKEPTDGYRWSVLEREHQHVRSLKPLADLHVDRDFRVFDPAIVR
FT                   HAPRPWQRRAAHAVTPAG"
FT   gene            complement(340893..342644)
FT                   /locus_tag="Plut_0331"
FT   CDS_pept        complement(340893..342644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0331"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23219"
FT                   /db_xref="GOA:Q3B612"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B612"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23219.1"
FT                   /translation="MNNRQATTIWSAVLVEELIRQNASMFCISPGSRSTPLTAAVARNP
FT                   RASWKMFPDERSAGFFALGHARATGRPAVLVCTSGTAVANYFPAVVEASADFVPMIVIS
FT                   ADRPFDLQECGANQTIRQDGIFGRYARWHMQLPQPSTEIPLQSLLSTVEHAVAKSLGAP
FT                   RGPVHLNQPFREPFDPEPLEGQDPWLEPLQAWKLDGRPRTSSAQPERRPDARAMATIRE
FT                   LLATARRPLLIAGSIPSPDDARAVASLADDLRIPLYADLSSGLRLTEGTLAWQQAFATP
FT                   AFLGRFRPDLVVHFGGRLIARHPSAALKAWKPAHYVVIREHPERYAPDHPVSLSLESSL
FT                   QTAAEGLMGCRSEPSAIKEPAEGFFLHCSGALDDLTEASIPLSEISAARQISQLITPGE
FT                   ALFTSNSMSVRELDSFAAALQPDGLPCGLNRGASGIDGIISTAAGYGEGLGRKVTLLIG
FT                   DIAFLHDLNALSLLRSLSRPMRIVLLNNNGGGIFSFLPVASCNDIFEEHFATPQHFHAQ
FT                   HAAGMFGLRYAAPRTNREFEECFLAAGEAPQSTIIEIASSRSENVEQHRTLQARFNAFA
FT                   ETAFTDR"
FT   gene            complement(342641..344062)
FT                   /locus_tag="Plut_0332"
FT   CDS_pept        complement(342641..344062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0332"
FT                   /product="Isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23220"
FT                   /db_xref="GOA:Q3B611"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B611"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23220.1"
FT                   /translation="MSDHHIIITPTETPLPIAQAAEAIQTALQQHGRDGANPLHPPGTL
FT                   MLFRQPLQPSDPAKWLAAQNIRPRIFWRNREQDYAAAGIGVADRITYSGREQNSSAFRI
FT                   LGESMAQKSRAARYFGGISFNNIEQQDHDWKNFPAFSFILPLLELSMENGACTLTCHIL
FT                   AGTPDETLARIEDARTLIASLPSDAGDNGERLPAVTGRSCSPDREGWIRNCGKAIATFE
FT                   DGSTEKIMLARKTTLEFASACNPMLFLLRHPYPQNSTYRFYFEPEEGCAFLSFTPERLY
FT                   RRDGSRLLTEALAGTCSKEGADLTDEHASRALLGSEKDIREHRFVKDMIYNELLPACSQ
FT                   IEMEDEVQVLQLNRLAHLYTRCSAVLKPECTDDGEVLSILHPTPAVGGVPKEEAMRHIM
FT                   ELEPFSRGWYAAPVGWIMRDAAEFAVGIRSALVNGTTASLYSGAGLVRGSDPELEWDEV
FT                   EQKIGDLLAITEDKA"
FT   gene            complement(344091..344705)
FT                   /locus_tag="Plut_0333"
FT   CDS_pept        complement(344091..344705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0333"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23221"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B610"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23221.1"
FT                   /translation="MKQSMLQPHTLLKRALIFIGLLALPVLSSCTKPQDDIRSLQQEVW
FT                   QHPDDTGALMNLANAFARSKRYDEAAEAYSGALKIDPELDAAYHSLGAVRFNQERYTEA
FT                   RDWFRKHLERAPSDSLRNYDLGNALMQLKDYRLAAEAYEAAIANSRSFTEAHYNLAVCF
FT                   THLDRMAEARQIYDWLLDKNNYLAVSLQSHLKGGKPDGQKP"
FT   sig_peptide     complement(344610..344705)
FT                   /locus_tag="Plut_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.818 at
FT                   residue 32"
FT   gene            344885..345091
FT                   /locus_tag="Plut_0334"
FT   CDS_pept        344885..345091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0334"
FT                   /product="heavy-metal-associated domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23222"
FT                   /db_xref="GOA:Q3B609"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B609"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23222.1"
FT                   /translation="MKQDVRVEGMTCGGCERSVKEALMELEGVLSAEASFLENVVRVDY
FT                   DPDMISIRAIMSVIVELGFRVVP"
FT   gene            345144..345887
FT                   /locus_tag="Plut_0335"
FT   CDS_pept        345144..345887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23223"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B608"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23223.1"
FT                   /translation="MAEDRSDRLAVLIDADNTQPSIIEGLLAEIAKFGTSNVKRIYGDW
FT                   TSTALKGWKEVLLEYSIQPIQQFGYTKGKNSTDSAMIIDAMDLLYTGRFNGFCIVSSDS
FT                   DFTKLAVRIREAGLTVYGFGEQKTPGPFVSACDKFIYTEVLRAKTNENEPIKRRSAADL
FT                   KQDTRLVRLLRNAVEASSDEAGWAHLAATGSNIAKQSPEFDPRNYGYGKLGELIAATKL
FT                   FEVDERIGGDGQSKSIYLRDRRKRS"
FT   gene            complement(345943..346020)
FT                   /gene="tRNA-Asp1"
FT                   /locus_tag="Plut_R0046"
FT   tRNA            complement(345943..346020)
FT                   /gene="tRNA-Asp1"
FT                   /locus_tag="Plut_R0046"
FT                   /product="tRNA-Asp"
FT   gene            346150..347493
FT                   /locus_tag="Plut_0336"
FT   CDS_pept        346150..347493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0336"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23224"
FT                   /db_xref="GOA:Q3B607"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B607"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23224.1"
FT                   /translation="MTTVNSSGSLTVTDNRTGKTYDIPVENGAFKTMDFRQIKVSDDDF
FT                   GLLGYDPGFLNTASCKSAITYIDGDRGILRYRGYPIEQLALHSTFLETAYLLIKGELPD
FT                   KERLAVWSYNIHHHTMTHANIVKFMDGFRYDAHPMGIMVGTVGALSTFYPDAKDIMNED
FT                   SRKLQVRRLIGKIPTLAAMSFRHSMGFPYVLPDNDLSYPGNFLSMMFKMTEQNYSPNPV
FT                   LERALDVLFILHADHEQNCSTNAVRAVGSSGVDPYTAVAAGCAALYGPKHGGANEAVIR
FT                   MLMEIGSIEKVPEFIKSVKAGSGRLMGFGHRVYKNYDPRAKIIKKIAFEVFEETGRSPL
FT                   LDIALELERIALEDDYFISRKLYPNVDFYSGLIYKAMGFPLDMFPVLFAIGRIPGWLSQ
FT                   WTEHVQDSDQKIARPRQLYLGEEARDWMPIESRPRNRMDEKKLDICRL"
FT   gene            347543..347830
FT                   /locus_tag="Plut_0337"
FT   CDS_pept        347543..347830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0337"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23225"
FT                   /db_xref="GOA:Q3B606"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B606"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23225.1"
FT                   /translation="MSVTRKDVDYIAELARLSFTDEEASRMTDELNSILHYVEKLGELD
FT                   TEGVLPLSNIHDQKNVLRDDVERPSISNAEALQNAPDRQDRFFKVPKVIG"
FT   gene            347838..348143
FT                   /locus_tag="Plut_0338"
FT   CDS_pept        347838..348143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23226"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B605"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23226.1"
FT                   /translation="MVEFHEKRGNAVFGVRVQPRSSKSAVSGPYGNALKVTLKAAPVDD
FT                   AANRECCRLFSKLFSIPDSRVSIVSGAASRTKSVMLEGLSAEEARSILRNSSIPGL"
FT   gene            348140..348895
FT                   /locus_tag="Plut_0339"
FT   CDS_pept        348140..348895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0339"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23227"
FT                   /db_xref="GOA:Q3B604"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B604"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23227.1"
FT                   /translation="MNAVILIPARLDSSRLPRKMLADLEGEPLIVRTWRQALRSNLASR
FT                   VVVAADSPEIAAVLEPLGAEVVLTSPTASCGTERIAEAARSIEADVFLNLQGDEPLISP
FT                   ENIDLALQPFFDAPAGSALPDCTTLVFPLGPDDRTQIDDPHVVKVVMDGEGNALYFSRS
FT                   PIPYVRNSSPSLRLYRHVGLYAFTAEVLQRFAAMPVSMLEEAESLEQLRLLESGFRIRC
FT                   VNTAVDNPGVNTPEDLELVRSLLRRASRA"
FT   gene            complement(348884..350092)
FT                   /locus_tag="Plut_0340"
FT   CDS_pept        complement(348884..350092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0340"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23228"
FT                   /db_xref="GOA:Q3B603"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B603"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23228.1"
FT                   /translation="MAEKTLSVSELTKRIKGELESIFPAVSVKGEVSNCKKHSSGHIYL
FT                   TLKDEGAQIPAVIWKHTAARIKTTVEDGICVIAEGRLEVYPPSGRYQLICSALTEEGEG
FT                   ALQLAFAALLRKLAGLGWFSEESKKMPPRFPETIGLITSPTGAVIEDMQNVLSRRFPSA
FT                   ALRLYPVKVQGRDAALSVREAISWFNRESRNRPDVIIIARGGGSMEDMQAFNEESVAEA
FT                   IHRSAIPIISAIGHETDITIADMVADLRAGTPSIAAELAVPDSLELLRHIAAHAATQSG
FT                   LVMGKVQGAEREVDSIRGSYAFNRPLSMLQQFEERVEGMRDRMARSLQGTYRNTLQRYQ
FT                   AALSHLNLLDYRKTLERGYVLVQKEGNVVTDGRSLKESEAVELWFHDGTIPASLTGKLR
FT                   SRP"
FT   gene            350256..351242
FT                   /locus_tag="Plut_0341"
FT   CDS_pept        350256..351242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23229"
FT                   /db_xref="GOA:Q3B602"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B602"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23229.1"
FT                   /translation="MAASDCIERLSGLLALDEGAAGSLLARFSRAMSAELLERGSVAVR
FT                   GLGSFRISYSPPLRESAESGWVYTAPSNAVVHGRRTGRDQTRYLLRTRLQMDEGDLKRT
FT                   SRALYKAFSGALGRNGALILPGFGRFREDASGHSVFRLEPGLHELINSDYQDLASIGMD
FT                   APLRRRRFASVAGAAALALVCFAAGFLTVRSGVVTDLAHLLTGVFRSEELPQPIPLPPP
FT                   PAPALSSGSVAENVLLEEGEFTIVLATFTRRPTAIREQARFDSAGITAVVWPARQDGRD
FT                   YWRLRTGRYRLRSEALEAMHGMPQRIAGGAYIQKVIKRVVSNGEKEL"
FT   gene            351223..352479
FT                   /locus_tag="Plut_0342"
FT   CDS_pept        351223..352479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0342"
FT                   /product="Chlorophyllide reductase subunit Y"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23230"
FT                   /db_xref="GOA:Q3B601"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010245"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B601"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23230.1"
FT                   /translation="MEKKNCKALHPQSMCPAFGGLRVLTRIDGSQVCLAADQGCLYGLT
FT                   FVSQFYAARKSIISPGLMNAEISGGTMIDDLRRTVEEIALDPSVRLIPVVSTCVAETAG
FT                   IAEELLPRRAGNAEVVLVRLPAFQIRTHPEAKDVAVATLLERFGDFTAPKKQRSVALIG
FT                   EIFPLDAMTVGSILQKIGVSSVVTLPGTALEDYREAGRAEVVAVLHPFYEKTADLIRSN
FT                   GGKIVEGNPIGANATAGWITRIGRALGLESEAVAAVAQEEAAKVRDVMGRFNTLDGRVI
FT                   VAGYEGNELPVVRLLLEAGLEVPYASTSIAKTPLCMEDDRVISMLGTEIRYRKFLEDDM
FT                   QAVEEYAPDLVIGTTSLDSFAKERGIPAIYYTNNISARPLFFAAGAATVLGMVAGLLQR
FT                   KDAWQTMREYFEGTRQGLL"
FT   gene            352476..354545
FT                   /locus_tag="Plut_0343"
FT   CDS_pept        352476..354545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0343"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23231"
FT                   /db_xref="GOA:Q3B600"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B600"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23231.1"
FT                   /translation="MSRIKQFRQRLFLLHPASLGGIFFLLFIVFLTSTLFEYRYRRLEI
FT                   EHMMEEEASLLIHALTVGAENAVEGYNGNRTILTGSLLGRLRLLDRLDRQKPLTSRALK
FT                   DIAGRGGMYRINVFDRTGRRIAWNVPPDHAPSLHHRDPKRELEPILSGRVDSLVLGIRQ
FT                   SVSDRGPRLIAAVARSRGGAIVGNVDASELLELRRSIGAGSLIRKIGAGEAGIDYIIWQ
FT                   DTTAILAATPNVSGADPLLADPVLAAALRARKPTTRMTEFDGRPVFEVVNPFYYRGANV
FT                   GLLRVGLRTDHFNAAFAKLRNRFFMMLGLLFFGGLALFNLVITRRDRALAAGAYQRVST
FT                   FSSSMLTSMADAVLSVNGAGALTLLNAAGERLFGVRADDVLGRSAASLSLELASLFAEA
FT                   ASGEFSVMKREFRCRAGGREHVLEGSFSRISEGQGGAEDWQGTVVVLRDLTEHHAMQER
FT                   LERQGKLTAMGELASGVAHEIRNPLNAIGLIAQRLDIEFTPKEDEAEFRHLLRTVVSEV
FT                   HRLNAIIQRFLRFARPPALEVVPTDLAAFAADYRAVLEGEASDKGVAFSLSGAPGTVAL
FT                   IDRDQMQQVLLNIVRNAVEATSRGGAVSVSVSADAGSAVIEVADTGKGTTPDERHRMFN
FT                   LYFTTKDDGTGMGLSIASQIVQSHGGTIEVNDRPGGGTVFRILVPQAPPSGGDS"
FT   gene            354578..355936
FT                   /locus_tag="Plut_0344"
FT   CDS_pept        354578..355936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0344"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23232"
FT                   /db_xref="GOA:Q3B5Z9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23232.1"
FT                   /translation="MGHTILVVEDERVQLESIAGFLLKQGYRVMTADRPAGALVIAGEE
FT                   AVDLVLSDFRMPGMSGVELLAGLKQLNPDIDVIIMTAFGSVESATEAMKLGAIDYITKP
FT                   VDLHRLIVMIRNTLERRQLASENRQLRRELAGRTGMAGVVSQSAAMNRVMSIASRAASS
FT                   SAAVLITGETGTGKELVARALHYGGDRREGPFIAVNCAALPESLLESELFGHEKGAFSG
FT                   ADRQRKGRFEAAAGGTLFIDEVGDIPQSLQVKLLRVLQEKTYERVGSSQSLKADVRIVA
FT                   ATNRDLEAMVADGGFRSDLFYRLNVVPIRIPPLRERREDIGPLVDAFLSRFSTENGKPL
FT                   CGLSREALDLLMKYPWPGNVRELENVIQQAVVLSRGDTIYMEELPLRVHEPKADIASAA
FT                   DGGFTRRVEAFERALIREALRDAGEVQTRAAELLGISERHLRYKLKKYGMKPG"
FT   gene            356142..356411
FT                   /locus_tag="Plut_0345"
FT   CDS_pept        356142..356411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23233"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23233.1"
FT                   /translation="MKKIIRFALAALALAAFLPSGSLQAKQWFGENPLKQVLGIGFTDA
FT                   DLDGYNDNAPDADGDGIPNGQDPDYVAVPAGTPTADCDGTGRLR"
FT   sig_peptide     356142..356219
FT                   /locus_tag="Plut_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 26"
FT   gene            356487..356864
FT                   /locus_tag="Plut_0346"
FT   CDS_pept        356487..356864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23234"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23234.1"
FT                   /translation="MNAPIKHLLIFFPVLCLLLLVPGDSPSGSAVAGPPLFRESGGGRV
FT                   PPEERLRFRDEDGDGINDLIRDSDGDGIPDGRDGDGSGPGDRRFRDGSMQGGGRSIERQ
FT                   GGSLRAPSSSGRPAGSGSGRK"
FT   sig_peptide     356487..356585
FT                   /locus_tag="Plut_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.966 at
FT                   residue 33"
FT   gene            356872..357972
FT                   /locus_tag="Plut_0347"
FT   CDS_pept        356872..357972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23235.1"
FT                   /translation="MPRSPLYAAVTLLLLALCPSGVFAIDGFDVSASVSSSVEDNVFRT
FT                   AGGEDDVIRAFSAGIAPHWKWTGCESAVFYDGTIVDFSRYSESSYAVHNAGATLDYFPK
FT                   SSIRVRGGIDLVIREGSGSTDLYDYSGNGVFCELQLPLSLDWTARGGLSRRTKEYRVLH
FT                   DFDNKESVASFHIEHRFPDGASFALRAEAGAKDYLGGPGSEARQLLTSLRVSLPMGERT
FT                   GLRLRVSDRLSFGGEALVASGVAADGYWLEDLYDDPYGYEGMEGDAMVSHLFQGGVMLR
FT                   IGCGAKLKSYDRAVLDGDGVWLADGPRREDVCLEASAGAEKTLRLNRQGALLKLSAGWY
FT                   VSWSESNDALYRYRASSAGLGAEVLF"
FT   sig_peptide     356872..356946
FT                   /locus_tag="Plut_0347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.800 at
FT                   residue 25"
FT   gene            complement(358001..358561)
FT                   /locus_tag="Plut_0348"
FT   CDS_pept        complement(358001..358561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0348"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23236"
FT                   /db_xref="GOA:Q3B5Z5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5Z5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23236.1"
FT                   /translation="MNVKDVSQKSEQKMKKAIEAFQHEIASIRTGKATTALLDRVKVEA
FT                   YGQTMPLRQVGNVGVSDIHTLLVQVWDKSMVAATEKAIRDANLGLNPAAEGQSIRVSIP
FT                   PLTEERRKEFVKLTRKFGEDSKVSLRNHRRDMIQEIEKLEKEKAISEDDRNRGKKDADD
FT                   LLHRFEKQVNELIAQKEKEIMEV"
FT   gene            complement(358610..358837)
FT                   /locus_tag="Plut_0349"
FT   CDS_pept        complement(358610..358837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0349"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23237"
FT                   /db_xref="GOA:Q3B5Z4"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5Z4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23237.1"
FT                   /translation="MKSDIHPKYTEVTVVCANCGNSFETRSTRPSIKVDVCSNCHPFYT
FT                   GKQTLVDTAGRVDRFNKRFAKSTASQAQAK"
FT   gene            358918..361029
FT                   /locus_tag="Plut_0350"
FT   CDS_pept        358918..361029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0350"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23238"
FT                   /db_xref="GOA:Q3B5Z3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23238.1"
FT                   /translation="MAESSPLSSLKGMGPKKVAILHDAGLVSFEDLFELFPRRYLDRRV
FT                   MKPVRDLRAGETATVVGTITAASVDAGQRGRSRFRATLSDGSGTLELTWFRGVRYFARA
FT                   VVPGETLAVHGKVGYFGARAQMQHPDFDRLGSDRHEDGGSDLSLYNTGRIIPLYPTTEA
FT                   MKLSGLGSRQLRSLMAQAFELQPPGARENLSRSILDSNSLMPLAEAYREIHFPSSPERL
FT                   GIAERRMKWTELFYAQLLFALRRHTARHLRQAAVFTHSGEYTSRLYASLPYELTAAQKD
FT                   AIREIYRDLRSGSPMQRLLQGDVGSGKTAVAMFSMALAADNKLQSVFMAPTEILAVQHW
FT                   LSMRRFFEPLGLEVALFSGRQPKRLREELLLRLREGDVHVAVGTHALIEDAVRYRELGL
FT                   VIIDEQHRFGVLQRKALQEKASNPHVLLMTATPIPRTLTMGVFGDLDVSVIRQMPAGRR
FT                   PVKTIVRPESEQAKVHQFLRREIADGHQGYIVYPLVEASEKTDLQAAVESFGELSGAVF
FT                   PDLRLGLIHGQMSPEEKDGVMQRFRTGELHILVGTTVIEVGVDVPNATVIIVEHAERFG
FT                   LAQLHQLRGRVGRGQHPSHCFLLYGKLTGDGRERLQAMESTSDGFVISEMDARIRGAGN
FT                   VLGKEQSGSLSGLKIADLSLDFDIMQSARSAAFALVEADSRLALPENEPVRRWYMDRYL
FT                   GRQTLADIG"
FT   gene            361051..362049
FT                   /locus_tag="Plut_0351"
FT   CDS_pept        361051..362049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0351"
FT                   /product="GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23239"
FT                   /db_xref="GOA:Q3B5Z2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23239.1"
FT                   /translation="MVIYNATSKMNPDETAGTRSCALPACMVVEAAGAFYMAESPDGTI
FT                   YRCRTIPLTKTENEGTSLVAVGDMVLLRLSPGEGAVPEAVIVTVLRRHSALCRKRDIRR
FT                   NRSKEKVQVIAANIDQLVVVSSAFDPPPNLRLIDRYLAFAESEQLEPLLVVNKADLDPM
FT                   GDAVRSMELYRDLGFRVLHLSAKKGAGMDRFLAALDGRVSAFSGHSGVGKSSLINRILG
FT                   QQLLTTSRTSIRTGKGVHTTSRSVMLRLPGGGHVIDTPGIREFSLSGISRENLRFFFRE
FT                   FLPLMPSCSFSSCSHTVEPGCAVRSAVSTGLLHPSRYESYLALYEGLEDGD"
FT   gene            362144..363517
FT                   /locus_tag="Plut_0352"
FT   CDS_pept        362144..363517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0352"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23240"
FT                   /db_xref="GOA:Q3B5Z1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23240.1"
FT                   /translation="MITTINPATEEQLASYPAMDALELTEVISLADRDYRRWRTVAPLE
FT                   RRAAMHRLAALLEAEKQQHAEMISREMGKPLSQAVAEVKKSALVCSYYAEHADRFLQSE
FT                   ESDLDGMQGVVRFDPIGLVLGVMPWNFPFWQVFRFAVPAIMAGNGILVKHAPNVTGSSV
FT                   AMESLFRRAGFPEHLYRAVHIDLEDVDRLTGFIIDHPAVSAVSVTGSTGAGRAVATKAG
FT                   HALKRSVLELGGSDPYIVLDDADVSAAVNHCAAARLLNSGQSCIAAKRFIVHASVMEVF
FT                   EEQLLVRMRSAVMGDPFHPDVEVGPIARLDLRDQLHDQVRRSVEGGAKLLCGGSIPERK
FT                   GYYYPPTVLSGVRAGMACYSEELFGPVATLIEAKDDDEAVHIANDTPFGLGSAVFSANI
FT                   ERAMLIAARLDTGNCFINTMVKSDPRLPFGGVKQSGYGRELARYGIREFVNIKSLCIA"
FT   gene            complement(363615..364844)
FT                   /locus_tag="Plut_0353"
FT   CDS_pept        complement(363615..364844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23241"
FT                   /db_xref="GOA:Q3B5Z0"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Z0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23241.1"
FT                   /translation="MYFTLQRNTMTEGDEKATRQTHWESRHEQEGYVKKIRQVKGRILH
FT                   TWVEAERDIALNTMDNRMLDEVVQDCRLKDLPVCLIWDLSHVGTITLHYKQSIADIIFN
FT                   WAPGFSRIVFFNIPEAIRIIVESFAAVAPEGISVMTAGSYEEAERKAAAEEHEKNETEP
FT                   TESHTRAKNEFLAAIARISWMNMLEQHIPIPQPDNRFHSFFKAVEAMQSDLRAKEDEKE
FT                   MELNQLKQDLEQRLTHMVIKMNAQTELNRKSGRDFEKEISELKSRIATQDMELTRVSTA
FT                   IAEKTSSLRNLLDQIYALDIDPTQKRQMTDSCLSLIETETIEKRLNIELTEADSVFLSK
FT                   LQKKHANLNQRELRISLLVKLNYDTREIARSVGISTRGMESIRYRMHKKLGLGKHQSIK
FT                   TYLSDLSITM"
FT   gene            364983..365957
FT                   /locus_tag="Plut_0354"
FT   CDS_pept        364983..365957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23242"
FT                   /db_xref="GOA:Q3B5Y9"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23242.1"
FT                   /translation="MCAGIRRIFLHATPFPMSLETGYTFIVNPHADKGRAAGRVSALRR
FT                   AVQGRADAEVLSTVRAGHAGELAAEAARGGRAVIACGGDGTLHEVLNAVMGAGSAVGVL
FT                   PFGSANDFLKTFVPAMSGGRSPESQFSGGRIRVDVGRVEFSGGEQRHFLNSLGIGFTGR
FT                   IARAVRRAPWLRGELAYAYALFRVLIGYAPVKMHIQITLPDRLVVLDERVFAFSVGNGK
FT                   VEGGKFQIAPEADLRDGLLDVCILRDVPKREIPGLVLQYLRGVQSRDRRVYSYRAERID
FT                   VSLDSPEVMHLDGEVYEGVGGKITVAVLPEGLEMIAPRGMGER"
FT   gene            365997..367244
FT                   /locus_tag="Plut_0355"
FT   CDS_pept        365997..367244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23243"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023917"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23243.1"
FT                   /translation="MQILVFEDALAERLMPLAGLKPVYGLATGFRTLREKFEHYAPGVS
FT                   FTFHMRRRLARWYAMAYPAAPVNILMEDDILLVNGRLVCDAVTGALIEAGAFTPGTASM
FT                   QDGEVLFARIKPSLIAETDGSLPDLIDSRRLAEGLSIERVEGFRLLSNLWDPVAMHPGE
FT                   LLRDAESLPLGRIDGDVHPSAVITDPSATWVAPGAVVRAGAVLDADGGFVAVGPGAVVE
FT                   PLALVTENVYAGAGCRVKAAARVYSNVSIGTGSKVGGEVEDSLIEPFANKQHDGFLGHS
FT                   YISSWCNLGAGTTTSDLKNNYGPVRILCGGREEETGLRFLGLMMAEHCRSSIGTLFNTG
FT                   TVAGYGCNIFGAGFPPKEIPSFAWGGSGGFIPHEVDRAFQTARTAMARRNVAAGPEYEA
FT                   MFRSAASATGLHSVSV"
FT   gene            367266..367835
FT                   /locus_tag="Plut_0356"
FT   CDS_pept        367266..367835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0356"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23244"
FT                   /db_xref="GOA:Q3B5Y7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23244.1"
FT                   /translation="MILVIDNYDSFTYNLVQYIGEAGAEVSVFRNDEISVEDVLSMAPR
FT                   GIVISPGPGTPDDAGISVPLIHALKGRIPLFGVCLGHQSIGAALGGRVVRAREIMHGKT
FT                   SEVYHDGEGVFRNLLNPFPATRYHSLIVEKESLPKELTVRAWTEDGVIMGMDSTALRLY
FT                   GVQFHPESIMTGEGMKIIRNFLELSR"
FT   gene            367840..368577
FT                   /locus_tag="Plut_0357"
FT   CDS_pept        367840..368577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23245"
FT                   /db_xref="GOA:Q3B5Y6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23245.1"
FT                   /translation="MDPKPEPPPPGGRTPSPLPPPLPANGHEGDFMVDGWRVFKIMAEF
FT                   VSGFEIMSDAGPAVSVFGSTRVAEGSEEYRQARRMGSLLAEEGLAVVTGGGPGVMEAAN
FT                   RGAQEAGGSSIGFNIKLPNQQTPNSYIDPGRLVGFQYFFVRKVMFLKYSQAFVALPGGF
FT                   GTLDEVSEAITLIQTGKSARFPVILVGKSYWDGLYRWICDTMLRDHGFISPPDLGFIYL
FT                   VDTPEEVLPIIRTFYPEGYSLNF"
FT   gene            complement(368596..369033)
FT                   /locus_tag="Plut_0358"
FT   CDS_pept        complement(368596..369033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23246"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23246.1"
FT                   /translation="MRPTLRSAAGWAVLALMLMQFIPLGRLNPEPHLSIKAPAPILQAL
FT                   GKACYDCHSYRTRWPRAAYVAPASWLIVHSVRSGREALNFSDWNRSLMQQSDSLRNTMM
FT                   KVVMKGSRHQPMYYILNPESRLTAREEGALVTWLKATAIQH"
FT   sig_peptide     complement(368956..369033)
FT                   /locus_tag="Plut_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.693) with cleavage site probability 0.559 at
FT                   residue 26"
FT   gene            369087..369413
FT                   /locus_tag="Plut_0359"
FT   CDS_pept        369087..369413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23247"
FT                   /db_xref="GOA:Q3B5Y4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23247.1"
FT                   /translation="MIFPCEKAVWYNLPQIRADLAIELVKTGMTQSQAAKLLGVTPAAV
FT                   SQYIHRKRGLQVSKTKVYRQEIKVAAKKLQDGVVPEELRFMVCKCCQILSRESGDGQAV
FT                   CGTE"
FT   gene            complement(369424..371115)
FT                   /locus_tag="Plut_0360"
FT   CDS_pept        complement(369424..371115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23248"
FT                   /db_xref="GOA:Q3B5Y3"
FT                   /db_xref="InterPro:IPR011199"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5Y3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23248.1"
FT                   /translation="MNTFLLDYNTILTPKKGFPKLFRDYTSEGSQRDSLLGRCFHLDDR
FT                   KEADYYRQLGLLASRRFQRDSLVDMLQTQNRRFGGGEVREREIEKLRSPRCMAVVTGQQ
FT                   LGLFTGPLYTIYKALSAVVFAERQKALFPEYDFVPVFWLEGEDHDYDEPAHTAIFSGSG
FT                   LTHFRPETNRRLPDQMVGSTCFDASIQNTLEAFLDMLPPSDYREEVATILRECYFPGNT
FT                   FEGAFASMLLRLMPKEPLILLSSFDPAFKRMAAGVFTREIETAPASSYNVVAQSSTLEE
FT                   LGYGAQTKPRAVNLFHLNQHGQRQKIEHPSPDLFTLAGESRQYSRHQMLELVSDHPERF
FT                   SPNVVLRPIVQDTVLPTFAYVAGPGEISYLAQYRRNYEHFGITMPFIVPRGSFTLVEPK
FT                   ISRIMDRMLQVTGRPGFSRKQIYAAVFSDLEGMKKKAVETAENRSLEPLFQEAREEIQR
FT                   ALDRLLPTLSKIDPTLEPMLGASKAQAEKIVENIEQKTWKAGRRKHEELLEQILKAETA
FT                   LFPEGGPQERLLNICYFLNKYGTGLIGTLKEQLQGHSSESHIILEL"
FT   gene            complement(371120..371899)
FT                   /locus_tag="Plut_0361"
FT   CDS_pept        complement(371120..371899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0361"
FT                   /product="3'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23249"
FT                   /db_xref="GOA:Q3B5Y2"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5Y2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23249.1"
FT                   /translation="MKKQDRRPEILVCNDDGIEGEGIHVLAASMKKLGNVTVVAPAEPH
FT                   SGMSHAMTLGVPLRIREFRRNNRFFGHTVSGTPVDCIKVALSHIMKVKPDLIVSGINYG
FT                   SNTAMSTLYSGTVAAALEGAIQGVTSLAFSLTTYEHADFTYAGKFARKLARKVLQEGLP
FT                   EDTILSVNIPNVPEADIQGVRITGQGRSRWSEDAIERNDMYGNPYYWLNGTLMLLDEGM
FT                   ESDEFAVRRNFVTLTPLSCDLTRHGFRSTLEQWKLKK"
FT   gene            complement(371913..374540)
FT                   /locus_tag="Plut_0362"
FT   CDS_pept        complement(371913..374540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23250"
FT                   /db_xref="GOA:Q3B5Y1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Y1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23250.1"
FT                   /translation="MRPFRKTVGLALSGGGANGISQIGVLKALEEEQVPIDHIAGTSMG
FT                   AVIGGLYSCGYTPSELQAIAHSLPWQSIVTIGNDDYSRSNVFLEQQRVRDRSTVAIRFD
FT                   KLKLVIPRSLNSAQALTETLDLLVINALYPASGDFNELPVQFRAVTTDLVTGRRVTLSS
FT                   GSLSEAMRASSTIPVLFSPIRRGSEELVDGGLVANLPVDELDAFDAGYRIAVDTHGSMY
FT                   ATGRELDLPWKAADQAMTILTKLQYPAQLERADIVIAPDLEGRMATDFSDIDGLVKVGY
FT                   QKGKVLAGTIKRSIAEGEGRSAPSPIKGWRKEVQFPEESAEYIEHYRIVSGIVRNATDT
FT                   RMALRELLETDLFTRVWAELDSRRKRVVFHLVPLPAIRQVRISGGPTGVLSFDEQAACF
FT                   APVMERVYTNRAGTLALENLVRAYRQKGYVFVNLKSPSLSGGTISVALTSGKAGSIVIS
FT                   QDRNITGPTPVQREIKIDTSRAVIYGKAKESVENLYETGVFSRVSLAAEQPDPDDEHLQ
FT                   SALLKFTLDEKPATVLRIGLRYDETSNAQFLLDYRNENLWGSTSSLGGWLKTGTKNNVV
FT                   NLEFNMPRIAATNLTMSSRAFYDQHGFDHSSITFDKEFLADLSERTGTYNIERYGISTA
FT                   FGTRLKKNGKLIVDATLQSVRSENETENGVPLQTGKAELVTLGTQLSIDSRDSPLIPTT
FT                   GSLSNLRYSATPVTLDNEELFWQLSGNHEENIPVAPRTTLQLSGMFGVSSGHVPLSEQF
FT                   FLGGPGTAYSRRFIGLKESALPGNNMAAAGVQLQYSPPGDIIFPTSLRLIYNAGNVWDR
FT                   REDIALAQLIHGIGTSLVWATPIGPARFTISKAFSFMRNAEDKESSNLRFADTVYYFSL
FT                   GHDF"
FT   sig_peptide     complement(374481..374540)
FT                   /locus_tag="Plut_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.456 at
FT                   residue 20"
FT   gene            374816..375661
FT                   /locus_tag="Plut_0363"
FT   CDS_pept        374816..375661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0363"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23251"
FT                   /db_xref="GOA:Q3B5Y0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5Y0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23251.1"
FT                   /translation="MVWFKRVKPFIRTTDRRDVPEGLWSKCEDCGAMLHRRQLEENLNT
FT                   CNECGHHFRISPYRYFSILFDNEEFTEFDDCLRAADPLTFVDTKKYPDRVHDTIEKSGK
FT                   TEACRNAFGKSAGADLVISAMDFGFIGGSMGSVVGEKISRAADKAIELNAPLIVISQSG
FT                   GARMMEGAFSLMQMAKTAARLTRLGENRLPFISLMTDPTMGGISASFAMLGDLNISEPK
FT                   ALIGFAGPRVIRDTIKRDLPEGFQRAEFLQEHGFVDMIVHRKELKQRLAKTLAMMRVEG
FT                   "
FT   gene            376391..378469
FT                   /locus_tag="Plut_0364"
FT   CDS_pept        376391..378469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0364"
FT                   /product="Subtilisin-like protein serine proteases-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23252"
FT                   /db_xref="GOA:Q3B5X9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23252.1"
FT                   /translation="MKKSTPASILQQHREQHFPGQQSPLSLGNDAELLSRFGSHAYDSL
FT                   YDVLEPLSRISDDDRHGPGSIDTDFTPGGAGRRVDRVAPEVLAFSPSDGSLNVALDADV
FT                   VVTFSESVAAGSGLIELHAGSATGELLYTFDVSDTSQVSFAGNVLTIDPSFDLDADIHY
FT                   YLTIGFGAVTDLAGNAYVGTSSYDFTTISLADATAPTVTAFSPADGSLDVDTDANITIT
FT                   FSEAVSAGSGLIELHADSPAGELIYGFDVTDGSQVSFDGNVLTIDPSFDLDAATHYYLA
FT                   IGDGAVTDLAGNSYVGTDAYDFTTGFDAPSWDPVSGYGMVDAAAAIELATGTALADADL
FT                   FGDGYGVWDWGLNLIDAPDAWQAGYTGEGIVVAVIDTGVNYFHSDLYDNIWINTLEIEG
FT                   NGIDDDGNGYVDDIFGYDFVNDDGYAFDDNGHGTHVSGIIAGLYDDIGVTGVAYDASIM
FT                   AVKVLDAEGTGTFLDVSSGIYYAVDNGADVINLSLGAYDAVSLDLVLALEYAFDSGVIV
FT                   SMAAGNDGLSSPTYPAVLAETEGGIAVGAIDSDGSVAYFSNDAGSVDPYDYVVAPGVSV
FT                   YSTYLDDSYAIMSGTSMATPYVSGVAALLLDAQADFASDWTLDQLEEIISTSAQSLDSL
FT                   IAAATGDPSSESDDALASALPADTAPEGVFTTDVVLEEVSMMGISSFLDDLPEVYMA"
FT   gene            378649..379758
FT                   /locus_tag="Plut_0365"
FT   CDS_pept        378649..379758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23253"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23253.1"
FT                   /translation="MRKMDAAEWQGVRVVNYAITRGMAENAHPWVKDFEVKAIRGEACF
FT                   RRAMKLKAAGYTPDVIVAHHGWGESLFLKEVWPEAKLGIYCEFYYRAHGADVGFDPEFP
FT                   QADPEGAACRLRLRNLNNMLHFETADGAISPTEWQAATFPEPFREKITVAHDGIDTARL
FT                   APDPGVKLRLGSGLMLTKKDEVVTFVNRNFEPYRGYHTFMRVLPEILRRRRGARVLIVG
FT                   GDGVSYGAKAPDGKSWKRIFIDEVRPKIGDADWQRVHFLGRVPYADFVRLLLEAMSCGC
FT                   AILGSDTGPLIEAIHHDETGRLVNFFDQGRLAEEACALLDDPDARRRLGENARRFARET
FT                   YDLNRVCLPKQLAWVEGLVPLSSSRAPRP"
FT   gene            complement(379730..380449)
FT                   /locus_tag="Plut_0366"
FT   CDS_pept        complement(379730..380449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0366"
FT                   /product="Thymidylate synthase complementing protein ThyX"
FT                   /EC_number="2.1.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23254"
FT                   /db_xref="GOA:Q3B5X7"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23254.1"
FT                   /translation="MPELEGTGCRCIFRFLNHSSRPPMQVRLIALTAPQINIEGQSLTA
FT                   EGLMAYCARVSSPHQESADYEKLLAYCIAHKHWSIFEMADMTVEIVTSRAISPQILRHR
FT                   SFTFQEFSMRYSKAQAIERYTPRRQDSKNRQNSLDDLPPETVAWFDEAQERVATESMAL
FT                   YEAALEKGIAKECARAMLPLATQTKLYMKGSIRSWIHYLEVRTDPATQKEHRDIALEIR
FT                   KIFVERFPVTASALGWS"
FT   gene            380653..400689
FT                   /locus_tag="Plut_0367"
FT   CDS_pept        380653..400689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0367"
FT                   /product="VCBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23255"
FT                   /db_xref="GOA:Q3B5X6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR001759"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR034007"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="InterPro:IPR041690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23255.1"
FT                   /translation="MSGPLDNKRRGKGMFLALEPRILLDAAAAVLAGDLIQEALTADSD
FT                   AGTVECAQVEPTADAEDAATDSPETQADAYDTADSADAAASPLDAAAEVHPVDIVPAAD
FT                   GSADARHEIAFVDASVPEADSLASGLPDRVEVYRIDAGSSGIAQITEILNTRTDIDAVH
FT                   ILSHGTSGSLRIGSDTLSTDTIDFYASQLTAIGRSLSADGDILLYGCDIGQDSDFVLRF
FT                   SQITGADVAASTDDTGSAALGGDWELEHEVGTIDADAIVSDDYSGILGDYALSFDGGND
FT                   YARSASAVNLGNTFTISFWMNAESLKNYGDPLSAGTADYHLSFLTYQDGKMLFIAGDGS
FT                   SWGNGVTTTSGTFSAGTWYHIVGVATGSNLQLYVNGSLYGTSESNSSPVNDVINIGARP
FT                   ATGYYFDGRVDEVGIWNEAFNAATISALYNGGSPISLTADATNYTGHTDNLLAYWKFNE
FT                   GSGTTVADSSSHANALTVYDGSSVAASWAVGAMNAPAVGSGQALDFDGVDDKVVVADSG
FT                   ALDLSGSFTIEAWIMPQGSGSSSTDGGMILNKENSYEIAWHGDGSIYYALNDDDTSLDW
FT                   AWVDTGLDAPVDQWSHLAFIKSSTSLKVILTSEAGESLTYAASTFAGQPEPTTEPLTIG
FT                   GRPAGTYFNGLIDEVRIWSDARTDTEITTSLYTRLSGTEQGLVGSWDFEEPSGTTAYDR
FT                   SPSANNGTLTNFVSTDRTSESAPVSERAGALVLDGTDDYLRVENHSELEITGDVTVAVW
FT                   AKFDVLDGWDIMAIQGNGEGDDNTLYMFGVSTSGGSSKLVAYWEYDSGGSDYYAYSTVS
FT                   VTVNTSDWHHYAMVRDSVARTVSFYIDGDKFGDAVSYTNNAYKSLTGPLTIGASTTSTG
FT                   AHNFIDGKIDDLRIYSRALSGAEIAASKDTELNGSESGLVAYYSFNDAGGSVAVDSSPN
FT                   RLDGTLYGGVSLTTAASPVQRATGMGLVFDGTDDYVNAGANAALQITGDLTVETWANFE
FT                   SLDHNSAPSTLVLQGLGNIDNSQSSNNILYLFRINTDKTLNVFWEYATGTNVTLTSTIA
FT                   ASVNAGEWHHYSFVRDAANKTLTFLVDGVKLGEAISYSSNPVGGDSTPLIIGAEYQNDG
FT                   AVVSEFKGMIDDVRIWNVARSAAEIAAAMSSRLASTTANLVANFRLDEQGSSTIKSSNG
FT                   TYTGTLSGNPQFVTNYYIDTLVTDQGTGILPAYDVDTSGTLTFSTTRAPLKGTLTWTDA
FT                   AAGAFTYTPNAAATGIDTFFYEVSDGSLTSAPREVLVSILDGNQALDFDGVDDYVDLGI
FT                   NQTTLGNTFTISAWVNPDGVWTNYRGIAGDHYDSLESGGTAGINFGQYNSAEPEGAGIV
FT                   FTIGTGVEQVWSSVRIDTSLIPANDWSHVSMVVSADATTADNYIKVYVNGLLVGEKTGV
FT                   AAFTPKDGFTIGRAFNGNDRYFDGQIDEFQIWDTARSEAEIREYMYRELPDMVVSGGDL
FT                   VAYYRFNESSGTLLYDARGGADGTLLHMDDADRVTSAAQFGPKNALDFDGTNDYVNLGS
FT                   FTDFYGSNYDSDYTISAWVKPADTASNQSIFYARENTADEKYLDLRVNSDGTLTFIVRT
FT                   IYPDTQGLVTSTVRVDDGRWHNVTAVKSGSVHTLYIDGVSAGMFTLGENPMQLDYFYIG
FT                   ASRTDNNNIAQFFNGRIDEFRLWDKALSASELRDTMMRSLTGNESGLAAYYNFDNTSGT
FT                   TLQDFSGGRHDGTLTNMDAATDWVASVAFNTWLNTSSTAWAMATNWSLGSVPVSTDNVG
FT                   IYSYAGSSSPTLSSAATVNNFLLGTGATFTLSANLTVNGSLILENDLDLNGQVITLGGS
FT                   AMLVEDGGRAYGTSGSITTTRTLSNISGVDVAGLGAEITTVADMGSTIITRTHVADTEP
FT                   VTLKRSYTLTPITNTGLNATLVFHYDDQELNGLNESDLKLYTSTDSGSTWTFIGGTVDA
FT                   TANTVTLAGLGSLSLVTLGVNAPAVTASAGTTAFTESASASASGDAKKIDESITVSARS
FT                   GEILTGATVSITGNFKSGEDILAFANDSSTMGDLTGSYDSATGVLTLSSSGGVTAAQMQ
FT                   AALRAVTYRNTSETPTESTRTVSFVVNDGSVGSVVVTKLVSVAATNDAPVAGADSAAVS
FT                   EDATGTGNVFLNDTDRDFQTTGITVNNGSTTNQGLVFDERPAGTTLLGGATSLDISIIF
FT                   SSTDSSGDAPIFSYAAGSSYNELLFDANYSNSGKLDWWFGNTALNDSGITSAELLDGNV
FT                   HTLRFTWISATGATAFYLDGVQKCLTTHFTNSSLGSDGVLVLGQEQDSVGGGWSTSQVF
FT                   SGTYYGVSITAGDGTTTRTAHWDMSGAQDGTVTSESGGYDLTLAGSPTLVNQLSVSAIR
FT                   TGTEAGSGTSGTVGQSLAGTYGTLTINADGSYSYSADQNAADALAAGSSATDTFTYSVS
FT                   DGGLTDTAELVFTVNGMNDVPLISSDSDLIQQASSTGIALKNAAGTAVSDLAIRGIATD
FT                   GTYMYIADDNGVSSLTIVRFTMEGTMVDTRVVAELPVGWNQMVYLDGAIYFRSYNVNSA
FT                   SNNALYRIATSNWPTAAVSSVTVPGDHPLLIGDGWMNGNLFTTPDGRIGVLGQQDENYD
FT                   TLVRLYSVSADGLTLTHVQDITILDAVEFPIDSHGAASDGQYLYVMSINAGYRVYSLID
FT                   GSFVYDNSSVEGGGSWTMQTPAQGDTAEIGNATYLTRNPLTGAFIWADYNNARVVSSAG
FT                   VVPSFTVTEDVAGNLTFTGTPFADIDGDTLTVTLSVADGTIAGSAGTGITIGGSGTART
FT                   FAGSAADLNTYFGSAGKITYTAAQDSTASRALGVSVTDGTLSSSLQAVIAVTPVNDAPG
FT                   ITAGGTTAFTEQTPIAVASAITLSDAEGDGEWTEGTLKVQVTSNSEAADSLVLPNNAPE
FT                   GYGIWLDVVNNKTLKYGSTAIGTASSFLASGDTAWTFTFNATATNALVQATARAIQFNN
FT                   SSDTPGTASRTVTFTATDMHSAATSATQAVTVAALNDAPKVTNEADPALVFDGTDDYAL
FT                   FPDIDANISTAFTLETWVKFDDLDGVQFISGKGTEQMELHTSGSALRFIPTNGAYIDTG
FT                   SVLVVDTWTHIAATYDAGADTAHIYINGVEVSAVDNNAAADSALLATETGYYLGRRADN
FT                   TYYLNGSIADFRIWNDVRTADEIRNNMNAELQGSEAGLVALWNLDEGSGTTLADATSSR
FT                   FNGTAYNTTTWTTRPVTAGLSVNYTEDASPVSLFSGVNVSTVETGETITAMTLTVSNVS
FT                   DATESLGIDSSAVALTNGASGTTATNGLGYSVSVSSGTATVTLSKAEGISASATETLIN
FT                   GITYSNSSQAPSTGATRTVTITSLKDSGGSAGGGSDTASLNVAATVTVHAVNDAPVLAA
FT                   QTLSITETASYDTFSIEKGRFGATDAEGDSIVFSLVDSTTVPSGAVDSEGYNFVQNGAY
FT                   GDLYIQTDGDYAFVPDNGAINALTNNVSESFKIRATADGQTAESTFTVSITAVNDTPTI
FT                   TTYVSTADITTGLPDTAYSVVGSSPETEVVKYAFDDNVNTKYLNFSGVGSSVTVDAGAN
FT                   YVVTSLGLTTANDATNRDPAHFILYGSTDNASFTQIAAAALTPPAERYTDYPTVSFSNS
FT                   TSYRYYRLAFDQSAGGGGDSYIQVAEIRLGGETSNVILYTENAQVNALENVILRDNEHG
FT                   SLASATVTISGNYENASDSLSFTNNNTGLYGSITASFVSSTGVLSLSGSATVEQYQNAL
FT                   RAVTYASSSDNPTLNSPTRTLSWQVNDGAADSSVATSTITITPVNDAPALAGAGNTLAF
FT                   TEGSSPAVIDASLALSDADDTTIASATVTISGGYVSTEDVLACTSQNGITGSWNGSTGV
FT                   LTLTGSATIAQYKAALESITYQNTNTNNPNIGNRTISWVVNDAALGSSPVTSTITVAGV
FT                   NDAPTVSSSITRSASEGASSITFNLLANASDVDDSTLSITDVTYAVGGVSTGNSGSDVP
FT                   AGFSLSGVTLTVDPAAAAFDDLAAGVGRTIVASYTIADGSGGAVTQTATVTITGTNDVP
FT                   TVTNADTAKAGAVTESGNADDGTAEAGTATASGTLSSSDVDASATATWSLQGTPSTTYG
FT                   TMVLDATSGVWTYTLDNTLTATQALKEGESATQTYTARVTDDKGAYVDQTLTVTITGTN
FT                   DVPTVTNADTAKAGAVTESGNADDGTAEAGTATASGTLSSSDVDASATATWSLQGTPST
FT                   TYGTMVLDATSGVWTYTLDNTLTATQALKEGESATQTYTARVTDDKGAYVDQTVTITIT
FT                   GTNDAPTLTGLEGKTVLENASAAFIDSSVVFGDVDSVNLDGGTLMVSGLDSEDVVSIAT
FT                   GVAHSNGAIQRDGNNVQVSDGSGWTTIGTIGTVAGATGSGENLVITFNSSAMPTNVDAL
FT                   LQSLTFYNNDDTPTAIRTLSITVTDGDGGTTGAQSAVVNVTAVDDSSVLAFSHSPSTYT
FT                   ENATGFHIDSGLTITDVDSTTLDGAKVFISSNFFGTEDTLSASGTNVSWSGSGGSYAGT
FT                   NGTITMAYDAAKGILTLSGSAGVADYQAALRSIQYSNSSDNPSTASRGIDITLGSAVGT
FT                   VIDDTLHFYEYVAIPGISWTASRDAAALKTLNGLTGYLATITSEAESTFVLSKVSGTTW
FT                   IGASDKDSEGIWKWMTGPETGETLSWTNWSSGEPNNSGGNEDYAHIMDWTSPAGKWNDL
FT                   PDGGGGGDYASKGYLVEYSAPALSVSFSKSLSLGITAVNDVPVSSGGITNTGGIEAGVD
FT                   SSGNAVAGSNATAAANALFAGVSDLDNSIFTVTQAKASAGSFAGVTASTTSSNGLAVTG
FT                   LYGTMTVGADGSYSYVIDNTNATVQALDESESVDDLFVVRVSDGSGGTVDQALTIRVDG
FT                   TNDRPTVSSSITGSASEGASSITFNLLANASDVDDSTLSITDVTYAVGGVSTGNSGSDV
FT                   PAGFSLSGVTLRVDQAAAAFDDLAAGVGRTIVASYTIADGSGGSVAQTATVTITGTNDV
FT                   PTVTNADTAKAGAVTESGHADDGAAVAGTATATGTLTSSDVDAGATKAWSLQGTSSTTY
FT                   GTMAINASTGVWSYTLNNELTATQALKEGDTVTEAYTARVTDDQGAYVDQTVTITITGT
FT                   NDVPTVTSLAAAHAGAVVEAGHQDNGTVVAGTATATGTLAASDVDTGATKIWSLQGTPS
FT                   ETYGTMAINSSTGVWTYTLDNTLMATQALKEGESATQTYTARVTDDQGAYVDQAVTITI
FT                   TGTNDAPVLQAVTAGSITETVQSSATADQNLSGTLTAADVDGGDSKTYGINDGSGNAIA
FT                   ASDGVVSKAGTYGTLTLDTSTGVYAYAKNASAIEALDDGESGSDSFTVVVTDSAGAVSS
FT                   KTYTVSVTGHDDAPTLSAATSGSITETGLATAVTETGLTGTLSGSDVDTEILTYGIDGG
FT                   IELTGTYAGIVTKTGTYGTLSLNRSSGAYQYDRNAASVEALAASESVSDVFTLTVTDGD
FT                   GVLVRQTYTVNLTGADDVPLITVVDVDASITEASTLLDSGSVTFTDVDLSDRPVATGAK
FT                   SSISAVKSGGTTALVLSAAQESALAAGFSVTNADGNTNNGTVNWGYVIAESTLDFLGAG
FT                   EKVTAVFTITVNDQHGGTATQDVMVRITGANDSPSISLGGSDSASEGLSESNAGLSKSG
FT                   TLTLSDKDATDTVTPSVYAVSTEGITNGISNTAFKAMLSVDDGAVIASGATGGTIHWVF
FT                   NSGSEAFNYLAEGETLKLTYTLRATDSQSSVVDQAVVITITGTNDTPVVDATDVSGGVT
FT                   ELVTADGNLTDSGTIGFTDTDLSDTHSLGAVTASGGAIGALTVTKTVDTTGIGTGGSMT
FT                   WNYSVAASAVEYLAAGETKVESFTFAVQDAHGGSVTRTVEVTLTGTNDAPVITAGPDTA
FT                   SLSEIDAGLSTSGSLTVSDVDVTDVVTATRTLSVGGTSNRSDSAAPGDAALLGMFTVTP
FT                   GTIIDGLHTSSTLGWSFDSGTGTFDYLQNGETLVLTYTVSATDDNGTALSDSETVTITI
FT                   TGTNDTPVITNGNDTSALTETDAALTASGTMAVMDLDTADTVDIAVESVSRGGTFEGTV
FT                   PLTNDELKAMLGVSVQSGSISALGADASAGTEFGWTFTSGSSGSAAFDFLRDGETLVLT
FT                   YTLKATDNSGAGSLEASPSATSIVVVTVTGTNDAPEITAATVTGAITEGSGDLTETGSI
FT                   AFSDVDLSDRPSVSKALKSLKWESAAGEDVTDAMSVGRYNELTAFASGESVYGFAMTPS
FT                   SANANGGSVGWEYSMQESTLDFLAAGETVTVVYTVRVADDKGGSASQDVTITINGTNDL
FT                   PELASVTYGSIVENPSDTTVLESGLFGTLKGTDRDSVSMLTYGISGSLPSGGMVAQSGR
FT                   YGTLQVATASGAFLYKRDALAVEALDDGQMAADRFIFTVTDGLSAPSKREYVVNLTGAA
FT                   EFVPLADAAKAKTSSDNLAPDLVPSVLNSLVLVQPDSGTDASPASSMLSTVVQGIVVQG
FT                   VDVSTDPFVVPSATGSSVPPATVPEPLLSAASSTVAPSETVSLPVKNSVAGIDDGQNVK
FT                   GASLTKATGAAEGAASVGRAVGEVLFVDKGIGNISVDPVMGLIFRVPENAFGKADASAK
FT                   VTYRAMQAGGLPLPKWVTFDSESATFRVKPGAEGSLRVVVKILDEAGNEAEASFELNAR
FT                   DGLTPKDDAKDGSKDGEGRPQGAAGHRSLHPFSREGALDGGREVLPSAGRRALSEQLAE
FT                   AGRWGMFRKHHQLLAQLGEVVAEDA"
FT   gene            400757..402586
FT                   /locus_tag="Plut_0368"
FT   CDS_pept        400757..402586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0368"
FT                   /product="Outer membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23256"
FT                   /db_xref="GOA:Q3B5X5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23256.1"
FT                   /translation="MMVNPLRHAPMAFLAAVLLLLSSCAVVPKPLDSESNRARLSAGLA
FT                   ETYARQEQLQRSVTLEEAMARAISYNLDSRVRLMQEALAHGELARARWDMLPKLAASAG
FT                   YSHRSDYPASSSASYSDGEVGAVTLSMSTSQDRDLRTADLSVAWNVLDFGVSYFQAKQQ
FT                   ADRQLIWRERRRKSVHNLMQEVRLAYWQAAGAARLRSRAMRVLDASERELGRIRRQREL
FT                   RLTSGLESLRQEKALLEVMRQMQAILDEFAVAKPRLASLMGLPPGSAFELALVDLPDDG
FT                   LPGMDVPVEEMERVALKYRPELREAAYEERISALEARKAIARLLPGIELSGSKEYNSNS
FT                   FAAYPNWWGGGMTVSWNLMNIPSAPQRIKTAKAAKTVAEANSLALAMAVLSQVYVSRQQ
FT                   QIAAIRQYSLARQQWDVDEQMLWYVEAGHSLNALSDRELIQTEANAVKAQLGLYVAYAS
FT                   MERAQGNVYASLGLDPFVDIDARMPVDKLADTIKRASDAWQAGKFSWINEEMGRIEQSR
FT                   ALYHEGMELFRREEYARADSTFSALRALDPFNESARQYAEVLIPARVKRIDKAQSLRHK
FT                   AMEAQKLQQEGKVEEAKALWTEIITESKEELSK"
FT   sig_peptide     400757..400834
FT                   /locus_tag="Plut_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.863 at
FT                   residue 26"
FT   gene            402583..408288
FT                   /locus_tag="Plut_0369"
FT   CDS_pept        402583..408288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0369"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23257"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23257.1"
FT                   /translation="MKSIVARAALGACILALPAGLDAGTDAPLKTVGDAELTLRELIEQ
FT                   AEENISEADLLIEARKQAERNAESAAKVREAYERGSRLAESGDLAGARAEWRRALEIAR
FT                   NPEMKSYIVEQTRKAEQRAEAQRAEREQRVAALNGEATALFGRGLLDESQARFQESLAL
FT                   EASNPEAKRYIDTLIPARRNELRQQAAREEQARVALEKGRALSSGGDFNAALTRWREAL
FT                   ALTSDVELAATINNEIQLAEGKVSKAAGLLSEGAVQFDAGSLQAAEEKFRAALAVDPMQ
FT                   VAATDYLEVKIPARKVELQRIAEAEAGARVIFEKGNKLFAAGDTDGAKAAWREAEAATR
FT                   DPELKAAVVAQFRKAEAQEAAERAAAEARVAALVREGESLFQSGRLEEAEAKFREVIAL
FT                   DRSDRVATQYLSSSIPDRKAQLEKQREEEAEARAAIERGNKLYAGGNLDGAQAVWREAL
FT                   SLTRNPELKSAIALQSRRAEEQAARDRAALKARIDSLSAEGVALFNADRLDEAALKFRG
FT                   VLALDPSHWSSLQSIDSGIPKRRKELERIAVVEEQAAGVALRGDALLKAGDLEGAKSAY
FT                   LEAAGIAEKAESKASMTLKADQITLRQEREAEELRARIAAMATEGESLFNADRLDESTA
FT                   KFRELLTLDATNRTATTYINDTIPARKAELERRAAVAKQARASYERGTSLAAAGDLRGA
FT                   VGAWNEALAAAEDPDLTAAINTGLAGAKEKLARAEELTLEGTALFQSGNVDGSEATFRQ
FT                   ALALDPMNRGAMDYLEVRLPVRRAELQRQREAEELRGRIAATLAEGESLFNTDRLDEST
FT                   AKFKELLALDATNRTATGYINDTIPARKKELQRIAAVEQRVKETGVRGDGLLKAGDLEG
FT                   AKAAYLEAAGIAEKAESKASMTQKASQITLRQEREAEELRARIAAMATEGESLFNADRL
FT                   DESAAKFSELLALDATNRTATGYINDTIPARKAELEHRAAVAEQARASYERGSALAAAG
FT                   DLRGAVGAWNEALAAAEDPKLTAAIKTGLAGAKEKLARAEALSQEGTALFQSGNVDGSE
FT                   AKFRSALIIDPMNRGAMDYLEVRLPARRAELQRQREAEELRVRIAATLAEGESLFNADR
FT                   LDESTAKFRELLALDATNRTATGYINDTIPARKAELERRAAVAKQARASYERGTSLAAA
FT                   GDLRGAVGAWNEALAAAEDPELTAAINTGLAGAKEKLAKAEELTLEGTALFQSGNVDGS
FT                   EAKFRSALILDPMNPVAMDYRDAQIPLRREELRRQIEAEAQAAAAFKSGNTMFAAGDLN
FT                   GAEVAWRKALSLTRNPELQAAIALQSRKAEEQAAAERAALAARIEALGREARLLLAADQ
FT                   LDEADARYRELLALDPARPDALLALETGIPQRRAELKRQREAEELRARIAAISAEGESL
FT                   FNADRLDESTAKFSELLALDATNRTATGYINDTIPARKAELERRAAVAEQARASYERGS
FT                   ALAAAGDLRGAVGAWNEALAAAEDPELTAAINTGLAGAKEKLARAEELTLEGTALFQSG
FT                   NVDGSETTFRQVLALDPMNRGAMDYLEVQLPARRAELLRQQREAEHQARIAAISAEGES
FT                   LFNADRLGESAAKFRELLALDATNRTATGYINDAIPARRVELQRRAAVARQAQAGYENG
FT                   RARYAAGDLAGAIGAWEGALRIAEDAKLTATINADLQKAREKSSRIRALHDESLSLFAS
FT                   DSLDGSEAKFRELLAIDASNAVAKDHLSSRIPARRAELLRQRGVASSVEAALGEGNRLY
FT                   ASGNVQGAIARWTEGLGVAETPGQKASLAGQVRMADERLRQEAAARQIRVSELYAEGAT
FT                   LFGSDRLDEAAAKFQELLQLDGSHPEARSYAGVKIPARKAELQRLAELEQRAKDAYERG
FT                   NRLYAAGDYDAAKAAWQEALNITATQR"
FT   sig_peptide     402583..402654
FT                   /locus_tag="Plut_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.919 at
FT                   residue 24"
FT   gene            408303..409127
FT                   /locus_tag="Plut_0370"
FT   CDS_pept        408303..409127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23258"
FT                   /db_xref="GOA:Q3B5X3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23258.1"
FT                   /translation="MNHNMSCTVSIQRGLGGAFARMFAFLCMLAVAAPHTAFGEKPVPA
FT                   ALKAPARVPAGDVLIQVVAREHVTIAAGMDGRIERLMVREGDRFTKGMLLLAFDCSSEQ
FT                   GMLERSKASRELAVKNAEIQEKLFAMGASSDLELSTARAERGKMAAEQKIAAAAVRKCT
FT                   VLAPFSGGVSELKVQRFQTVKKGDPLMRLVNTGDLEIQMFVPSKWLVWLKPGRRFTVHV
FT                   DELDRDYQAEVRATGTWIDAVSQSVAVFSRFSRQAPELLPGMSGHAILASPK"
FT   sig_peptide     408303..408422
FT                   /locus_tag="Plut_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.477 at
FT                   residue 40"
FT   gene            409138..410511
FT                   /locus_tag="Plut_0371"
FT   CDS_pept        409138..410511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23259.1"
FT                   /translation="MADPRLSAFSSILELERMARKAEDAAALRYVLVNETMTLVPYRQA
FT                   AFWELGSGRLRALSGMSQPDRNAPFVAWLERLMAELHRMAVERRSGEEYPPQTLTMADV
FT                   SEEIALDWGEWLPAHAISVPIGSANGVLQGILLLARATPFAGHEPALLAVLAEAYGHAL
FT                   QALEPRNRPELSWAFLKRKAESILKDNKQVRWIAGGVLLLLVFPVRISSLAPAEVESRD
FT                   PWVVRSPLDGVVRSIDVPPNSTVERGRQLVTMERTVLENALAVTRQERMVSEAEYRRAA
FT                   QEAVYDRANMSEMSVLSAKVGRLRAEEAYASQQLQRTLITAEHSGVAVYGDPDDWNGRP
FT                   VRTGERIMTIMDPEKAKLAIWLGVDDAISLEPGAEVVFFLSSNPLWPVRATLQYASYSP
FT                   EIRADGTLAYGLEAKFNDKTDLPRVGLKGTAKIYGRRVALSYYLLRRPIAAMRRWLGI"
FT   gene            410508..411932
FT                   /locus_tag="Plut_0372"
FT   CDS_pept        410508..411932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0372"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23260"
FT                   /db_xref="GOA:Q3B5X1"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23260.1"
FT                   /translation="MSAATGQKPPLPPLREDLSLHPGPSARDGSPAWVLHDPGRNRFFQ
FT                   IDALGFEILSRWQMGDADAIAGSISDETTIAADASDVLEMARFLVVHELVRVMGEAGRE
FT                   RLKAATSKGRWPKLKWLLHNYLYFRFHLFNPERFLSKTYPYIRWIYTPIAAKVMLFIAL
FT                   VALYMAGRQWDAFTHSLSYFFSFQGVVLFGLAMFFAKVVHELGHGYTAYRYGCRVSSMG
FT                   VVFIVLTPVFYTDASEAWLLTSRRKRIAIGAAGIVAELGLAVLATFLWSFLPEGAMRSA
FT                   ALLLATTSWVHTLLVNMMPYMRFDGYYLFSDLLGIPNLFERSFAMGRWWVRERLFGLGD
FT                   PPPEEWDRRTEKLLVAFALGVWVYRFFLFIGIAFLVYHFTFKLLGIVLLTVELGWFVFL
FT                   PIFGELKSWYAMRDRFIWNRNSRISAALAGLFLIGFVLPLSFSVDAPALLLPREHAVFY
FT                   APEDARVHTLRVREGE"
FT   gene            412017..412634
FT                   /locus_tag="Plut_0373"
FT   CDS_pept        412017..412634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0373"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5X0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23261.1"
FT                   /translation="MRWALMASAADERQYSRRLVTLRELEAAAKELEGYRRQALRLRAI
FT                   APFSGRIDRVMKELRPGQWVGGGSPLVSVVGTAGSSGEGYVFESDVERVRPGARCTFYP
FT                   DNCEMPVVRGRVRQVERAGSPVLQHPELASIYRGSIPSRISRSGEVIPEKAVYRFFWTP
FT                   DMKGGEEPRHIRGTLVIRSSPESMFWRLWRTVAGVLIRETGF"
FT   gene            412945..414483
FT                   /locus_tag="Plut_0374"
FT   CDS_pept        412945..414483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0374"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23262"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23262.1"
FT                   /translation="MKSIIARAFLGACILTLPASLQARAEESVNTGGAPAVSLTDLGRM
FT                   AEENIRKVESLIEERRKAERKAALDAEARRAFGRGVRLAESGDLDGSKKALKEALEITQ
FT                   SPEMRSYLEEQSRRRQEYSTAEGEALDKERRELAALQKERAAVVPAEGAKAEWLTDLSL
FT                   SAATELKAAVQSRINLLNGEGETLFKADRLDESEARFREVLKLDPSNLKAREYLGSLVP
FT                   VRRAGLQRIALAEEKAGEAFERGNKLYRSGDLLGTRAAWVEAINTTEIPATKMGMAARI
FT                   SRLDTEIAVLYSKVDGLNSEGSALFDDNRLEDAEAKFREVLTLDPTNAKAMEYMDVMIP
FT                   RRRDLVAARDAVEKKAEAVYLEANRLYAAGDAAGAGAAWQNAMALTQDVALKAKITAKV
FT                   RIAEERKRQDAEAFQARIAGLYADGVALYDVGRLEDAGGKFREVIALDATHWGARQYLD
FT                   HKIPGRKVEEVRKSQVEQAAKAAMEQGNKLYAAGDFEGAQAAWNKALEITRQQR"
FT   sig_peptide     412945..413022
FT                   /locus_tag="Plut_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 26"
FT   gene            415629..417632
FT                   /locus_tag="Plut_0375"
FT   CDS_pept        415629..417632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0375"
FT                   /product="Outer membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23263"
FT                   /db_xref="GOA:Q3B5W8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23263.1"
FT                   /translation="MQPSLPAPPPIVPAPAAPAALEPAVVESLPAAVLAVPLPSADAPS
FT                   VDGGAKKTVPAAVATATAPALAAAPLPDEPVPADPGPSAASAASPERAPAAASLPAPLL
FT                   PEPVAAEPEAVVLEEGEPLPEAMPGPVGAPLPEPVAGVAIPDAESETRVDGEPPKPQPS
FT                   VESVALPEELRIGVVQEPPSALQEAPSREILVKDESLAEEPGPEAPSPEPAPARPGMPP
FT                   PHDLAPWALVESEDGDLPVFDSSMPVIRNEVARLQLEEWSRHVGEAVARHPSVRAAEYA
FT                   EQESISSIGEAKAQLYPQVSLGLNTDLRRSIRDGKPYATVSDLPIDDEVRLNPNLTVRQ
FT                   LVFDGGATSSRGKAAMARSLAARERRVSTEEGVALRAVATMIELAKLQEQLEFARENLS
FT                   EVRRLRDMIRARVDAGRDAPSEMLQMNSRVFEARNEVVLLEGRRADAGARYEEVFGGTP
FT                   VVLAFPDVFAPIPMSMSGGMDAALRKNPDLLSSKALVDAAAADYKAAWGALYPRLEVEA
FT                   NLTVYDVTRNESDYYDSFVGLKLSHNILDGGLKSSTKARTRSQMERARSEYDNTQRAVE
FT                   LALRRAYANREALIPQYKALQAQLDHKRETQRAYEEQFLAGRRPLNDLVAAQQQVIDTA
FT                   IRTLDYKAELHRQHFVILSLIGELAKGEGKKM"
FT   gene            complement(417663..418385)
FT                   /locus_tag="Plut_0376"
FT   CDS_pept        complement(417663..418385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0376"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23264"
FT                   /db_xref="GOA:Q3B5W7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23264.1"
FT                   /translation="MTQTEKNGKSILIVEDDRDLAESIGMYLELEGYQVTTATNAISCY
FT                   VELYNSTFDLALLDLSLPDQDGLILARYLRNNTQTAIMVLSARSTIEDRRMGYDAGAHV
FT                   FIAKPVDFGELSGSIAALLDSMGKDSQTQQTADTKPQEERWLMLRSDWDLVSPSGAHAR
FT                   LTAKEWDLLVALSARCNKMVSRESILKTLGYTNNEYGHRSLESILYRLRKKTSDMGANP
FT                   VKTFHGNGYGFMAPLVVI"
FT   gene            complement(418444..420465)
FT                   /locus_tag="Plut_0377"
FT   CDS_pept        complement(418444..420465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0377"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23265"
FT                   /db_xref="GOA:Q3B5W6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23265.1"
FT                   /translation="MSLNPLKRKGMRHRALLMLAVLCLAAGCGAHAWASPLELGKKEHY
FT                   SLEGHLAVLEDPAGTVGLAEAKSAYRQGKFQEIEGKFAAGYSHSAYWVRLEILPSGGFP
FT                   AEGWLRLAPAVLEHMEIYLPENHGRPIRMGSTELHPGGILRNADFLTPVDLSGDGPVVV
FT                   YLRIWSQNTITLHGGICTEAHLLSCTDRTIAQESAFGAISLMIILIALVVYRNTGWRHM
FT                   LYFSIYIFILFLSLYLSRGMHFYLLPDWLRTFTAVLLKAQLGSSMLIFMLFVIELMNDD
FT                   YPGRFRTYFTVLIVLAVLLLFSSPTPAFGVVASIVMTCYFSIVPLVVWFSSRIVLPTRS
FT                   SRVLFVSATVTIFSGFTVYFLHLMGFFPDSVFAFNALQASSLIYALLLLPVFAIRVQSS
FT                   RQQAIEQSILVTRTAEALSERISRELREHTERLEVSIQAEQSASERMETFLTMLAHDYR
FT                   SPLSVISGNLDILNRLAPEGNSEAGTEIGKIRHAAKRLEKLMEISLVHERLQQPSEPGR
FT                   EEYICVHEALKRAISVAQSRWPERGFFLSASSDDAFLFGEPSHFDAAIFSIFDNAHSYS
FT                   PPGSPVTITSTVSNGLVEINVSNAVELLPGTDMEELFKKYYRGTNAAGTAGAGVGLPAA
FT                   RSIIEQFGGEVTIQKTGKNSITVTITAPVTRHTLTSSE"
FT   sig_peptide     complement(420367..420465)
FT                   /locus_tag="Plut_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.760 at
FT                   residue 33"
FT   gene            complement(420462..422522)
FT                   /locus_tag="Plut_0378"
FT   CDS_pept        complement(420462..422522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0378"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23266"
FT                   /db_xref="GOA:Q3B5W5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23266.1"
FT                   /translation="MPPPQPSQPSLRALRHAGWITVLLAALCCSGILLLSQTAAASPLL
FT                   LKSDGGKGSFSLDGHLELLEDASGTLKLHEVIGSTAFREIQGSVNEGFSGSAFWVRFRV
FT                   VRGEGFPASAWLRLGPRTPDTLEAYVQQQGTSPLSASSYKAFPLGLTMPPGKRAVPDPQ
FT                   LLVPLELGPEGSELLAYMRIASRSPVQLRGTVLNREELMKQSRSHMFLQAFYLGVTAVI
FT                   VLMSLLIFFAVREWRFLFFSLYAADLFLSYLIARGMYVFLMPWLGDSAAPELMETTGGL
FT                   GVVFFALFAYEVLKDKCKPTTLRALQVTALAGLLDPTASLLFNTTILKPFGAYSAIALL
FT                   GVLCWITVRQLPLHPFRKQVLLGLFGLNILLYGELFLQRLGLLPLNTAIQDLVQAGSFM
FT                   HILVIFGLLVERFLHAEQELKESTHESEMRATAIAEKKTEELRIYRDRLEQSLQSRHQS
FT                   AERVRRFFQMVSHEYRTPLAIIQGNINILSRRSRPGDTKKPAILHAMHRAAGRLLEVME
FT                   QAVERSRLLETDDVQVIGRIRVSAYMFQQVESARALWPKLHIIQECLAGNEEIEGDLLL
FT                   LQMALFNLLDNARKYSPEGSPVHVRCRAEEGFGIIELHNNTALPMDEDEGELFMKFHRG
FT                   NNSAAEPGKGIGLWLVREVMRQHDGSATLKSGKEGGVTATIRIPLAQKENP"
FT   sig_peptide     complement(422397..422522)
FT                   /locus_tag="Plut_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.936 at
FT                   residue 42"
FT   gene            422706..444560
FT                   /locus_tag="Plut_0379"
FT   CDS_pept        422706..444560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0379"
FT                   /product="VCBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23267"
FT                   /db_xref="GOA:Q3B5W4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23267.1"
FT                   /translation="MRGVNPLNLPKMSVAEPHAVCLEQACERAYSDVNKRLTLKSPEVL
FT                   LYDPGVAEVEVLLAGLDPAVQPLAVQPSDSPQEILAFLISHPQLTALHILGHGGPGAVR
FT                   FGGVQLNAEDFHVPVDALIQRARLIDIYFWSCRTAQGTEGTTYLQAISENSMANVHAST
FT                   GLIGETAKGGSWELDVTVSPTVRMPFSSAAREAFEGVLAVTALDNALSVTEQATPTLID
FT                   NNVEISGIADSYYLLVSLAGIVSSDQFSFATTVPASPTAGAVYSDSGTIKYYDGSAWSA
FT                   VATVDSSLDGAGGALKIVFNSSASDAIATAVAQSILYQYSGDDPNVAAREVTYAVYSGS
FT                   NALVGSSDSTMITVTAVNDAPVNTVSSAVTVAEDTAIAITGLSVADADDTSDITVTLSV
FT                   TNGTITVAESVTSGLVTTDIGGNGTGTVTLTGTVAEINATLADTGAVSYQGALNYNGSD
FT                   TLTMLTTDGSLLTDSDTVSITVAAVNDAATFSGDKTGSGNEDGTITGTLAVADAADGLA
FT                   SPLDFSVSTAASNGTATIDATTGAWSYAPTADYNGSDSFTVSVTDGDGNVETQVISVTV
FT                   AAVNDAATFSGDKTGSGNEDGTITGTLAVADAADGLASPLDFSVSTAASNGTATIDATT
FT                   GAWSYAPTADYNGSDSFTVSVTDGDGNVETQVISVTVAAVNDAATFSGDKTGSGNEDGT
FT                   ITGTLAVADAADGLASPLDFSVSTAASNGTATIDATTGAWSYAPTADYNGSDSFTVSVT
FT                   DGDGNVETQVISVTVAAVNDAATFSGDKTGSGNEDGTITGTLAVADAADGLASPLDFSV
FT                   STAASNGTATIDATTGAWSYAPTADYNGSDSFTVSVTDGDGNVETQVISITVAAVNDAP
FT                   VAVNDTGSVAEDATLTVDATLGVLADDTDVDTDATSTVTAIRTGAESAETSTSGTVGTG
FT                   LVGTYGTLTIAANGSYTYVADQAAADDLDAGDTVTDTFTYTVSDGSLTDTAELVITVTG
FT                   TNDAPTVSSAITSAQNEGAASYQIDLLTNASDVDDSASLSVTGITYKIGTGDASENIPT
FT                   GLSLSGSSLTVNPNSTAFNDLGAGQPRVILVSYNVSDGTATVAQTATITITGTNDTPSV
FT                   TLGTVSSGFTEIDGVDTATNAVAFGTTGTAEIADLDLASDGIANLTITFANSTIRDGAA
FT                   EQLLVGGSTITLNTTASASNLTVDSSGITWSVAVTRTGDASTGTTSVVFTNSASGGEAT
FT                   TAQAEALLDAIKYNNTSDTPTAGARTFQVTVSDGTATSSVATKSITVVPENDTPVIDLN
FT                   GTSTGVNDSVGYTEINGADTTANDVKLGVSGTAVVTDLDGDSLANLTVSFLNSDIKDGS
FT                   SEEFVLGGLHIGLVSNYTTNYLLGGVSKYTITTTVGATETTVVFTDAESATLTKADVAY
FT                   LLDLVQYNNTSDAPTDGGRNFNITVSDGTDVSSVATKTITVVHENDTPVVSLSAATATY
FT                   TEINGADTTSNDVSLGTAGQTEISDLDSANLSSLTVSFANSTIQNGAAEQFLVGGSTIA
FT                   LNASTGTTTLVSTVGGVSYAVSITNNSTNTSFVFTKVGTNTVVTKAEAEALLDAIKYNN
FT                   TLDSPTAGARVFNVTVSDGTESSTAVTKTITVVPTNDTPSVSLYTASGIFTETDGEDVA
FT                   GNDVAFGTTDQTEISDLDLTSDGIANLTVTFANTTIKDGASEQFTVGGSEIALNASGTT
FT                   SLSNTIDGINYTATVTTGTTNTTVVFTKEGGGEVTTANAEALLDALKYNNASDSPTEGD
FT                   RLFNVTVSDGSAVSAVSTQTVSVSAVNDTPTITVNTSATPAFTEVQGADTAANKVTISP
FT                   NVTIADLDDAIISASVRITNPFDGDILGFTSTSSGKITGTYNSTTGTLSLVAAAGQTPS
FT                   TADFQAALQSVYFNNSSDTPNTTTRTVECTITDGDAFSLVATETVTVTSTNDTPVVTTS
FT                   AINIWSGTTTQTSTLSYSDLDPSASQTWTVVSGTGAAFATATDATNGKITFTVANVVDG
FT                   GNITVKVTDTGSEGAATSVNKLVAVNVYDYALFDTDGTTQLAAYATFADATAAGTAGQV
FT                   VKIATDNTVSTFVLPDSSVSLDVDASLETAAVSITGNDGDNTLTGTSLNDTLSGGDGDD
FT                   SLVAGSGNDTLSGGAGADTLDAGLGNDVLAGGTGADSLLGGDGDDVFAYSAFSDATSSA
FT                   IDEVTGDSISGGAGTDTILISTQGAYDFRTISSAMGIEKLVIDAGTATPTVIIDNKLVG
FT                   AGEVLNVSSASADGTVNVILHATSLTQGTINITGYEFGDNSEFNGGTGIDTITYYGSVS
FT                   DYSFSGSPDTYVKIVSDTYGVDHTLRGIEVINFVTEAAPTTVTMSARLIGAGGYAALSD
FT                   AIAVASTGDLIMMAAPVAVNYAESKVIADKDLWLNVPITTLKDTGTNLSSVSTINAIGT
FT                   SNTAVLDMTASGYTGDQYGYPNYTTIEVSDGGTAYMDASVLGGRAFTLTGDFRVTGTYL
FT                   EVLNLDPATARSIDVLTIQDSSANLAALTPTQIATLKSTYGVDAFVGNGDISLTADQIA
FT                   AFSTSSSVTLLNPNGDVTQIGSNSTAYGYGDTLDAFSSTETGYALATNVAKSVTLADVN
FT                   TSNTTTYTISGQIIDGLAGNDRISGTSVATSSDALVTDYLIGGEGHDYLIGGGTDLLQG
FT                   DAGDDIYIVTGANDFVLEDQGEGIDEVRTSLGTYTLTDDVDILRYTGTTVNAGFTGTGN
FT                   ELANRIYGGAYNDTLTGGAGDDVLWGGAGADTLSGGIGNDTIIIGTDRIAVAYYNGAYT
FT                   TTASANTDPVDDYAGDSVDGGAGIDTLQFQGTANNQNLIISSTTTGIEVFKVVNIPGYT
FT                   SYALDLDASALSDDSDNFAVTFNTPGSVVSGVASLADDISAKAGTDLVFNGAEMVGNAA
FT                   ANTLKGSAYSDVILGGEGADGLYGQGGNDYIFGEGGNDQIFGGAGDDVIVGGTGDDRAF
FT                   GDLGSDIFIGGAGNDYFSGSKASEYVDSSPVDTGVDKAVVAADAKIYLSGDARFEATAS
FT                   VTVTSNADGTDTYEGVEVVSKGGAVTVSSGAVTVSGGTAVDLAMDFRLIASTGELLSTY
FT                   SSFDAALAAARSAAATNTGLTIAVADGAAVVLDGSGEGLVSGLTIIGSGTDDAATFTGA
FT                   LTIDQSNVTLQGVRFETVGDVAAVTVSASGATIADVSFTGTNVATSSVGVAVGAAIGVS
FT                   ITGSDFTNLDTAIALADTYGAAAVITGNTIASSTVGIDINGLAAAADVTVTNNSFDSND
FT                   TALLLDKASTDYNAAASLAVEYNRFDVPVDHVGVDADGVSFSGALQTELLATLPLNTYV
FT                   LAQTDTAGHTDGEAITNDGNTAMESASNYVVDGTTATGDTVVFQQDDYGLTLDMTSGST
FT                   LALDLDSDSTYTTYVVGELGEGTVYISTAIENITGTAQGDSITGSADANVLSGLEGMDV
FT                   LSGGAGNDTIYGGADDDLIYGGDGNDILYSGSATLTDSVQGVGDDVLYGGAGDDTYKVG
FT                   EVADQNYFVGGDGEDTAVFSRTIGSYYINRADLRFLTDVNLTSGTEDAIWGVLNNDESS
FT                   LSATGSETAVDVDFASDQPIFQVEYVVNGVTIQTDYVQAENLEFTDVTLIWGTLAELES
FT                   DLAISGLADAVDPDADFRTELFVTSSDPEVAFVYNGGGSPDELNTPNYVLGSLKADTII
FT                   GGDGADVVFGLAGDDKITGGLGVDTLDGGIGEDNYYITPQIYNAETGYWIGDEFQAGDI
FT                   IADTGDGDAGIDQLDEVHIIDGGYVHFDYGTLTGVDEVLYDSYMAEDNGVTSSDSNQVY
FT                   VTSEQFDGVDYFRSGSAAYDYLEIEFFENDTTLTATNVVGVEAVVLDTWTDGSEENRID
FT                   AAGITTDAIVYVRGGQSDTDSDSIRVDNLVADIRADGYTTVTGHSTTGIYYGDLDINLR
FT                   SGAGEVRIWTGADDTTVTTRTGSLAYVDADKLTLGDLYLDGVGNVTVVNAGSITVDASK
FT                   DLAFDDLDTLNPLTGTLSVTTKNYADIDILTGTNTTTVTSYYGHVDVDATELLDDKVAG
FT                   QYNLILKGSSSVTVTELQGDVNASLSSGAMDITTATTLEAGHDGNVDIITGTHDTKITG
FT                   TTDGLSVTVNADLLSSDAVHSDVLTLDGQADFDVDHIASGVTVDADGDGSGAALQGTLV
FT                   IDTDAAAKDVLVLTGVAATTINTQSSLGGTVTVEADKLADDITLALNGAAAITVNDLVG
FT                   DIDADGNGTTTGMTAGDLIVKTADNGGGSLAIHTGDTSLYLNTAADTDTKDAVTVDADM
FT                   MARDTDMYIGGASNVTITGLITDLYASSAATDYATLSGSLTVTTGALTNGGGTGGAVQF
FT                   VLGSGVTTVVANESGTDATTTDLVIDATALTANTLTLRGTAEIEVDHVSTNVDAGGDAE
FT                   SSLSPLSGMLDIDAEAGSHTFTVTTGTGRTAVTAATGNTITIAAALLDDINAVVSGAKA
FT                   DAELVLDGTGTVRVNDLNGDLNAEDFSGATGTSLTVNVSDLSGTGDGADSLAALEIVTG
FT                   STDTNITGNDLYDDVDTLDIRVDGSALAGQAGERLKLSGTAEYVVENNTDNQKLTLDVY
FT                   DLLDNNEVTLQGVGDFELTGTSADVDASDLTGDITVRTKNTDPDAADDIIVTSGSGITT
FT                   VDAVESVDKITLNAALIHDDHLDAERTIETEKTEVNVLGAGTVVVTNLKADLDASSFTG
FT                   TLDVTRTAVGVDASENPYIDDVDITVGVKGASIDAGEIRNNTTYVDAHLMDADGLLTLE
FT                   GADATSFLVDLVNEGAKIDARGLDGALDVYTIDGVGKTSVVEVLTGTAETTITSNAGAV
FT                   DVDATALDDETLYLIGSSEYEVTHLGYNLFAENSTGAIAVTTDAISGYSSTSPFLTITT
FT                   GTGNMTVNGDDSNDSDTGILDITVKADKIADASTTEVDLYLTGDAEYLITSNTTTVGGS
FT                   YSEVTIDASDLGDTGGLTLSGEGNFRLVNTTQDVLAPTLEGKLTVETEGPVGGTAVANI
FT                   ITVTAGSGQLGVKATDSIDKITVEAANLVDDTNTYSPATYNPGTWELTAEGAGTVVVNG
FT                   LAADLDAHTLGGELTVSLGDVTPADVDIWLNDGDSTINTDSSGVTLNASQLGTDDVVTL
FT                   TEAGAVYLFNADAGMKVDAKTVVSGQETSYSGLLTVATAALSTGEKVFVDTGSNDTKII
FT                   GSGGGVDVDATVLADNNDLIIQGSSVVTVTGLQADVKAGATSGTISTGAIDITTVSNAN
FT                   LSVETGTGDIAITSASGVVTVDAASMSRSVKDADADITVDGSAKFTLSSVGTNVLVDAA
FT                   QLSTANHSTDDGKLTVTTKDGATGVVITTGNAQTTVNTGSSTAGRVEVQADTMDNDIVL
FT                   DLNGSSQVNVFDVIGDIDASGLSNTLYVKTADNEDAVGSSSLEDVKVTLGNASAGIVGV
FT                   GSDDRIDVVANAMTTNGRVLSLAGASDVYVTGLFENLDANGSSVNGYSMAALTGDLFVT
FT                   TGELTSDSQLTMYTGTGNTFINADKVDTDTNDLEDLTVDAGAMSSGVAEATLTLTGDAD
FT                   IYVYGASRDILATTYSGDSSVDTQLTGSLWVRANSSSNFDIVTGTHKTTVTMDSASSTV
FT                   HVDAMALVEDATLSSSYEELNITGSATSSTAYVTNLVADVKADLFYGTLDVITAENASI
FT                   AVIAGNRNNFISANGADAAVMVNAGAIDANYNLYARGVGDFSVTSVGNSVVIDADGSST
FT                   YTDKLTGSLDVTTASGATNVAVYTGTYTTTVEGNLGSIAVNAKELLDRESTYEMLLEGS
FT                   SAMTVTNLIADVNATASSGTVSITTGDAVDNGISILTGSGAMSVTDSAASDTVSIDATK
FT                   LNDNTLLTLSGDAKFTVSSLKGDAVVNSGTGLFTATLADAPDVTIDTDRTTTVNAAALA
FT                   AGHTLELTGSGNVTLSGLIANLDANGVSDWNSGSELTGTLNITTSVRQTDGEVTSGGVT
FT                   GDGTDPALTIWTGSNSTTVTGYDATANESSILDIVVDATKLADTNTSTVLYLGGDAEYK
FT                   LVNSDTTYSTSHKEVQVNLANAAGSGKVILTGTGAYNLIETSTDIDAGIAEGPLTVTTR
FT                   VASVDDIIVTAGTNILTVDAVNAGDTVAIVAANLTDDMDDNDRTGTVSKDPDSDGVDTF
FT                   ELTTKGAGDITVSDLSADLDASLLSGDLYVSLKTFSSFDTVDDVDIKLNSGDATINTRR
FT                   LQSRDVTLDADAMAEGDTITLAGGGNIVAYKVDAGVTVDAKTGVVVGVTQVNSTGILEI
FT                   YTDVLSTGEQVQVLTGEGPTTIVSTGSAADSKITVDADFLKQATTGDYLKKDLILNGST
FT                   AFWVTALGASVYATAASALVNITMEETDSVADTLWVTTGTANTVITGLDALDTIQVDAA
FT                   ASGSGDIITVDGSSDVIISNVSSSMDIDANGDASDTGSTALTGELTVSLTSTADSVDIW
FT                   TGTKNTTVHTNISNAGHGVSIVAAALEDNQQLTLDGAANVVVTGLDGNITATSLTGSLT
FT                   VTTAGAADGQISIALGSGTTTVTADALDTVTIDATQQDGNAASTDGADIITLNGNGAFV
FT                   VNNLKADIDAAADGDATAGEVSLTVDLLTPEDNAITIDTDRTTLVKAGELDGTDDVLTL
FT                   KGDGDITVGIYDESTGATTEGLGVITLNAAETTGSIEVYTSAIAGATSGTTQHLTATTG
FT                   SGDFLIYGDDSTNATYVSGTVESGSVYSETRDIQIDSSLMTSEDRLTLGGDAEFYLTGV
FT                   AAIVQASEDGIWTGHTDDGSVDVANMPLDSASISPDTAEGLGLNGIDANLTSLATGDIY
FT                   ITGTDAANTFLLGGGDDTIYGYGGDDYLRGGDGDDIIYAGMGDDTIYGGDGDDFLVGGS
FT                   GRDGSDFISGGDGVDTACFYYSTYDTAAARYVLYLDSDGNMLSSNLDIIGQDGLDTGNN
FT                   ASEIAETFYYSFDRTTSGTLNQVEVIVNLESATETITDRVLSDVENLQFCNISTGGSEV
FT                   LNPDDFVGKVINVNTGEKFSTIQAAIDDSDTRDDDVILAKSAVYNEEAFVSKNLTFFLQ
FT                   DGASGVTLTLANDYLDHTEYELAIKVMSEEDITINGNGGDNTITILDYSDLASWTQSNE
FT                   GTNSGLHEIDTNEDGSADTEAFELIGGWSTAVPSVRGDGEEIFGYLSEFDNASYTINGL
FT                   DGDDVIRISETSTKIHYLYGGSGDDFLSAGQGTEWLDGGSGNDILVSLGGDDRMLGGSG
FT                   DDLIVLATYNDGDAGSVLDPSGDGRTLILLGGGDDQIVAAVLDPDYGIDIDAWVLDFAR
FT                   GDDRINLENLVDSKGGTVDLYDIIKDISGSEIGLDNYTATYDDGDAAHTDDVNVNVEGS
FT                   IYLLGINTARLTSTDFVYDSDAAWLDQFHDLIGLQDVLQAV"
FT   gene            444770..449530
FT                   /locus_tag="Plut_0380"
FT   CDS_pept        444770..449530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0380"
FT                   /product="VCBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23268"
FT                   /db_xref="GOA:Q3B5W3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23268.1"
FT                   /translation="MRLKQWARRAGKRIARTVSSWPSNLGVGIGLYVSHLFYEKWAASH
FT                   LELPQAEEPDDGLTLDVNAALGAAIPDPLDETSSEQEVFTVADPLPEKPPADPEEVVAP
FT                   PDSEGSSVIMEFDGGEDILSYLVPSSDTGYALVADYQVYTLEYVEPQEPMYSVQEEDDD
FT                   DDRGLFWLDPAAVLAVGLGFFAGTQSLYDFDELLVADNTAPVAADDDDAVDEGDTLTVG
FT                   ASAGVLSNDTDGDGDVLSVTALRTGTESGYGSIGTVGEALTGTYGTLTLESDGSYTYLA
FT                   DQAAADALGEGETATDSFTYLISDGHGGTDIAELDIVVSGVNDAPTSTDDLVASDDGAT
FT                   VVLALDDFGTFNDVDGDSFAGVRITALESAGDLEYYDGSQWVDVVAGQLISASDIDAWN
FT                   LRYTPADDAFGTPYATIGFDVYDGTDYSASEYTLSVNVSAVNDMPAVDLKPSDATGIDN
FT                   SATFVEVAGTDDGSAVVAFAAEGLNLSDIDSTDLATLKVSIDPSTVESGDRLVLGSTVI
FT                   DLSDTSDNVGEVVYGGTAFSYSVTDAGEDRTVVFTSLVESGGEGAPAVISSYESLLDAL
FT                   KFNNTADDVTSGETRTFSVVASDGTDSSAAAVFTVTLQGTDDPSDLIFDMSAGPFIDDG
FT                   EVVVNAYTSAGELLFSIEKIDGAYEIVGADAEDVQFIGEGAIIDTKIISGTEVVVVEEF
FT                   QVRLFHYFGDVFLSLESGSYVDEATGATTALDVALRAVVDVPENSVSEVSVTPYTESAV
FT                   RLIELAAGVEELSFDVAADAELISTYYAAAASGISELVGIDIVSTRATPVNDTEDFLAA
FT                   LGADATVEDIESNQYGLKLAALSELVFSDDQLASKVDYGVSSIVGDLEVTFNDDGGLDF
FT                   DLISFTTTQVELTDSFTDYNSTFTYTTTDNEGNTVTNPLVPLDDNGNPVAGSTLVRDAV
FT                   APETASIRLINPESGAFFMRGYVDLVDSLNAAEESEYLEFKLIFDSVQYTATYNEELGL
FT                   WQSSSYDADTRLTNSSDSTFTITSFDASTGEASWQFLLPEVVTTGTYETILVLTDRAEN
FT                   ASLVVKSFTITDGPPELFITIADPVLYEGGTTTVTFDFSEEVTGFDLTDVFCFDTVSGL
FT                   QQDALDPTLWTATLEVSSSQGLAMPMVVSVGDGAVLDRTGNENTTGASAVYTVMPSSPI
FT                   VGDITMIDDTLWGTASADVIDGLTGDDILYGEGGDDLLLGHEQDDVLMGGEGDDTFLAG
FT                   DGDDIVSGGYGDDIYYADAFGDFTYTQNYVVGGEGEDTVYFHYGMSEYKIAFVSASQFD
FT                   FLNTLLGDEAGFRGITEYDLSFEEDLPVLRIERVDNFWEDLSGQVDYVQVEEYVFADAI
FT                   LQFTAVTGDLVFGTGWVLNVASADGALLMDGAYDPLQTTIGIKVEGSLYGDRLIGGLGD
FT                   DVLAGGGGDDVIVSLGGDDHLYGGTGDDVLIATTAWTGADPGEVVLNGGEGADTFVFLP
FT                   QDPEQGASLVIEDFSIDERDLIDITGFYHESTGGLQALTAADLVNTDFMDDYSSYLNLD
FT                   DGAGYASLHLEGFVDAGGNALEDVDVRIDFDSANVPDTVSSDWFAPVDSGVLSEHWWDQ
FT                   LYSSLAN"
FT   gene            449564..451720
FT                   /locus_tag="Plut_0381"
FT   CDS_pept        449564..451720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0381"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23269"
FT                   /db_xref="GOA:Q3B5W2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23269.1"
FT                   /translation="MTPYTDEADVEILEPKPVKLASNFEKIILDFARQSGKSLSLDLIR
FT                   SALPQGKAQAEIEDIQDVARVCGLRIYELPKDVTRLEDEDVPALVQHNVDKFVVITRLA
FT                   EGGQADVLEPEGSKEGLKLQEQAYSRNIERVYRIGFDSASLFSRWSWLLRPLEESKWAY
FT                   GQVFIAAVMTNLLAMTTSIFSMVVYNRVLPNNATESLVALTIGVFIALVFDSLIKMLRS
FT                   WFLDGAGSRADVRIGEKLFEQLVSIDLSAKRDSVGGLSSVMREFETLRDFLTSATLVAL
FT                   IDLPFVIVFLIAIFVIGGPVVLVPAVLVIVVVASGLIAQPFLSKLAQESLEEGKSKQSI
FT                   LVETISGLEVMKTSMATREMRKRWRESLLAQSGSAVKSRLVSQIVVNFSAFAQQIAQVM
FT                   IIVVGAYEAAVGNMTMGALIAAVILAGRGMAPLGQIAGLLTRLVHAKASFLALDRFMAL
FT                   PLDRPPSTRFLNKEKMLGKLEFRQVNFAYPDQQQNALQDVSFTIQPGERVALLGKIGSG
FT                   KSTAARLMLGLYGPSSGSVLIDDTDVRQIDPFDIRRHVSFIMQDSWLFSGSVRDNIASG
FT                   ALAVSDEELLRAAEIAGVHDFLGDHPNGYDLMLRERGEGLSGGQKQAISLARGLVGNRS
FT                   VFIMDEPTSMMDMGSETKFVERLSQVIIGKTLVVITHRSAMLKLVDRVIIFDKGRIIAD
FT                   GPKSILDRKNPAPGAPPTAMAVKG"
FT   gene            451832..452110
FT                   /locus_tag="Plut_0382"
FT   CDS_pept        451832..452110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23270"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23270.1"
FT                   /translation="MDQFIDDIGLIRIGGGLVRIQTLRRMQDEKGEQRAQERGDLVLPI
FT                   ASFLRMHTGINRAIEEMLEKGILKRREDEKIEGEGDASDVIDTQVKE"
FT   gene            452221..453627
FT                   /locus_tag="Plut_0383"
FT   CDS_pept        452221..453627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0383"
FT                   /product="Type I secretion membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23271"
FT                   /db_xref="GOA:Q3B5W0"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23271.1"
FT                   /translation="MKFPFLKGRSAEEILAGFLSPHSEGEEASRFARFVSSSLERIDRL
FT                   NRLWGGKQSTPTFLLLSITVFLAVMLIWASFAELDHVVTGQGKVVTPKQTQLIQSLEGG
FT                   IIEHIYAREGDVAEEGSVLVSLDPTQAKSLYGQAQKEERAIAVRVERLLAEKEERDPVF
FT                   PFELMQEEPELIAAEQAQYRERKAVLDTEFQLLDAQVSQRREERMQAEAELHRATRELE
FT                   LARAEYGLIKDLVDRRLEARLSLINVDRERNEALSQLNKAKVSLKRADAALAEGRFRLA
FT                   QSRMNFMSQVGNEYAEGVGRLAEVRQKLQGLSDRLNRTQLVAPVNAIVNKIHVRTEGGV
FT                   VQPGQPILELTPIDGKIEIEAAIQQKDIAFVHIGQTVSVKLTAYDFSRFGDIKGKVTVI
FT                   SPDAQQLEDGREFFQVRVELDQSYLENKGRHYPVTPGMAANVDMVIAKRTVMEYLMEPV
FT                   FKLQDRAFRE"
FT   gene            453634..454389
FT                   /locus_tag="Plut_0384"
FT   CDS_pept        453634..454389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0384"
FT                   /product="Trypsin-like serine protease"
FT                   /note="typically periplasmic; contains C-terminal PDZ
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23272"
FT                   /db_xref="GOA:Q3B5V9"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23272.1"
FT                   /translation="MLKRLILLITLSVSVLSPFADAAPPAPQSVKRALTLTPETSVATA
FT                   FLIAPGYLLTANHAVRGKQRLYVAKERDRVFTAAKVVGYSDELDIAIIAASVQGRPLEF
FT                   GQWQTFPRGAETFVLGFPKIGNYVSEKRITAGIFNGDQKFRGREDWFQLSAEIQRGNSG
FT                   SPVIGPDGRVYGLISHKLDAQKALQKYGDFPQNVNFALKSSLILNFLEGYHIKVRSAVF
FT                   DPVKELRPYQVFAGNQDSIFLLLGTSKAD"
FT   sig_peptide     453634..453702
FT                   /locus_tag="Plut_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 23"
FT   gene            454746..455423
FT                   /locus_tag="Plut_0385"
FT   CDS_pept        454746..455423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0385"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23273"
FT                   /db_xref="GOA:Q3B5V8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23273.1"
FT                   /translation="MANINFGFEHHASKLYSGAIEQGIQNSLVPMVIETSGRGERAFDI
FT                   FSRLLRERIIFLGSGIDEHVAGLIMAQLIFLESEDPERDIYIYVNSPGGSVSAGLGIYD
FT                   TMQYIRPDVSTVCVGMAASMGAFLLASGAKGKRASLPHSRIMIHQPSGGAQGQESDIII
FT                   QAREIEKIRRLLEEILASHTGKDVQQVREDSERDRWMNAEEALDYGIIDQVFAKRPAPE
FT                   KKD"
FT   gene            455464..458169
FT                   /locus_tag="Plut_0386"
FT   CDS_pept        455464..458169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0386"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23274"
FT                   /db_xref="GOA:Q3B5V7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23274.1"
FT                   /translation="MSDQQVPFNLEKTYNHSEVEDRWRSAHWEALGTFHAEHSRVHGEG
FT                   RKPYSVLMPPPNVTGSLTLGHVLNHTLQDIFIRYSRMTGKEALWLPGTDHAGIATQTVV
FT                   ERKLRKDGISRHDLGRKDFLTHVWQWREEYGGLILKQLRRLGISCDWRRNLFTMDERAS
FT                   EAVINAFIALYRDGLIYRGKRIINWCPVSQTALSDEEVIMKPRRDQLVYVRYALAKDPA
FT                   RFITIATVRPETILADVAIAVNPQDERFRDLVGEMVVVPIAGRHIPVIADDYVDIEFGT
FT                   GALKITPAHDPNDYAVAGRHNLPVISVVGKDGRMTDEYGYMGMDRFDARKKIIADLDEL
FT                   GNLDRVEDYEHNVGYSERADVVVEPYLSEQWFVKMQPLAEKALQVVNDGEIRFHPPHWI
FT                   NTYRHWMENIQDWCISRQLWWGHRIPAWYGPDGQVWVADSYDEACRLAGTDKLVQDEDV
FT                   LDTWFSSWLWPLTTLGWTGPKSDNEDLRAFYPTDTLVTGPDIIFFWVARMIMAGMYFKG
FT                   DVPFRDVYFTSIIRDMKGRKLSKSLGNSPDPLKVIDTYGTDALRFTIIYIAPLGQDVLF
FT                   GEEKCELGRNFATKIWNASRLVFMQREKHFEGPEDFARYYEGFDPSLESFDMAGRWILS
FT                   SYNAMLERYHAAFAQFRMNDIVKTVYEFFWGDYCDWYLEALKVTLAEGCSPVDARKAVA
FT                   LAVHVLEGSLKALHPVMPFITDEIWHSVLPRPATQSIASSEMPVPAAAPVAEEGFGLVQ
FT                   KVVTEIRSLKALFGVPPGLRAEVRLKGARSAAGASLEGGLSFIAALGQCTPSLLEDGTR
FT                   PPHAAASVVDGHELFVLLEGLISFEKERSRLQKEIQNVSNYVAQLQKKLSNSGFADHAP
FT                   EDVVMKEREKLADAEANLLKLEDNLAVLSD"
FT   gene            458315..459214
FT                   /locus_tag="Plut_0387"
FT   CDS_pept        458315..459214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0387"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23275"
FT                   /db_xref="GOA:Q3B5V6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23275.1"
FT                   /translation="MRQLKISKQITNRESLSLDRYLQEIGKYDLLTADDEVRLTKAIKE
FT                   GFDMPVDTTEYKRAKRALDKLIKGNLRFVVSVAKQYQNQGLTLGDLINEGNLGLIKAAK
FT                   RFDETRGFKFISYAVWWIRQSILQALAEQSRIVRLPLNRVGTLNKISKAYSQLEQEFER
FT                   DPNTKELANLLDMDSQDVADTLKIAGRHVSVDAPFAQGDDNRLLDVLQNDGHLPDHGLN
FT                   RDSLTLEVERSLSVLAPREADVIKSYFGIGMDNPLTLEEIGEKFKLTRERVRQIKEKAI
FT                   RRLRTSAYCKVLKEYIGS"
FT   gene            complement(459416..460219)
FT                   /locus_tag="Plut_0388"
FT   CDS_pept        complement(459416..460219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23276"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23276.1"
FT                   /translation="MAAVNHPPAVVLLTDFGTDDTYVGQMKGVILTIAPETRIIDLTHA
FT                   VTPQDVTEGAFLLERALPYLPPESIVIAVIDPGVGTRRRAIAVEAGGRRFLAPDNGLLT
FT                   PILLKNGPVQCVEVTNRRYIAPERSRTFHGRDIFSPAAAHLATGIALNTLGAAIEPADC
FT                   MKLPMPGCTALGIGVWEGGVIFSDRFGNLVTSIDSSLAAEKDQWRLVLPDGTALPVRET
FT                   YGNVPEGEPLAYRGSFGTLEVGVRDASALERFGLNRGEKVRLERL"
FT   gene            complement(460224..461306)
FT                   /locus_tag="Plut_0389"
FT   CDS_pept        complement(460224..461306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23277"
FT                   /db_xref="GOA:Q3B5V4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23277.1"
FT                   /translation="MKILDRYIFRQFVKTFIFTSLAFVALFMLIHMVENLDDFMDKNQG
FT                   FEAIAQYYLFAIPQTILITSPVSSLLAAILVAGKLAVSSELPAIRSAGVSMGQLLYPFL
FT                   LGGMIISTINLTNSFWIAPAATLRNNNFELTELGHQRRDEEGGNSNLHILEPGNRIITL
FT                   GSLNPDMSSAREVSIEQFSQKGIVSRSDADGMRYNPEKKAWVLENAAERMFEDGSERFW
FT                   TEPMLPVQLHLSLQSLAELNLRPDEMNIARHWQYLSEKKHAGFAGLERSSVKLHTKLSL
FT                   PFASLIIIIIGVPLSAKKKRGGLAAEIGISLFAGFLFLGLQKTIATFGYNGVMPPMLAA
FT                   WLPNLLFLGVGYVIYRYSPD"
FT   gene            complement(461317..464247)
FT                   /locus_tag="Plut_0390"
FT   CDS_pept        complement(461317..464247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0390"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23278"
FT                   /db_xref="GOA:Q3B5V3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23278.1"
FT                   /translation="MNIFVPMLAAGTLLLSVTSCKPMMNASAEAGSYPYRTIPGDSLHT
FT                   RIYTLKNGLTVYMSPYRDEPRIYTSIAVRAGSKNDPAETTGLAHYLEHMLFKGTDSIGS
FT                   LDYEKEHLELEKISELYEEYRAAEDPEKRAAIYRDIDSISNVAASFAVPNEYDKLLNSI
FT                   GAQGTNAYTWVEQTVYLNDIPADKLEQWLTIEAERFRNPVMRLFHTELETVYEEKNMTM
FT                   DSDSRKIWENLFAGLFKKHTYGTQTTIGKAEHLKNPSIRNVMNYYRTWYVPNNMALCIA
FT                   GDFDPDETIRLIERKFSVLEPKALPAFVPPLEEPITKPEVIRVKGPEAEEVVIGFRFQG
FT                   VNTRDADLLTLLDKVLYNQTAGLIDLNLNQKQKVLDAGSMLVLMKDYSAHILSAKPREG
FT                   QSLEEVSRLLLEQVELMKNGEYPDWLLEAAVNDLKIEQLKLYESNRGRVEAYVDSFIWG
FT                   MDWQQYSTQIDRLRTISKEELTAFARKHYKANYVEVQKEHGTPESETKIQKPPITPLKV
FT                   NRDTLSSFAGELLAMPSKGTEPVYLDYRKDIGFREVQSGVKLHYVKNRENDLYSLYYVF
FT                   DTGKNHSRKIELALDYLSYLGTKELPPEEFSRELYRLGTSFSAFTSENFVYLKLSGLRE
FT                   NFPRALRLLETLLQDARPDRDALEKLKAGIRKERADDKLSKRKILFEAMSSYGKYGPKS
FT                   PFTNVLPDHELEALTPEELLGEVQNIMHYTHRVLYYGPDAADAIIQELQTVRRYPAAPE
FT                   APPAADPFPELEQTENTIFVVDYDMTQAEVIMLTRDAIYNPSEVPLISLFNEYYGGGMS
FT                   SVVFQELREAKALAYSVFSVYRSPKQKEKHNYIFSYIGTQSDKLPEALGGISELMQELP
FT                   MSPELFASARNGILQKISSERLTRTEVLFNYEDAVRLGHEGDIRRQIFEGARKMGLEDV
FT                   QRFHESHFRNRKHVMLVLGKKEELDMDTLRKYGAVRELTLENIFGY"
FT   sig_peptide     complement(464161..464247)
FT                   /locus_tag="Plut_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.626 at
FT                   residue 29"
FT   gene            464610..466697
FT                   /locus_tag="Plut_0391"
FT   CDS_pept        464610..466697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0391"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23279"
FT                   /db_xref="GOA:Q3B5V2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23279.1"
FT                   /translation="MQRDRKGKGTETGIYRLVSPYEPAGDQPKAIKELTEGLKAGSPFQ
FT                   TLLGVTGSGKTFTISNVIAQAGRPVLVMSHNKTLAAQLYGELRQFFPDNAVEYFISYYD
FT                   FYQPEAYLPSIDKYIAKDLRINDEIERLRLKATSALLSGRRDVIVVSSVSCIYGLGSPE
FT                   EWKSQIIELRTGMLKERNSFLQELIALHYVRDDVDPGSGKFRVRGDIIDLIPAYDQLAL
FT                   RVEFFGDEIESLQTFDMSSGEVLGSDPYAFIYPARQFVAGEEQLRQAMLRIENELAGRL
FT                   NELRSAERFVEAGRLEERTRYDLEMMKELGYCSGIENYSRHISGRNPGERPHCLLDYFP
FT                   EDYLVVVDESHVTLPQIRGMYGGDRSRKSILVEHGFRLPSALDNRPLRFDEFMDMVPEV
FT                   ICISATPGDLELERSGGVVVEQVVRPTGLLDPPVEVRPVKGQIDNLLMEIRRHTAGGHK
FT                   VLVMTLTKRMSEDLHDFLRKAGVRSRYLHSEIKSLERMQILRELRTGEIDVLVGVNLLR
FT                   EGLDLPEVSLVAILDADKEGFLRNTRSLMQIAGRAARNVEGFVVLYADTITRSIREVLD
FT                   ETARRREIQHRYNEEHGITPRSITKSVEEILDTTSVADAEERYRRRRFGLEPRPERLLS
FT                   GVLESMTPEEGFAMAAELRAEMQQAALAMEYEKAAYLRDEIARLEDRLGGAARVDKEDQ
FT                   A"
FT   gene            466832..469033
FT                   /locus_tag="Plut_0392"
FT   CDS_pept        466832..469033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0392"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23280"
FT                   /db_xref="GOA:Q3B5V1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23280.1"
FT                   /translation="MLAQIEKEHYQKLHEILRLARQNLKQVDESLIQRAFFMCYRAHEG
FT                   EKRASGEPYFYHPVEVATILLNELPLDGVSVAAALLHDVIEDSGYTYEDISAELGPEVA
FT                   DIVEGLTKISGIMINRETTQAEGFRKMLLSMVKDIRVILIKFCDRLHNMRTLESLPEHR
FT                   RLKIALETRDIYAPLAHRFGLGKMKVEFENLALKYIDPEMFDFLQQKVRLTRGERVAYL
FT                   NKMIDPIKDDLEKQGFAVEVQGRAKHLFSIYNKMRNKNKNYEDIHDLYGIRVIIDTERI
FT                   ADCFAVYGFITQKYPPVPQHFKDYISIPKHNGYQSLHSAIIGPKGNMVELQIRTRRMHE
FT                   FAELGVAAHWRYKEKISKDDASIDSFLRWARELIKDADSAAAFMEGFKLNLYHEEIYVF
FT                   TPKGDMKTMPAGATPIDFAYSIHTEIGNSCIGAKVNGRIVRLNAELKSGDRVEIITSKN
FT                   QQPRADWLKLVVTHRAKLKIRSAINEERRLQIEKGRGMWEKMLSGTKKLLSDNDIVRYA
FT                   RRYGVKTPADFFSALASQQINGEEVIKRVNSEQREPEALEIREDPNQFAEYLRTARQGE
FT                   DDRKEHSKKKDDVTIAGMNNIAYAYAKCCQPVPGDDVIGFVTAEGVVKIHRKNCVNVSN
FT                   ENLQKSERVVSVSWNRKVETDFLAGIRIVGEDRIGITNQLTLVMSKFDTNIRSISLHAR
FT                   DGMFVGTVMVYVRNTEKLSALMDKLKKVAGVFTVERLIS"
FT   gene            469061..469714
FT                   /locus_tag="Plut_0393"
FT   CDS_pept        469061..469714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0393"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23281"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5V0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23281.1"
FT                   /translation="MFTIEPLEQPTPYPMSTTASKPITIRVLKIFTLLLFFSSLSGCGY
FT                   NSIQQNDEAVNRAWGDLESQLQRRGDLVPNLVATVKGAADFEKETLTAVVEARAKASSV
FT                   TMTPGMLSDPQAMQRFQSAQGALSSSLSRLLVTVERYPEIKANQNFRDLQNQLEGTENR
FT                   IAVARQRYNGAVETLNFSIRQFPNSMTNSLLLKLKPREYFKADETSKALPEVKF"
FT   gene            469717..470496
FT                   /locus_tag="Plut_0394"
FT   CDS_pept        469717..470496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23282"
FT                   /db_xref="GOA:Q3B5U9"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5U9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23282.1"
FT                   /translation="MVCTFFRERVHDAGALPVRALGVFVLLAALLAAQPSALFALDVPA
FT                   LSGRVNDYGGMISPAARASIDRALSNLEREESTQVVVLTVPSLEGDAIEDFSMRVAEAW
FT                   KIGRKGKDNGALLIASRDDRKLRIEVGYGLEGSLTDLTAGRIVQNEMVPLFRAGRVDEG
FT                   FQQGVISIIAAVHGEYRAEPGEKKKGGRVSLPMLMLLLFFIYFSGFFNRRSGTGGGPFI
FT                   SGGHGGGFYGGGGGFGGGGGFGGGGGGFGGGGASGNW"
FT   sig_peptide     469717..469839
FT                   /locus_tag="Plut_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.644) with cleavage site probability 0.607 at
FT                   residue 41"
FT   gene            470532..471167
FT                   /locus_tag="Plut_0395"
FT   CDS_pept        470532..471167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23283"
FT                   /db_xref="GOA:Q3B5U8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5U8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23283.1"
FT                   /translation="MEHSPVRKLLTEAGQRQVEARIKAAEAGTSGEIVVMVVEESSRYR
FT                   HASVVGALFSSMIVAVAVGHFQGGDGMWHFLGVFVPLFIVFHELLVRFAPLRRLFARKG
FT                   DMADAVGKASLAAFYAKGINGTEAATGVLIYISLFEHMVRVVADKGINEKVDPDAWPEL
FT                   VGGIVQGIRSGEAAAALSEAIDRCGELLSRHFPIREGDRNELSNQIRY"
FT   gene            471487..472584
FT                   /locus_tag="Plut_0396"
FT   CDS_pept        471487..472584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0396"
FT                   /product="Glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23284"
FT                   /db_xref="GOA:Q3B5U7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23284.1"
FT                   /translation="MKKTALYPWHEKAGARIIDFGGWLMPVQYSGIIAEHRAVRSAAGL
FT                   FDVSHMGNFYVKGPRAEEFLQHMTTNDLSRAKNGQAQYNVMLYPNGGIVDDLIIYRIDA
FT                   QTFFIIVNAGNCEKDYQWLQEHAAEYDGVVLEDHSSAMSLIALQGPKAFDILKKVLPSL
FT                   DAPSLGSFHFCTLEYSGAELMVARTGYTGEIGVEICMPNEMALPLWEDLLEAGRPEGIL
FT                   PIGLGARDTLRLEMGYSLYGHEIDQDTNPLEARLKWVVKLDKGHFIGREACLQVELNPK
FT                   RSVAGFVLEGRALPRQGCKLFNSDHQEIGRVCSGTLSPTLQEPVGTCSLLREYQKPGTR
FT                   VFVEIRGTMQPGTIRPLPFVKTSLS"
FT   gene            472710..475019
FT                   /locus_tag="Plut_0397"
FT   CDS_pept        472710..475019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0397"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23285"
FT                   /db_xref="GOA:Q3B5U6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23285.1"
FT                   /translation="MLSALFLAGSTITFHPGDQAVYIQLPWYDILGPAARDAVAHIQTP
FT                   FGLLGARVGSFFVRSFLGFPSLLLFSAVFYWGLSLFRSKSLKSALIFFLYSVLMSLDLA
FT                   AMGGLTPFAFSDLLAGYVGRMLAEMFSTLLGATGAWALLLAIAAVPSFYLGRTMFSRVS
FT                   AGVAPAAALPSRLFSRIGNVFRALGKKKNEPAAVPAAIARPAEASVVPPPAPERLEGNA
FT                   HLPYSTPALFSSPSGVSRDDGVELVVQQATHETEADLDDRKLKVKTKDRDTYRIPSIDL
FT                   LEKGPEGDGVIDEVHLAESKRRLLEKLSIYKIEVKRIQATVGPRVTLFEMELAPDVKVS
FT                   RVTALENDLAMALAARGIRIIAPIPGKNAVGVEIPNSRPETVMLRSVLQVEKFKNSPYT
FT                   LPIVLGKTISNEVYIDDLTAMPHLLIAGSTGSGKSVGINVILSSLLYSCTPDKVKFVLI
FT                   DPKRVELFHYQHLKNHFLLRFPGFDEQIVTEPQKAVYALKCVEKEMELRYIRLEQAGVR
FT                   NIGDFNRSNPIDAMYYIVVVIDELADLMITAGRDVEEPITRLAQLARAVGIHLIVATQR
FT                   PSVDIITGIIKANFPSRIAFQVASKVDSRTILDGSGAEQLLGDGDMLYQPSSLPKAIRL
FT                   QGPYVSAKEVEAVTRYIGSQHALTDVHDVLLPKGEMRKRGSSENGAPQSFGAEDEERDP
FT                   AFDEAARLVVMSQQGSTSLLQRRLRLGFSRAGRVMDQLEKEGIVGPQDGSRARDVLIAD
FT                   LSELEVRLNAPPEEDY"
FT   gene            complement(475105..475374)
FT                   /locus_tag="Plut_0398"
FT   CDS_pept        complement(475105..475374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0398"
FT                   /product="NifU protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23286"
FT                   /db_xref="GOA:Q3B5U5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23286.1"
FT                   /translation="MYAMSTSKDYLPNSDALYDRVIAALETVRPYLQVDGGDCQLVGIT
FT                   KDMVVDVKLLGACGSCPMSTLTLRAGVEQAIKKAIPEIVRVESV"
FT   gene            complement(475453..476640)
FT                   /locus_tag="Plut_0399"
FT   CDS_pept        complement(475453..476640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0399"
FT                   /product="ATP-binding protein, Mrp/Nbp35 family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23287"
FT                   /db_xref="GOA:Q3B5U4"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23287.1"
FT                   /translation="MPAIDQQQILHALSTVQEPDLKKDLVTLGMIRDVAVSDAGDVSFS
FT                   VVLTTPACPLKEEIKTACVKAVKAAVPGVGTVKVSMEATVTSASSCSHGHQPGDGHSHE
FT                   NGHQCSSGQCGGHDQPLQGVKNIIAVASGKGGVGKSTIAVNLAVSLAESGAKVGLIDAD
FT                   LYGPSIPTMFGLHSEKPEMSGKKIQPLEKYGVKLMSIGFLIETDTAVIWRGPMASSAIK
FT                   QFITDVDWGELDYLVFDLPPGTGDIQLTLVQTVPVTGALIVTTPQDVALADVSKAVSMF
FT                   HKVNVPILGLVENMSWYELPDGSRDYIFGQKGGERFAKAQGLSFLGAIPIERGVGEGSD
FT                   SGVPYVIGKPNSTSAKALKATAMETARRISITNASSRDENTGCGSGCGCGNDETV"
FT   gene            complement(476674..477984)
FT                   /locus_tag="Plut_0400"
FT   CDS_pept        complement(476674..477984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0400"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23288"
FT                   /db_xref="GOA:Q3B5U3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23288.1"
FT                   /translation="MKPLIALVGRPNVGKSTLFNRILREKAAIVDPTPGVTRDRHIAEG
FT                   HWQGREFRLMDTGGYAPEDGVISTAMLEQTMMAIQDADIIIFLADVRSGVSYDDLELAK
FT                   ILKRDFSDKPIFLAVNKAESPQLAIEAASFVSTGFTEPWAISARDGSGVADLLDEILLT
FT                   FPESDGPPEEDGAIRLAVIGRPNVGKSSFVNALLGSNRQIVSSIPGTTRDAIDTRFTRK
FT                   QQEFMLIDTAGLRKRTKISAGIEYYSSLRSERAIERCEVAIVMLDATPGIEKQDLKIIN
FT                   IAAERKRGVLLLVNKWDLVEKDSKTSKQYEESLRSHMGNLSYIPVIFTSALTKKNLYRA
FT                   IDTAKEISQNRSRKISTSALNRFLEEALAANHPSTRTGKELKIKYMTQIEAPWPVFAFF
FT                   CNNPELVQTNFRKFLENKLREKFSLEGVTISLRFMQK"
FT   gene            478128..478577
FT                   /locus_tag="Plut_0401"
FT   CDS_pept        478128..478577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0401"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23289"
FT                   /db_xref="GOA:Q3B5U2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23289.1"
FT                   /translation="MSKTLSFKTYSAKPADVERKWYVIDAEGQVLGRMAAEIARVLRGK
FT                   HKPQFTPHVDTGDFIVVTNAEKVALSGNKENLKTYFSHSHYPGGVRVDSVKDLLRKKPE
FT                   KIIEHAVWGMLPHNNLGRQLFRKLKVYAGTQHPHEAQAPTEMKIH"
FT   gene            478596..478985
FT                   /locus_tag="Plut_0402"
FT   CDS_pept        478596..478985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0402"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23290"
FT                   /db_xref="GOA:Q3B5U1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23290.1"
FT                   /translation="MKEVIDTVGRRKTSVARVFMTPGKGRVIINKLPVEEYFRDEVKRL
FT                   HALRPLVLTEKTEDFDIKVNVKGGGLSGQSGAVSLGIARALTEFDEAARAVLKQERLLT
FT                   RDPRMVERKKFGRKKARKSFQFSKR"
FT   gene            479145..479906
FT                   /locus_tag="Plut_0403"
FT   CDS_pept        479145..479906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0403"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23291"
FT                   /db_xref="GOA:Q3B5U0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5U0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23291.1"
FT                   /translation="MSHFQLEEMLRAGVHFGHLARRWCPKMKPYIFMEKNGVHIIDLQK
FT                   TLVLADDALNALDAIAQTGREIMFVGTKKQAKQIIAAEATRAGMPFVCERWLGGMLTNF
FT                   STIRQSIRRMNSIERMETDGTFDMITKKERLMLAREREKLMRILGGIATMTRLPAALFI
FT                   VDIKKEHIAIKEARSLGIPIFAMVDTNCDPEQVDYVIPANDDAIRSIQLMVKAVADTVV
FT                   NARAMKVEQEVLAEMDAPEVDAAEDAAQSAE"
FT   gene            479945..480811
FT                   /locus_tag="Plut_0404"
FT   CDS_pept        479945..480811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0404"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23292"
FT                   /db_xref="GOA:Q3B5T9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5T9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23292.1"
FT                   /translation="MSQISAKDVKDLRDTTGIGMMDCKKALEETGGDMEKAIEYLRKKG
FT                   AALAAKRAEKDASEGMICIRVSADRKSGVILELNCETDFVARGEVFTGFAGALGDLALE
FT                   NRTVSTDALLKLRMADAMGGELVDDAIKTMTGKLGEKIDLKRLFFFDAADGLVESYVHP
FT                   GAQLGAIIHLATDKPEAVAPLAKDLAMQVAAAAPIEVDRSAVPQELIAKESEIYRQQAL
FT                   GQGKKEEFVDKIVLGRLDKYYQEVVLLEQSFIKSNNMKVSAVLDEFRKLLQAAVDVKEF
FT                   VRYQLGE"
FT   gene            480930..481637
FT                   /locus_tag="Plut_0405"
FT   CDS_pept        480930..481637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0405"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23293"
FT                   /db_xref="GOA:Q3B5T8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5T8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23293.1"
FT                   /translation="MQYRRILLKLSGEALAGKDGYGINAEMLERFAEEVKEARDMGAEI
FT                   ALVIGGGNIFRGVSDAAKNMDRVQADYMGMLATVINSIAFQDALERLGVYTRLQTAIKM
FT                   EQMAEPFIRRRAIRHLEKGRVVIFGAGTGNPYFTTDTAASLRAIEIEADVIVKGTRVDG
FT                   VYDSDPETNPSAEFFPKISYLDVIRKNLRVMDMTAITLCRENTLPIVVMNMNEKGNLSR
FT                   LIRGEHVGSLVHA"
FT   gene            complement(481634..482170)
FT                   /locus_tag="Plut_0406"
FT   CDS_pept        complement(481634..482170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0406"
FT                   /product="regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23294"
FT                   /db_xref="GOA:Q3B5T7"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23294.1"
FT                   /translation="MYSRRNAPRGQAALESSQSLASAHAFKLLGLRSHSQMELETKLKK
FT                   KGFEGAHIAGAIERLKELKLIDDRAFAEEFLRSRSRMKQAGRMKLRMELRKRGISDAII
FT                   DVLLKSHDTSAPCLEAAKKKMRALGSSPGVREKEKLVRFLQGRGFMWEEIRETLQVLMP
FT                   GSGGRSPLPDNEEEV"
FT   gene            complement(482160..483560)
FT                   /locus_tag="Plut_0407"
FT   CDS_pept        complement(482160..483560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0407"
FT                   /product="Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23295"
FT                   /db_xref="GOA:Q3B5T6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23295.1"
FT                   /translation="MPATITTRPLKILLVSPQGKMDDDSNQKPLFHMALAVLVSLTPPQ
FT                   HDIEMVDEHFHDSIDYDGDYDLVGITSRTLEATRAYEIADTFRAHGKKVVLGGLHISFN
FT                   PEEAAIHADSIVVGEADNLWASLIDDVGNGALKPLYDSKQYPPVKEIVPIDYARISRSS
FT                   KRGKVDGTKSIPIYVTRGCPFNCSFCVTPNFTGKQYRAQKAESLKSQVEEAKKYFFKAS
FT                   SSSKKPWFMLTDENLGINQKKLWEALDLLKECDITFSVFLSINFLEDPQTVKKLVDAGC
FT                   NFVLAGLESIKQSTLEAYNKGHVNSAEKYSKIIEDCRRAGLNIQGNFLFNPAIDTFEDI
FT                   DELVRFVEKNHIFMPIFQIITPYPGTQMYLDYKRDGLITIEDWEKYNALHLVIKSERYD
FT                   PVLFQYKVLSSYAAIYSWRHIIGRIWHNPKKVINLITNLAFRHHLNSELNAFEATHNVT
FT                   PESLQNVQ"
FT   gene            483829..484299
FT                   /locus_tag="Plut_0408"
FT   CDS_pept        483829..484299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0408"
FT                   /product="2-vinyl bacteriochlorophyllide hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23296"
FT                   /db_xref="GOA:Q3B5T5"
FT                   /db_xref="InterPro:IPR009905"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23296.1"
FT                   /translation="MPRYTPEQLAKRNASIWTDIQIILAPIQFIIFLTGVSVTALYLNG
FT                   IITSFYWVSLAILFKTLFFALLFVTGMFFEKEIFDKWVYSKEFLWEDVGSTIAAAFHLL
FT                   YFVMAWMGYPEEVLVWEAFLAYFTYVINALQYLVRIILEKHNERKLRMGGHI"
FT   gene            484305..484529
FT                   /locus_tag="Plut_0409"
FT   CDS_pept        484305..484529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23297"
FT                   /db_xref="GOA:Q3B5T4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23297.1"
FT                   /translation="MMQYSFTKLWNLTFLFVAPFWFTLVWMIWSSGQLATDADRAVFAL
FT                   FVVPGFLVIYLSGFLIEGWHKKKKSQSAR"
FT   sig_peptide     484305..484412
FT                   /locus_tag="Plut_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.884 at
FT                   residue 36"
FT   gene            484569..486674
FT                   /locus_tag="Plut_0410"
FT   CDS_pept        484569..486674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0410"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23298"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23298.1"
FT                   /translation="MQNLWNDSDVLNPAVGQEMPRELSELVYASRLLGRESSLVMHGGG
FT                   NTSVKSQLHDFIGNGVNVIFIKGSGVDLADVQAHDFTPVRIDPLQKLQHLYATGERKSD
FT                   EDIQRFSTREFKHFLYLNLFHLTDHMVSNALTPSIETLLHAFLPHRFIFHTHSLAFLTL
FT                   SNQPEGEKLCGEVLGDGFGSVPYIKPGLGLARHAAKAFAADPAIRGLALHKHGLVTFGD
FT                   TAREAYDRMIEAVSVLESRIAAKPRGVFPAAPLPASLPPVEDVAPIIRGACVEEKEPGT
FT                   KDYDQFILDFRSSGRVLEYVNSRNLSEMSRKGAMTPDFIVRTKNRPLVLPAPDAVDMDG
FT                   FKTAVHEAVRQYRADYEAYFTEQKAASGSEAGMLDSLPRVALVPGIGLFGLGRTAKAAR
FT                   VNADIAAGSAAAILDAESIGTFRSITDREAFDIEYWEMEQAKMQKVRHLAFAGKVAMVT
FT                   GGAGGIGLATAKAFKQKGAEIVLLDLHMDALERAAEELGGDVLAMACDVTDRNAVRAAF
FT                   HAACRRFGGVDIIVSNVGAALQGRIGEVPDEVLRKSFELNFFSHQSIAQEAVRVMKLQG
FT                   TGGVLLFNVSKQAVNPGPDFGPYGLPKAATMFLVRQYALDHGRDGIRANGINADRIRSG
FT                   LLTPEMIKARSAARGLSEREYMAGNLLQLEVTAEDVAEAFVHLALEKRTTGSITTVDGG
FT                   NIAAALR"
FT   gene            486723..487604
FT                   /locus_tag="Plut_0411"
FT   CDS_pept        486723..487604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23299"
FT                   /db_xref="GOA:Q3B5T2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23299.1"
FT                   /translation="MAEYDKDKQAKEYYTDIPVNNYGFFLKGAHSLDWGMKNRLSRIFR
FT                   PDTGKTVMFAIDHGYFQGPTTGLERPDVNIVPLMPHADAIMLTRGILRTTVPPSLTKAV
FT                   VMRCSGGPSILKELSDEELAVDIEDAIRMNVACITLQVFIGGEYETRSIKNMTRLVDMG
FT                   LRYGIPTMAVTAVGKDMVRDAKYFRLATRICAELGAQVVKTYYVEEDFDTIVASCPVPI
FT                   VMAGGKKLPEKDALAMSYRAIQEGASGVDMGRNIFQSDYPLAMMKSVNRVVHEGLTPDE
FT                   AFEYFNSIKGEG"
FT   gene            487670..488998
FT                   /locus_tag="Plut_0412"
FT   CDS_pept        487670..488998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0412"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23300"
FT                   /db_xref="GOA:Q3B5T1"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23300.1"
FT                   /translation="MREGDEALLMNTDDIRGFFASREQLDMADYLTLEYYVECVGDIET
FT                   ALAHFCSEQSTAQWRRVGHDEDFRPRFGAKVIGLQIEGELEQLSYPVQHSETGPIHACR
FT                   VTIAHPHRNFGPKLPNLLTAVCGEGVFFTPGIPVVKLLDITFPEPYLNAFDGPKFGIEG
FT                   IRDLLKAYDRPIFFGVVKPNIGLSPAHFAEIAMESWLGGLDIAKDDEMLADVEWSTLAE
FT                   RSRELGLARIRAEKETGEPKVYLANITDEVGSLKEQHDVAVRNGANALLINALPVGLSA
FT                   VRMLAAYTKVPLIGHFPFIAAFSRMEKYGIHSRVMTKLQRLAGLDSIIMPGFGSRMMTP
FT                   EEEVKENIAECLQDFGHIRRSLPVPGGSDSALTLETVYRKVGSVDFGFVPGRGIFGHPM
FT                   GPKAGAASIRQAWDAIEKGVSLERYAEGHPELGAMVAGARRSH"
FT   gene            489016..489840
FT                   /locus_tag="Plut_0413"
FT   CDS_pept        489016..489840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0413"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23301"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23301.1"
FT                   /translation="MQKLDGRVTVITGSTKGIGNAIAHAFVREGAKVVITSSSEPNVRH
FT                   ALDAFPEGTALGFRCDVTSPAEVERLLEAAVERFGRIDCFINNAGISDPFQSLAESDPD
FT                   LWGRVIDTNIKGTYYASRAAIRYFLQFNPNGKLINMAGSGTDPQSNTPWISAYGSTKAA
FT                   IARFTRSVAAEYRHTGMSIMLLHPGLVRTAMVSPSEPTAELLKQLHTFNTVLDIFAQPP
FT                   SVAARLAVKMASEWSDGRTGIYLSALGNWRKKRLLLSFPFRKMFNRIDRRTY"
FT   gene            489858..490358
FT                   /locus_tag="Plut_0414"
FT   CDS_pept        489858..490358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23302"
FT                   /db_xref="GOA:Q3B5S9"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23302.1"
FT                   /translation="MLKIAVARVLFLPLLFLLLFIGGCYSLTGGSIPPHLKTVAVPVFA
FT                   GGSEYRADLTRALSGKIESESSLQVVNSIARADALIEGSITSWSDTANQLSATTERAAT
FT                   NRITIVVQVNMDDRVEKRSVFAEQFVGFADYTTGDYLGQQRALRSCMQQIVDEAFDRIV
FT                   SGW"
FT   sig_peptide     489858..489938
FT                   /locus_tag="Plut_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.659 at
FT                   residue 27"
FT   gene            490433..490879
FT                   /locus_tag="Plut_0415"
FT   CDS_pept        490433..490879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23303.1"
FT                   /translation="MGLHEDVGYRLNLAGGFLKEAEQDFGLSRWRSCTAGSVLVVENAG
FT                   IAVLMLFGVSPSTHKPGMHLSQLLSEGTLERKAAELIEELLPMFEQHDSHEKMLAKYGD
FT                   EAGCRLPWEIFGEPEASAALDAARKAVRIASDLAAIVLPKDMKK"
FT   gene            490884..491762
FT                   /locus_tag="Plut_0416"
FT   CDS_pept        490884..491762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0416"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23304"
FT                   /db_xref="GOA:Q3B5S7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23304.1"
FT                   /translation="MKGIILAGGSGTRLYPVTRGTSKQLLPVYDKPMIYYPLTTLMLAG
FT                   IREILIITTPEDQPSFMKLLGDGSDWGIRLTYAVQPSPDGLAQAFIIGEEFIGGDDVAL
FT                   VLGDNIFFGYGFSQMLHSAVKTVTEDRKSCVFGYAVSDPERYGVAEIDAEGNVLSIVEK
FT                   PEHPKSDYAVVGLYFYTGDVVEVAHGVRPSERGELEITAVNEEYLRRGKLKCSMLGRGF
FT                   AWLDTGTHESFQEAGNFIQTVEKRQGLKVACPEEIAWRNGWISTDALKELALPLMKNQY
FT                   GQYLLRLLSRP"
FT   gene            491831..492415
FT                   /locus_tag="Plut_0417"
FT   CDS_pept        491831..492415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0417"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23305"
FT                   /db_xref="GOA:Q3B5S6"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23305.1"
FT                   /translation="MRVTATIIPDVLELEPEVLGDQRGYFLESFRQDVIEESVGRVSFV
FT                   QDNESKSRRGVLRGLHFQKPPYTQSKLVRVVSGRVLDVALDIRIGSPWYGRHVACELDG
FT                   ERKNMLWVPKGFAHGFVVLSDEAVFAYKCDNYYMPSHEGGIHWNDPALGIDWKLDPSLI
FT                   LVSARDSSLPGLSSADSFRYEEFSADRIYRR"
FT   gene            492412..493278
FT                   /locus_tag="Plut_0418"
FT   CDS_pept        492412..493278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0418"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23306"
FT                   /db_xref="GOA:Q3B5S5"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23306.1"
FT                   /translation="MNILVAGGRGQLGSELQALRKGAGAHRFLFLDRPDLDITDSGSVR
FT                   GAFDRFQPDVVVNAAAYTAVDRAEEDREAAFLVNRDGAGVLAGCSRDAGAFFIHVSTDY
FT                   VFDGTASRPYREEDMPCPEGVYGRSKFEGERLVASVDPSHAIIRTSWLYSAYGQNFVKT
FT                   MLRLGRERESLGVVFDQTGTPTHAADLASAVLHIALRHDPAFHYRGVWHYSNEGVASWY
FT                   DFAHAVMEFAGLPCRVEPITSREFPQVAVRPAYSVLDKSAVKRDWDLRIPYWQDSLKTL
FT                   LTTINPR"
FT   gene            493292..494344
FT                   /locus_tag="Plut_0419"
FT   CDS_pept        493292..494344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0419"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23307"
FT                   /db_xref="GOA:Q3B5S4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23307.1"
FT                   /translation="MHLLITGGAGFIGSHVVRHFLSAHPDCRITNLDSLTYAGNLANLR
FT                   DVEDNPRYTFLKGDITDRGFIDRLFGQTDIEGVIHLAAESHVDRSIADPTAFVMTNVIG
FT                   TVNLLDAARRHWNGRYEGRRFYHISTDEVYGSLEKGTGMFTETTPYDPHSPYSASKASS
FT                   DHFVRAYHDTYGLPVVISNCSNNYGPFQFPEKLIPLFINNIRNSKPLPLYGKGENVRDW
FT                   LWVEDHARAIDVIYHRGRDGATYNIGGHNEWSNIDLVRQLCHIMDEKLGRRAGESEKLL
FT                   TFVTDRAGHDLRYAIDSSLLQRELGWVPSLSFEEGLQKTVEWYLANEEWLGGVTSGAYQ
FT                   HYYEAHYGGR"
FT   gene            494366..495352
FT                   /locus_tag="Plut_0420"
FT   CDS_pept        494366..495352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0420"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23308"
FT                   /db_xref="GOA:Q3B5S3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23308.1"
FT                   /translation="MQILVIGGAGYIGSHVVRAFLDNGHEVTVFDNLQTGLRENLFRDA
FT                   SFIHGDIMNPLQLRAAMASGFDGCVHLAALKAAGQSMLEPEAYAESNLTGTINILAEAS
FT                   RAGIGRIIFSSSAAVYGSPAYLPIDEEHPKNPENFYGFTKLEIERLLEWFDRLKGMRYA
FT                   AIRYFNAAGYDTDGRIGGLELQPENLLPIVMEVAAGMRPELSIYGNDYPTRDGSCIRDY
FT                   VHVSDLADAHVSAFDYIGRHERSLSVNLGSERGVTVQEMIERARAITGRPIPAVIAGRR
FT                   AGDPAELVASSVKARELLGWVPRFSDVDTLISSTWKMYERTLAAKTL"
FT   gene            495349..496776
FT                   /locus_tag="Plut_0421"
FT   CDS_pept        495349..496776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0421"
FT                   /product="mannose-6-phosphate isomerase, type 2 /
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23309"
FT                   /db_xref="GOA:Q3B5S2"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23309.1"
FT                   /translation="MSAPMIVPVILSGGAGSRLWPLSRALYPKQLLPLCSENTMLQDTV
FT                   GRLRDLPGHGPVYCVCNESHRFLVAEQLRATGVPVGGIILEPVGRNTAPAAAVAAMLLE
FT                   RKHPGALMLLLPADHVIADGGAFGAAIEAGAEAAREGGLVTFGVVPTAPETGYGYLKAP
FT                   AEGGEGLRPRKVEQFVEKPDRKTAERYLESGGYYWNSGIFLFSAKAFQGELQLHAPEML
FT                   AACKRALDGASEDLDFLRLDRDAFISSPSDSIDYAVMEKTEHAFLVPLDAGWNDVGAWS
FT                   ALWSVHERDGSGNVTKGDVLLQDVSDSYIHASSRLVAAVGLEHHIIVETCDAVLVASKD
FT                   RVQDVKLLVDELKKQNREEADIHRRVFRPWGSYETVDQAERFKVKRITVNPGAALSLQK
FT                   HLHRAEHWIVVRGTARITVEDREVTLHEDQSTYIPVGSFHRLENPAEVPLELIEVQTGG
FT                   YLGEDDIIRVDDRYGRS"
FT   gene            496876..497094
FT                   /locus_tag="Plut_0422"
FT   CDS_pept        496876..497094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23310"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23310.1"
FT                   /translation="MAEEMKTPAPAPQQKGGDVVKGDFATILVGVGTLLDNTLTPLGKM
FT                   VADALDSLTVVAKQILDGVNTSLGDRK"
FT   gene            497226..500495
FT                   /locus_tag="Plut_0423"
FT   CDS_pept        497226..500495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0423"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23311"
FT                   /db_xref="GOA:Q3B5S0"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5S0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23311.1"
FT                   /translation="MISRNTMSDKFAEYPSSMPYSEMEAAVLTYWNEHDIFHKSLEERP
FT                   SDRVFSFYEGPPTVNGKPGVHHVFSRTIKDAVCRYRTMQGYRVPRKAGWDTHGLPVEIS
FT                   VEKKLGLKNKAQVEEYGEGEFNAEARALVYHHIDDNREGWGKLTERMGYWVDMDHPYIT
FT                   CENNYIESVWWALKTIFDKGLIYKDYKIVPQDPKSETVLSSHELALGYKEVKDPSVYVK
FT                   FPLKGDGASFLVWTTTPWTLISNVALSVGADIGYVKVKHAESGEVLILAESRLQVLLEK
FT                   NEEGQSLWNVVERIEGRALEGLEYEPLFDHFSPSRKSWYVTLGSFVSTGDGTGIVHIAP
FT                   AFGADDYEVSKQYDLPMLQPVGRNGCFTAEVPEYEGMFFKDTDPLIITRLKEEGKLYRK
FT                   ETITHTYPFSWRYDVPVIYYARESWYIRTTSIADRMVELNKTINWCPPEIGSGRFGNWL
FT                   EENKDWALSRERFWGSPLPVWVAEDFSIGDDAASGKMFAVGSIAELREGFIDIDGSRMV
FT                   LGEALDQGLAELDLHKPFVDRIYFIRDGVRFTRTPELIDVWFDSGSMPFAQLHYPFENR
FT                   ELFEQTFPADFIAEGVDQTRGWFYTLHAVSTLLFDRPAYRNLIVNGHILDKNGQKMSKS
FT                   KGNVVDPFETMQKYGADAIRWYLLVASPPWRPKSFNTEEIEEEQRKFFRAYINSYNFFV
FT                   LYANVDGFTGSEPAVPLLQRSELDRWVLSSLSSLVGGVHSRMEQYDLTGAARLVDDFIV
FT                   DDLSNWYIRRSRKRFWKSDMGPDKLAAYQSLHQCLETLARLLAPFTPFLAERIYLNLHA
FT                   LKGTTGRESVHLAEFPTIDNAAVDLPLERRMKKAQIITSLVRTMRERASIKVRQPLSRI
FT                   LLAVADSTEREEYRLVADIITEEVNVLNIEYVDEDGSVISKKVKPNFKTLGPKFGKDMK
FT                   QLAEAVRSMSHKQIAHLEKEGSLTLEWAERSFDILRGDVEIMHEDIEGWLVASDEAHGI
FT                   MVALDTEMSETLEMMGLSRELVSRIQSMRRESGLDITDRIRLRVEGSEKLLEAVQRNDA
FT                   YIKDETLATALELAPLDPEAHRPTVAETVNGELCRIALDKS"
FT   gene            500561..500995
FT                   /locus_tag="Plut_0424"
FT   CDS_pept        500561..500995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0424"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23312"
FT                   /db_xref="GOA:Q3B5R9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23312.1"
FT                   /translation="MTKKSSSASKKDQEIIEEPVLNKTYLTDEELEHFRQLLLKRREEV
FT                   LRDLDILRSSLSDENVEDSINSNYSMHMADHGTETMDREQRFMFIARDEKYIGYIDQAL
FT                   DRIRNRTYGICIKSGKPIPKKRLEAVPHTAVRIEFKQGKK"
FT   gene            complement(501127..502620)
FT                   /locus_tag="Plut_0425"
FT   CDS_pept        complement(501127..502620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0425"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23313"
FT                   /db_xref="GOA:Q3B5R8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23313.1"
FT                   /translation="MCGVFGIFNSKTPAEDTFYGLYSLQHRGQEAAGIVVADYSKARKK
FT                   TIFKQHKGMGLVSEVFRDETVFDTLSGYAAIGHNRYSTTGSAKSTNNIQPFSLIYRSGS
FT                   LAIAHNGNLTNARKLRNELTELGVIFQASSDTEIIPHLAARSREKEPVQQIYEALQQVQ
FT                   GAYSMVLLANNQMIAARDPYGFRPLALGKKTDPLTGELAYVIASETCAFDIIQAEYIRD
FT                   IEPGEILLIDHLAVANEKPTSLFLPPSERKARCIFEYVYFARPDSFIFGNSVDKVRRNL
FT                   GKNLARESSIEQTPGEKELTVVSVPDSSNTAALGFVRESNRAGRPARFEHGLIRNHYVG
FT                   RTFIQPGIQSRDIKVRSKYNIVRGVLQDRPIILIDDSIVRGTTARMLIKLIREADPKAI
FT                   HLHISSPPITNPCFYGMDFPTKRQLLTHMFDSIENEVDEIEKIREYIGVDTLTYLSMPG
FT                   LINSVPSFEGESCSYCTACFSGDYPIQVNEATTDKEEND"
FT   gene            502832..503350
FT                   /locus_tag="Plut_0426"
FT   CDS_pept        502832..503350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23314"
FT                   /db_xref="GOA:Q3B5R7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23314.1"
FT                   /translation="MKNTSAAPTVPSPALWLAITLLWGTVFYATSVYMLRLASQQLAGG
FT                   LFDPSGEAVLNVYGMHAVLLVSFALIAMTARMALDPGANSQIRRWEAVKGGYGEKVFIS
FT                   LSGSIATGFFFTILTALTWTASSELFPAGSALSLSVVFLASFYNIGAGLSASLLVGLVF
FT                   FLSGIGKKA"
FT   gene            complement(503406..503481)
FT                   /gene="tRNA-Ala4"
FT                   /locus_tag="Plut_R0045"
FT   tRNA            complement(503406..503481)
FT                   /gene="tRNA-Ala4"
FT                   /locus_tag="Plut_R0045"
FT                   /product="tRNA-Ala"
FT   gene            503631..504518
FT                   /locus_tag="Plut_0427"
FT   CDS_pept        503631..504518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0427"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23315"
FT                   /db_xref="GOA:Q3B5R6"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23315.1"
FT                   /translation="MSLRFIVREGFSGISRARVPAALTVTISFFALVLLGLFGTVSLGF
FT                   YDIIQELRGRVELEVFFSDAMPAAEARAASMKMQDLAGVKESRFIDKDEARKIFTGDFG
FT                   EDVVTILGSNPLPRSIRLRFHPAYATPDSLQPIMAAVRSIAPGSDIRYNKAFLLEIEKN
FT                   ARLFTIITGSIGLLISMATVVMVGYTIRLAMYSRKEKIRTMRLVGASASFIASPYLLEG
FT                   ALEGLLAGLLASGALALIFEQVLQRYEPGLYLVLQSSALLAYPSVALLGIILGLFGSAL
FT                   SVSKYLHSASRVLR"
FT   gene            complement(504531..505370)
FT                   /locus_tag="Plut_0428"
FT   CDS_pept        complement(504531..505370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0428"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23316"
FT                   /db_xref="GOA:Q3B5R5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23316.1"
FT                   /translation="MKRLGAHVSIAGGIENAPLNARAIGATAFALFTKNQRQWKSPPLL
FT                   PASIEAFRQNCADGGFEMRHILPHDSYLINLGNPDPLKLERSRAAFIDEMQRAESLGLE
FT                   LLNFHPGSHLNLSTPDECLRRIADSINMALEHSSCVTAVIENTAGQGTNLGNRFEQLAA
FT                   LIEMTDDKSRVGVCLDTCHLFAAGYDLATADAAGETFREFDRVVGMRYLRGMHLNDALH
FT                   PVGSRLDRHACVGKGKIGLDAFRLVMQSPAFEEIPLILETPDSDGWAEEIRMLYGLQ"
FT   gene            complement(505367..506353)
FT                   /locus_tag="Plut_0429"
FT   CDS_pept        complement(505367..506353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0429"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23317"
FT                   /db_xref="GOA:Q3B5R4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23317.1"
FT                   /translation="MITLSVVVPFYNERESIPELVGELSGALSDPLLHGLLPEPFSHEI
FT                   ILVDDGSTDGSGEAAKAIAETVPEVKLISFRKNSGKTAALSAGFRAAEGLFICTLDADL
FT                   QDDPRSIRPLLEKLLEGYDLVSGWKLHRNDPVTKTVPSRIFNAATRLFTGVRLHDINCG
FT                   LKLYRREVPESIELHGDMHRYIPVLAAWKGYRIAELPVLHRRRRYGRTKYGSARFLKGL
FT                   FDFFAVLFITRYFRRPMHFFGMAGLVSFLLGFSVSAYVTLDKVLNNRYISNRPILFLGI
FT                   LLLILGVQLFSTGLLGEMLSTTSGARESFLIRDTLNLTPEQQQKISE"
FT   gene            complement(506443..507114)
FT                   /locus_tag="Plut_0430"
FT   CDS_pept        complement(506443..507114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0430"
FT                   /product="radical activating enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23318"
FT                   /db_xref="GOA:Q3B5R3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23318.1"
FT                   /translation="MTGTILQISEIFHSIQGESSFAGWPCTFIRLAGCSHGCRYCDTTY
FT                   AKTAERRLSIGDTIDEARRYHAHLIEVTGGEPLEQPAVHKLLHALCDGGGGVMLETGGF
FT                   LSVRDVDPRVHKVIDLKPPSSGRDKENCMENIDIALNAGEGERKRYEFKIVAADREDYL
FT                   WARGILKDTRLAEACTVMMGPIAGTIHPSELAGWILEDRLHVRMQLQLHRYIWPGMDRG
FT                   V"
FT   gene            complement(507111..507713)
FT                   /locus_tag="Plut_0431"
FT   CDS_pept        complement(507111..507713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0431"
FT                   /product="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23319"
FT                   /db_xref="GOA:Q3B5R2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23319.1"
FT                   /translation="MSNPKRRLAVFCSGTGSNFMAVHKAIAERRLQAEIVLCISNRSQC
FT                   GAMEFARRKGIDTLHISEKQFNGQEEFARAMIQALEAYGIETILLAGYMRKIPAEVTVA
FT                   YRGNILNIHPALLPKFGGEGMYGIHVHTAVLAAGEQQSGASVHFVDEEYDRGEILLQGT
FT                   VPVMEGDTPETLAARVLECEHRIYPEALEKLLLRFRQ"
FT   sig_peptide     complement(507639..507713)
FT                   /locus_tag="Plut_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.608 at
FT                   residue 25"
FT   gene            507793..509367
FT                   /locus_tag="Plut_0432"
FT   CDS_pept        507793..509367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0432"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23320"
FT                   /db_xref="GOA:Q3B5R1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5R1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23320.1"
FT                   /translation="MSDPLIKRALVSVSDKTGIVDFCRELSSLGVEIFSTGGTLKALQD
FT                   SGVKAASISLITGFPEIMDGRVKTLHPKIHGGLLAVRDNADHVAQAVENGIGFIDMVVV
FT                   NLYPFEATVARPGVSFEDAIENIDIGGPSMLRSAAKNNESVTVLTDSADYPCVLAEMRS
FT                   SGGRTTRATRLRLARQVFQLTSRYDGAIARYLTGAEGAAPAAAETMTVKLERELDMRYG
FT                   ENPHQSAGFYTLTDGEGTRSFGDYFEKLHGKELSYNNMLDIAAASGLVEEFRGEEPSVV
FT                   IIKHTNPCGVAQAPTLVEAWHNAFATDTQAPFGGIIAFNRPLDMVTAEAVNGIFTEILI
FT                   APSYEEGVLDLLMKKKDRRLLVQKQALPKGGWEFKSTPFGMLVQERDSKIVAREDLNVV
FT                   TKRQPTEEELGDLMFAWKICKHIKSNTILYVKNRRTFGVGAGQMSRVDSSKIARWKASE
FT                   VNLDLHGSVVASDAFFPFADGLLAAAEAGVTAVIQPGGSIRDNEVIEAADANNLAMVFT
FT                   GMRHFKH"
FT   gene            complement(509626..510141)
FT                   /locus_tag="Plut_0433"
FT   CDS_pept        complement(509626..510141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23321"
FT                   /db_xref="GOA:Q3B5R0"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23321.1"
FT                   /translation="MNNAVPDENSMETTDILWIISALLLISGFAGLLVPALPGVLLVFA
FT                   GLVLAAWAEGFAVVGWGTLSILAALTLAAYLFDMLAGLLGAKRFGAGKAGLIGAAAGTV
FT                   AGVGFGLPGIVLGPFIGAVIGELYAENGLREAGMSGLGVWIGIALGTAIRIATAFMMVG
FT                   IYLLARFM"
FT   gene            complement(510122..511066)
FT                   /locus_tag="Plut_0434"
FT   CDS_pept        complement(510122..511066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0434"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23322"
FT                   /db_xref="GOA:Q3B5Q9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23322.1"
FT                   /translation="MHEAPTTLARKIRQEALRLGFSSIGFAAPPPGFLAVERYDEMLRD
FT                   GRHGEMTYLETGAPARRHPESLLPGLKTVISLAVSYRHNPPGGRAKLSRYAMIADYHTV
FT                   VRKKAEALLDCIERLSDSKPNAYIAVDGAPVLEKEWAERSGMARTGKNTLAIVPSAGTF
FT                   VFLGELLLDIEIREERPLLPNLCGSCTKCIDACPSGALLGPGKIDARRCISYLTIELKR
FT                   EFTAEESAMIGRNLFGCDTCQEHCPHNQRPAINPDPAFSPRKELIGLEPERILQLTRSG
FT                   FNALFAGTPIWRIGLKRLKRNARAVLANEQRSS"
FT   gene            511161..513080
FT                   /locus_tag="Plut_0435"
FT   CDS_pept        511161..513080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0435"
FT                   /product="gamma-carotene desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23323"
FT                   /db_xref="GOA:Q3B5Q8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23323.1"
FT                   /translation="MDRRDFIRKIFSRTGIGLGVASAASAGLVGSFQPRKELYEDGRGS
FT                   AGGAEGPAVPRNCVVIGGGLAGISAAMELASKGMQVTLVESSTSLGGKLTGWEIDALGS
FT                   RFPVEHGFHGFFDQYYNLNAMFEQAGISKEVFDASPGYPVMFKERPREIYGQTPKVFPF
FT                   NILSVVSQSRSLDIASFLRQYRGLPPVVDMFRYDYSRTFAELDGIDFMEYCRRGEILPS
FT                   FIDTVLHPFADATMNRMEVLSAAEAIRYFHFYFMGSPEGLAFRITNRDCMTAIINPLES
FT                   KLRELGVRVLAGHRVLRLEHDGARISGVRIGGPASGGLVLHVDGASIPDEGWVSMLSRE
FT                   GVPVLVAREGSGYRALDGRCTHMGCPVSPDPSGDGFYCPCHAGRFNASGEPIGGPPPTP
FT                   LPPLSVTLEGGTLVLRSGETGGDEVLQCEYCVLAADVRGTKDIVKRSGLSSPAFEKSVA
FT                   SLGEADPYAVYRLWLDRPLEGEGYPFYTVSGYTYTDSVSIYSAFQEPFISWAGERGGSV
FT                   VELHAYAIAPEDMRSDDEIRQAMLRELHSLFPETLKASVLHEVFMVQSNFTRWAPGEHA
FT                   GRPGPETPFPNLFLAGDWVRVDAPVFLMEAAAFTGRMAANAVFRNEGVRSVPLPIVPMG
FT                   GIFS"
FT   sig_peptide     511161..511241
FT                   /locus_tag="Plut_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.535 at
FT                   residue 27"
FT   gene            complement(513258..514799)
FT                   /locus_tag="Plut_0436"
FT   CDS_pept        complement(513258..514799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0436"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23324"
FT                   /db_xref="GOA:Q3B5Q7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23324.1"
FT                   /translation="MRGNLTVRKVKTASGATAVQVVRNEGRKRVIIKHVGSAHNERECE
FT                   VLPARAESYGEAHQRQPGMFAGTPAPPSSSLFQNALAHTTLISLTRQFSRNTLFACARK
FT                   CGLGRLPELYLDLALMRIIEPTSKLRTLELLQRYFNVSYLKRTAYRTLSKILEHQEEIE
FT                   TAAIQTACNDLKENFCLVLYDVTTLYFESFKEHDFQKPGFSKDNKPRQPHIVIGLITTR
FT                   SGFPVMHEVFEGNTFEGNTMLDAVHRFQERVGETRPLIVADASMLSTARMQQLENKEYR
FT                   YIAGARLADTSIGFIEQIHNELPRMDTASRRFSYAYAEQKVSVICEFSEARYKKDKREF
FT                   DKQVERALKLLERNETGRRAKFLKKSKEKGKPFVFDTALQAKAEKLLGIKGYVTNIPEQ
FT                   EMPDAEVVANYRDLWHVEQAFRMNNLELKARPIFHHTKEAIRSHILVCFMAMMMGKYLE
FT                   IKTGRSLRQIRDELWRVQEANIRDELTGEVYVLRMDPNELANSELIKLLDPEFPH"
FT   gene            complement(514936..515583)
FT                   /locus_tag="Plut_0437"
FT   CDS_pept        complement(514936..515583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23325.1"
FT                   /translation="MKNTVLTILALSMILFTAGCGSTKIQETKLGKAPGWYDDIHKDND
FT                   YIFAANTQRSRDLQLALDKATAAGRAEIARKVAVQVKSIQKRFIDEVGNGMDSKTGDLF
FT                   SQVEKNIASECLAGSVVTKQNIVKEGEFFRAYVLVSYPVGKANAEFLESIKSREYSLTR
FT                   MRATKAFAELERDVERYEQLKKAQKEDDALSRSNPETSDESTAIEKNGVKEG"
FT   sig_peptide     complement(515512..515583)
FT                   /locus_tag="Plut_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.432 at
FT                   residue 24"
FT   gene            515855..516493
FT                   /locus_tag="Plut_0438"
FT   CDS_pept        515855..516493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23326"
FT                   /db_xref="GOA:Q3B5Q5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23326.1"
FT                   /translation="MMATVADAAEKTFIREYRYRASDKDSKVSSRNAALEQVNALLLKE
FT                   TGAYVQSTLNTEKKETDQGVDSLTTEDITAISAGVTKTQILEESWDGTEYYVKAEIQLD
FT                   PDDIQLKLDQARVSREMLQLSKESMAQKGAAEVKSGIFEDEMSVDARHSEMQQNMDAAL
FT                   AKKDEDRKQGPNLFLIIGGLALIGGIVALAAGGGGSDGGDSGGADSDND"
FT   gene            complement(516521..517666)
FT                   /locus_tag="Plut_0439"
FT   CDS_pept        complement(516521..517666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0439"
FT                   /product="D-alanyl-D-alanine carboxypeptidease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23327"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23327.1"
FT                   /translation="MTFGPAAFPLRAEEFDFTPVRRLMQEGVDENVFPGASIAVIYRGN
FT                   TIFHEAFGTIGCGLSPKPAYSSTVYDIASLTKAVATTAAIMQLVERDSLKLDQSAAGYF
FT                   PPFGRNGKNDITIRQLLNHTSGLRPHAWYIKTCSTPQELIAAICNDTLLTKPGTATAYS
FT                   DNGFIILGTIVEQITGRSLEENFRARFSTPLGMQSTSFNPSGEMLRRVAPTGRDSTWNT
FT                   KIGPRPLVNDQNAAILGGAAGHAGLFSSTGDLIRFTLMLMNDGRQDGVRYFRQSTIRQF
FT                   TRRNGNDERALGWDLRSLEGYASTGSCFSKDSWGHLGFTGTSLWIDPRKDLAVIMLSNR
FT                   VCPSSENRKIRKFRPRLHTTVAECLGYSCREEKPIGPPANP"
FT   gene            complement(517695..518573)
FT                   /locus_tag="Plut_0440"
FT   CDS_pept        complement(517695..518573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0440"
FT                   /product="VpsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23328"
FT                   /db_xref="GOA:Q3B5Q3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23328.1"
FT                   /translation="MRNPNALKWSDLKTGIFFIFGIGFAAYLGLVIGKNSSLFTGVTTV
FT                   KVLAGNMQGLTENNFVSVSGKKVGTVSKMEFTSQNDSLLVVADLRIRNEYANLVTKDSK
FT                   ATIRSLGVLGDKYVDIMTGKGEPVQDGDFIALDANDGMAGLTTGASKALENINTLLEQL
FT                   QSGKGVAGRLISDEKMGSELVATISSLRSTADELATVSRKASSGNGLLPKLINDPKLAD
FT                   NTTDAIAKIQHAAATTDSLMTAINSGEGTLGQLRRNPELYDNLTKALSSLDTLMVDLKK
FT                   RPERYVRFTLF"
FT   gene            complement(518594..519328)
FT                   /locus_tag="Plut_0441"
FT   CDS_pept        complement(518594..519328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0441"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23329"
FT                   /db_xref="GOA:Q3B5Q2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23329.1"
FT                   /translation="MIELRNISLKYGEKEILKNVSLTIEDNTIKAILGPSGVGKSTILK
FT                   LMLGLIKPTSGQVFVDGTDISAMKESELYPIRRKMGMVFQGNALFDSMSISQNLGFFLR
FT                   ENLNLPEKEVQERVTEQIQFAGLEGYEEQLPESLSGGMRKRVAIGRALIFRPHMILFDE
FT                   PTAGLDPVSSKKILTLISSLRHHNNLGAVIVTHIIDDVFNVADCVAVLYQGGIIFDDAT
FT                   SKLHGSDHPFIRSILSDKILEL"
FT   gene            complement(519333..520103)
FT                   /locus_tag="Plut_0442"
FT   CDS_pept        complement(519333..520103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0442"
FT                   /product="putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23330"
FT                   /db_xref="GOA:Q3B5Q1"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23330.1"
FT                   /translation="MGHHLTLRIKGFFLTMQDFFFFSVRAFATMPKIRRYWRDFLDQAA
FT                   ICGADSIPIVLVSAISIGSLLAIEVGNLLEDFGAKTMLGRSTSISVIRELGPLLMGLML
FT                   SARFGSRNGAELGAMQISEQIDALRAFGTDPVAKLVMPRLLAALIMFLPLTALSDFAGL
FT                   YSAAYMAEHYHHLDPGIFWNSVYPRLALKDFVVGFAKAPVFAVIITLVSSFNGFSASGG
FT                   TSGVGRSTIKGIVVSSGLVLIANFYVSKIVLENM"
FT   gene            complement(520228..521088)
FT                   /locus_tag="Plut_0443"
FT   CDS_pept        complement(520228..521088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0443"
FT                   /product="Phosphoesterase PHP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23331"
FT                   /db_xref="GOA:Q3B5Q0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5Q0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23331.1"
FT                   /translation="MPPSSSGAGHNGFEKADLHIHTKCSDGIHTPEEIVDKAASAGLSA
FT                   ISITDHDSVAGIDKAKPSASAKGIELIPGVEMSSTYKGYDIHVLGYFFDHRHPALTGYL
FT                   DHCRHLRTERAERMVGKLAKMGVKIGLDQIILKAQNGSVGRPHIAAVLQDGGYVKSFSE
FT                   AFSKYLGAHSPAYVKSIETHPAEVIRLINEAGGLSFLAHPAQSAPDEILKQLITVGLDG
FT                   IEIVHPSHDSYKQNYYREIANEYFMLFSGGSDYHGLKDRDDDTFGRVTIPGDWVEKMKS
FT                   RLVKA"
FT   gene            complement(521241..522089)
FT                   /locus_tag="Plut_0444"
FT   CDS_pept        complement(521241..522089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0444"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23332"
FT                   /db_xref="GOA:Q3B5P9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5P9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23332.1"
FT                   /translation="MTLIQAILLGIIQGLTEFLPISSTAHLRIIPALAGWEDPGAAFTA
FT                   IIQIGTLGAVMLYFRRDILSIVKSVATGLWKGNPLHDGEAKMGWMIAAGTLPIVAFGLL
FT                   FKHEIETTLRSLYWISGALIILALVLSLAEWKIKKRLEEGHPLKSMEDIGWKEALLIGL
FT                   AQAIALIPGSSRSGTTITGGLLLNLSRETAARFSFLLSLPAVFAAGAFELYKTWDLITA
FT                   DPGNIMNLAVATITSGIVGYLSIAFLLNYLKSHTTSIFIAYRLAAGAGLLLLLGGGTIL
FT                   P"
FT   gene            complement(522086..522757)
FT                   /locus_tag="Plut_0445"
FT   CDS_pept        complement(522086..522757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0445"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23333"
FT                   /db_xref="GOA:Q3B5P8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23333.1"
FT                   /translation="MQTPPDITTIVLATGNRDKVRELRPLLESISARFRVTTLMDEGIE
FT                   VDIEETEQTLEGNAILKARAIFEMLSAKFPSMIAFADDTGLEVDQLGGRPGVYSARFAP
FT                   RPEGEKPSYSDNVRHLLQEMEGKVERSARFRTVIALKGTIPGHDDGRVFEHIEEGVAEG
FT                   SITTAPEGKGGFGYDPVFRSEATKKTFARMTPEEKNTISHRALAVKRTISWLHTITNTQ
FT                   P"
FT   gene            complement(522759..523466)
FT                   /locus_tag="Plut_0446"
FT   CDS_pept        complement(522759..523466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0446"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23334"
FT                   /db_xref="GOA:Q3B5P7"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5P7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23334.1"
FT                   /translation="MRLAVNIDHIATLRNARNEGEPDPVAAALLAEESGAAGIVCHLRE
FT                   DRRHIRDNDLKGLRRSVKTKLDLEMAMTEEMQRIAIETVPELITLVPEKREELTTEGGF
FT                   DIERHFKRLALFIEPIRAAGIEVSLFIEPDSRSIDLAAEAGSDLVELHTGSYALKSGEE
FT                   QTAEFERIRHAAKYAVDRGLKVVAGHGLNYRNIQPFRQIPEIEEVSIGHALIARAAFVG
FT                   IPEAVREMLDLIG"
FT   gene            523612..525981
FT                   /locus_tag="Plut_0447"
FT   CDS_pept        523612..525981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0447"
FT                   /product="DNA mismatch repair protein MutS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23335"
FT                   /db_xref="GOA:Q3B5P6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23335.1"
FT                   /translation="MAEGTSRKLEFDRVVAHTAGYALSVYGRDTLSSSLPFSGHRELQE
FT                   ELERVLELKGFLEEGSTLPFDTLADMRPLLATLEMHGGVLEPGELQDLHLFLDAAAGLR
FT                   RRMVREAELRPRLAVFGAGIPEDAFVRPVIREVIDEQGVVKSSASGELARIRRALVDRR
FT                   RALGRTLERILGGCRSSGWLMEDTLTIRNGRQCLAMRLEYRHRVPGFVQDYSGSGQTVF
FT                   LEPAECMEITNAILEGEIEERREIERILRETTARIRPELPDLLSGASLMAAFDSLYARA
FT                   RFALETRSVLPALSEGTEFRIKRGYHPWLLISHRDREVLPLDLELGLNEQVLIISGPNA
FT                   GGKSVAMKTAGLLSFMLLHGYLLPCSESSVFPLFTSIGIEIGDEQSIENDLSTFSSHLR
FT                   EVRRILDAAGRGSLVLIDELCSGTDVEEGSAIARTIIEELLRRGTKAIVTTHLGDLKAY
FT                   AHSREGVVNGAMEFDRRALQPTFRFIKGVPGSSFAFAMMQRMGFPPAMVREAESAIGEG
FT                   HRGLEELLEDLQELLASNRLLHLELEAQSASILLREQAVTEAESMLRRRDREQRQKASK
FT                   ELQRELHRARLEIRDILAEANAAAGDPRAVQEARRKLASRAGDAEKKEALLLDAPAPTL
FT                   DRSIRPGDLVQLLDTSASGEIESLRGDMAVVLCGTFRLTTSLSNLEKTSKRQVRKAAGA
FT                   PAPRFVGWNATTSPVESTTLDLRGLTGDEAAVKIERFLDALRLNRIERATIIHGMGTGA
FT                   LRRRTEEVLRNHPHVHSWRLGGQGEGSSGVTIVTLA"
FT   gene            526106..526726
FT                   /locus_tag="Plut_0448"
FT   CDS_pept        526106..526726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0448"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23336"
FT                   /db_xref="GOA:Q3B5P5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23336.1"
FT                   /translation="MKAQQESFLTIPNQLTVLRILLVPVFVMLLLQDDAFLKLLGVIAF
FT                   TVASLTDLYDGWHARRFNVVTRIGAFLDPLADKLLITAAFLVYVWMGYISLWMVMLVVL
FT                   RDVVVTALRSWAEFRDHPVVTSRQAKYKTLFQNVFAYLVMVLIFLKEAALFGRGSSDAI
FT                   LRFLNSSVLDWIMLAVTVVTVATGVSYLIDNWQVITGKHEERS"
FT   gene            526710..527204
FT                   /locus_tag="Plut_0449"
FT   CDS_pept        526710..527204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0449"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23337"
FT                   /db_xref="GOA:Q3B5P4"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23337.1"
FT                   /translation="MKSAAEGAGFHFARALSTCFFVGYFPLAPGTIVSALAVLLYLLVP
FT                   VLQDPVVLAGGVLLSAVFGVWSGGVMEESAGLDPSEVTIDELSGQWLALLFLPAGPVPA
FT                   LLAFLFFRIYDILKPGPVDMAQRLRGGWGIMADDLLAGLLANVSVRLVLLIVPAQWTGV
FT                   L"
FT   gene            complement(527183..529081)
FT                   /locus_tag="Plut_0450"
FT   CDS_pept        complement(527183..529081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0450"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23338"
FT                   /db_xref="GOA:Q3B5P3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5P3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23338.1"
FT                   /translation="MNDTRPLLDRILSPRDLKKLSTKQLQQLADECRKELIELIAMNGG
FT                   HFASSLGVTELTVALHHVYNTEEDRIVWDVGHQAYIHKMLTGRRSRMQTNRKYGGIAGF
FT                   PKIHESPHDAFGTGHASTSISAAAGMAAGRDLKGGREKMVAVIGDGSMTGGMAFEAMNH
FT                   LGDLKSDVLVILNDNQMAISPSTGGLKNHLVDITLNKTYNKARRLLWNSMSLLNHEGAK
FT                   NALRRLEDGMKAALTPGAFFEALGLRYFGPIDGHDMGRLVRALKEMHELPNPKLLHVVT
FT                   TKGKGFLPAEENQSGWHAHSGGFDTTTGMTAKKTGAPDPPKYQEIFGEALVEMALKDPA
FT                   ITAITAAMPSGTSLDLFEKAAPDRFYDVGIAEGHAVTFAAGLALEGLKPVCAIYSTFLQ
FT                   RALDQLIHDVALQNLHVVFAIDRAGLVGEDGPTHHGAFDLSFLHAVPGLTIMAPSDAQE
FT                   LRDMLHTALYHIEGPVAIRYPRGSSGGGPLRKDFTRLEPGRGRIIREGTGPVLFAIGSM
FT                   VQAAVEAAALLEAEGIKPDIVDMRFLKPLDTALIDRLAASATHIVTIEENSILGGLGSA
FT                   VSDHLASSPKKTPLLKIGLPDRFITHGSMQDLYRETGLDAAGIAEHVKEFYRTPVH"
FT   gene            complement(529095..529541)
FT                   /locus_tag="Plut_0451"
FT   CDS_pept        complement(529095..529541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0451"
FT                   /product="Protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23339"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23339.1"
FT                   /translation="MPATHPMMRIHRTTLELCTRKPIEIIDITRAAEDAVAGSGLKDGL
FT                   LTLVSRHTTACLNINEQEERLMEDIETFLKRLAPKDGNYLHNLQPIDGRDNAHSHLLGL
FT                   FMNTTETIPFSEGRLMLGRWQSIFFIELDGPRPERSVLMQATGI"
FT   gene            complement(529563..531005)
FT                   /locus_tag="Plut_0452"
FT   CDS_pept        complement(529563..531005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0452"
FT                   /product="Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23340"
FT                   /db_xref="GOA:Q3B5P1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23340.1"
FT                   /translation="MFPLVYEINTRIWLQKLGRLNNRPVTLGNVPDSEFRFFSESGFDM
FT                   VWLMGVWKPSEYSRAIATSHPDLRASLLEHLPSLQPADIASSPYSIPSYTVNEALGGHD
FT                   ELLLFREKLAHYGIRLMLDFVPNHLALDNQWLPAHPEFFISVSQAERSHDPGSSFEYAQ
FT                   GKYLAYSRDPYFPSWTDTLQINYANPATHAMMTGNLLKISELCDAVRCDVAMLVLKSVF
FT                   NTTWKNLSGHMKDEFWGPAIAAVKARHPKFTFLAESYWNKEWELQQQGFDFTYDKPFYD
FT                   YLASAPVNVEKLKGHMQAQWSYQQHLCRFIENHDEPRAADKMGLNNRAAALCCLMAPGM
FT                   HLVHQDQMDGYRHKIPVQLIHQAPEHADRDLGDLYRKLFILQRDPAFQEGQIEWLDLQG
FT                   SNHTHCIGFHRFTPERHAFVLANFGSTGIAFDVTHPVLEQVERSQIGVLSTAHGNRTAA
FT                   PHLSGQVIQVRLAPHEAVAITF"
FT   gene            531235..533442
FT                   /locus_tag="Plut_0453"
FT   CDS_pept        531235..533442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0453"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23341"
FT                   /db_xref="GOA:Q3B5P0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23341.1"
FT                   /translation="MTDFLRDLSPVQQSAVSTTEGPVMVLAGAGSGKTRVITYRIAHLI
FT                   GTKGVPSKNILALTFTNKAAGEMRHRVDTLLGPGASSGLWIGTFHSVFARLLRDYIERL
FT                   GYSRSFSIFDSDDSKSLIRQSMTELGIQQDAVPVNTVQGLISKAKNSFILPSEFHRNAS
FT                   DYNQQKAALVYELYTRKLRENNALDFDDLLIKPLELFREHPDVLHELQELFRYILIDEY
FT                   QDTNRAQYLVTKQLAERYRNIFVVGDDAQSIYSWRGADISNILNFQDDYRESETFKLVD
FT                   NYRSTATILTAANSVISRNSRQIKKELVPQGAKGDPLTLIEAYNERNEAEKVGERILSM
FT                   HREKGLEFRSFAVFYRTNAQSRVLEDAMRQSRIPYKIFGSVSFYKRREIKDAVAYLRFI
FT                   QNDRDSESLLRIINFPPRKIGDVSITKLRQFAEERGLTLYEAIRSAGEGGFPQRLLTAL
FT                   GSFSAVIEKLRETAVDGTVYDVLHELFELTAIPSLLQAENTPESLARHENLQELLSMAR
FT                   DFSDHNPDRGSLGDFLENIALASDYDETQESDNFVSLMTVHASKGLEFPVVFITGLEER
FT                   LFPLNCFEPEQLEEERRLFYVAVTRAREKIFLSWAQSRYLYGQPQHCLRSKFIGEIDQS
FT                   VLLGEGGRAVSRGGAPAAVAAPASASFRRPAASGSPAPETAARPATGGMKKGAKVHHAV
FT                   FGPGIVVELQGKGSQQKARISFRSAGEKTLMVQYANLKIVP"
FT   gene            533558..534589
FT                   /locus_tag="Plut_0454"
FT   CDS_pept        533558..534589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23342.1"
FT                   /translation="MRILFGVQGTGNGHISRSRELVRKLKEDGHEVEVIVSGRKEDELR
FT                   EIEVFEPYRVMKGMTLITYRGKLNYMETMFQLDFSRLMADVLTLDTAGLDLIITDFEPI
FT                   TSMAARIRNVPSLGFGHQYAFRYAIPETRGNIFEKYTLLNFAPARYNAGLHWHHFNQPI
FT                   FPPVIPAALYGNAAPEPVKGKILVYLPFEEIDDVTAFVSGFEDYEFHIYGKVSEDSDRG
FT                   HLHFRAYSREGFLRDLTECSGVVCNAGFELPGEALHLGRKLLLRPLDGQIEQGSNAMAM
FT                   EQLGYGMAMHALDRKILGEWLENPGRKPLRYARTVDYISEWISSGRWDDLSHFAGAAWR
FT                   DRG"
FT   gene            534601..535194
FT                   /locus_tag="Plut_0455"
FT   CDS_pept        534601..535194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0455"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23343"
FT                   /db_xref="GOA:Q3B5N8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23343.1"
FT                   /translation="MMQFRDLVVRSRSIRRFDESVAVQDGVLRDLVELACYVPSPKNLQ
FT                   PLKFIARSGPDCSRALFPLLSWAGYLADWPGPEAGERPTAYIVMLGDTSITSDFSIDSG
FT                   IAAEVIMLGAASIGLGGCIIASIDRPALQSLLHIPDRYQILQVLALGKPVETVVIDQIG
FT                   DGDPVRYYRDPNGIHHVPKRTPGDILLDFSDDPG"
FT   gene            535181..535765
FT                   /locus_tag="Plut_0456"
FT   CDS_pept        535181..535765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0456"
FT                   /product="Leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /EC_number="2.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23344"
FT                   /db_xref="GOA:Q3B5N7"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5N7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23344.1"
FT                   /translation="MIPVDALLKAYREGFFPMADASDGQLYWCRPEMRALFPLESYRPS
FT                   RDVLRLQRRGEYSVFFDSDFEAVIRACAAPRKDDPETWISGEIVETYIRIHELGLAHSV
FT                   ECRYRGELAGGLYGIAIGGAFFGESMFYRRSYASQVALWHLVCHLRLKGYLMLDAQIMN
FT                   PHLRRLGAVEVPHDEYMRLLEAALRKKTAFL"
FT   gene            535827..537128
FT                   /locus_tag="Plut_0457"
FT   CDS_pept        535827..537128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0457"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23345"
FT                   /db_xref="GOA:Q3B5N6"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23345.1"
FT                   /translation="MLSRDLTENQPKTRVIIYSGKGGTGKTTISSCTAVALARSGKRVL
FT                   IMSSDPAHSLSDVFNLRISRNDPQKIEENLYGLEVDTVYELKKNMSGFQKFVSTSYQNK
FT                   GIDSGMASELTTQPGLDEIFALSRLLDEAHSGRWDAVVLDTSPTGNTLRLLAYPEIIIG
FT                   GNMGKQFFKLYKSMSSLARPLSGASIPDDDFFNEVNVLLKQMEDINQFILSPEVTFRLV
FT                   LNPEKLSILETKRAYTFVHLYGINIDGIVINKILPTSRTVGEYFEFWADLHSKYLMEID
FT                   NSFYPTPVFRCHLQRTEPIGPDALYGISEMVFGEQAPDKIFYSGKNFWIETKRSELTED
FT                   HREILCIKIPFLKDAEEVTVERMGTDIVVAVDRAQRIITLPRALYSLEMEKFVREDSLL
FT                   RVIFREIPVNKEDAELNVNRNVLDKLRSLRRMKI"
FT   gene            537265..538146
FT                   /locus_tag="Plut_0458"
FT   CDS_pept        537265..538146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0458"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23346"
FT                   /db_xref="GOA:Q3B5N5"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23346.1"
FT                   /translation="MSENAHYGLLKGKKGIVFGPLDESSIGWQIAVHAHREGASIAISN
FT                   VAAAMRFGNTDELSALCGNAPVIVCDASKNEDVDSCFGELKEKLGKIDFIVHSIGMSQN
FT                   IRKQLPYEELNYEWFMRTLDVSGLSLHRLVSYALKNDVLNDGASVLALSYIASQRNYWT
FT                   YSDMGDAKSLLESIVRSYGPRLARRGIRINTISQSPTYTKAGSGIPGFEKMFEYSDLMS
FT                   PLGNASAVECAEYAMTILSDLSRKVTMQNLFHDGGYSSMGATIPMIKLAHEVLNDKELA
FT                   ERVGLEDFKPAK"
FT   gene            538383..540608
FT                   /locus_tag="Plut_0459"
FT   CDS_pept        538383..540608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0459"
FT                   /product="Isocitrate dehydrogenase NADP-dependent,
FT                   monomeric type"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23347"
FT                   /db_xref="GOA:Q3B5N4"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23347.1"
FT                   /translation="MAKTATIIYTKIDEAPALATYSLLPVIQAFAKGTGVEVETRDISL
FT                   AGRIIANFPDSLTEGQRIPDYLAELGELAMKPEANIIKLPNISASIPQLKAAIKELQSQ
FT                   GYSLPEYPEAPSTDAEKTIQQRYAKVLGSAVNPVLREGNSDRRAPLSVKEYAKKNPHKM
FT                   SAWSADSKASIAYMSSGDFYGSEKSVTMPSADNVRIEFFGADGSTSVLKESTPVLAGEV
FT                   IDSAVMNVNALRSFYAREIDESKKNGSLLSLHLKATMMKISDPVMFGHAVTVFYKDVFE
FT                   KHADVIRELGVNVNNGLGDLYLKIQSLPEAKKAEIEADIQAVYATRPALAMVDSDKGIT
FT                   NLHVPNDIIVDASMPVVIRDGGKMWGPDGQLHDTTAMIPDRCYATMYQAMIEDCKKNGA
FT                   FNPSTIGSVPNVGLMAQQAEEYGSHNKTFFAPADGTVRVLDAAGNVVMEQPVETGDIFR
FT                   MCQAKDAPIRDWVKLAVSRARATGAPAIFWLDSNRAHDAQLIEKVTRYLKEHDTAGLDI
FT                   RIMNPVEAMRFSLERFRAGQDTISVTGNVLRDYLTDLFPIIELGTSAKMLSVVPLMQGG
FT                   GLFETGAGGSAPKHVQQFQKEGYLRWDSLGEFSALAASLEHLAGAFNNQKAQVLADTLD
FT                   AAIGKFLDNRKSPARKVGQIDNRGSHFYLALYWAEALVAQSADADMQARFKQVAADLAF
FT                   NEAKINEELIAAQGSPVDMGGYYHPDEEATTKAMRPSATLNAIIDAM"
FT   gene            540776..541591
FT                   /locus_tag="Plut_0460"
FT   CDS_pept        540776..541591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23348"
FT                   /db_xref="GOA:Q3B5N3"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23348.1"
FT                   /translation="MAAKNLKVMFIGDVIGTPGLKMVGLMLKGFIKTHQIDFVICNGEN
FT                   AHNGKGLSLDALNQLLEAGVDVVTGGNHTWSNFNFFDTLKTHPKVLRPLNYPKGTYGRG
FT                   FGIYPLPGGLGNIAVVNLQGRTFMYPIDCPFRTADWVLKQVKDQARFVFVDFHAEATAE
FT                   KIALGWYLDGRVSALIGTHTHVQTADERILPKGTGYCSDAGMTGPFQSVIGMQTKSATD
FT                   RMLYQTPHKYECAEDDVHFSAVIVALDAQTGMTVGIQRFFYPEFEKGSL"
FT   gene            complement(541683..542684)
FT                   /locus_tag="Plut_0461"
FT   CDS_pept        complement(541683..542684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0461"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23349"
FT                   /db_xref="GOA:Q3B5N2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23349.1"
FT                   /translation="MSQLITIERHILEQQKNFPEATGELTDLLSDVAFAAKLVRREVVR
FT                   AGLVDILGFAGSTNVQGEEVKKLDLFANDKIINAIGQHGRFAIMGSEENEGIIIPPKNE
FT                   TGSYALLFDPLDGSSNIDVNVSVGTIFSIYRIKSSDPGNASISDCLQKGSEQVAAGYVI
FT                   YGSSVVMVYTTGHGVHGFTYDPTIGEFLLSHENITTPGSGKYYSINEGSYAQFNDGTKR
FT                   YLDYIKEEDPATGRPYSTRYIGSLVADFHRNLLTGGVFVYPPTTKHPSGKLRLMYEANP
FT                   LAFICEQAGGRATDGHRRILDIDPSELHQRTPLYIGSMADVKVAEEFEQGIR"
FT   gene            542864..544579
FT                   /locus_tag="Plut_0462"
FT   CDS_pept        542864..544579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0462"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23350"
FT                   /db_xref="GOA:Q3B5N1"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23350.1"
FT                   /translation="MKRFRWTILSADDAAVAAMMESINVSAPLARALLNRGIDTFDAAR
FT                   NFFRASFESLHSPLLLGDMEIAVKRVLKAVREGEKIMLYGDYDVDGTTGTAMLHRFLGG
FT                   LGAEVSWYINDRFQEGYGISPEGIDAAASRGVGLVITVDCGIRANEAVSRARGLGMDVI
FT                   VCDHHEPDILPEAVAILNPKVPGCRYPFRELCGCGVAFKFIQAIADETGDGEKAWREYL
FT                   DYVAIATAADMVELTDENRVLVREGLVRIQSAPAMSLQEMFRVMKVAPKEVGMFNIAFG
FT                   IAPRINAAGRMGSAQRAMEWLLSESAADARLHADGLEELNTLRRQTDADIMEKAEKMLD
FT                   GHFASYCSSIVLYDESWHIGVLGIVASKMLERHYLPTVIMGGMNGLVKGSVRSVEGLDV
FT                   YGVLEECGDLLLQFGGHRQAAGVTLLPENLSAFRKRFDAASASRLGIRERQKELVIDSE
FT                   LRLEDAGEKFIRVLEQFSPHGFGNREPVFMTKGLRVHGRPRLLKERHVKFSVRDGSGRF
FT                   FDVIGFDRRDVYDALQGDSGAVFSMAYSLENRVWNGRAQLQCRLYDLDVSTSIA"
FT   gene            complement(544591..545457)
FT                   /locus_tag="Plut_0463"
FT   CDS_pept        complement(544591..545457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23351"
FT                   /db_xref="GOA:Q3B5N0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5N0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23351.1"
FT                   /translation="MLKAAVQVLVTLAALYLVLQKTDVRQIGTVIGSSNLWYILCAILF
FT                   FNLSKLFNAVRLNRFFKAVGLNLSWAYNLKLYYLGMFYNLFLPGGVGGDGYKIFVLQKN
FT                   HRVKTINVFHAVFWDRLTGIIALIFLGLILLLPSSFASTMPEAVPYAWAGLLAVYPLAY
FT                   VLNRFVYRQFLDLFAITALESVMVQAAQAATAFFILQALAPGTHSIDYLAIFMISTVAT
FT                   ILPITVGGAGAREVTFYYMLSHINLDASLGIALSLVFFGISAISSLPGILLRIRHEASI
FT                   PEATEAA"
FT   gene            complement(545474..546406)
FT                   /locus_tag="Plut_0464"
FT   CDS_pept        complement(545474..546406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0464"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23352"
FT                   /db_xref="GOA:Q3B5M9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23352.1"
FT                   /translation="MKLSVVIPVMNEEESIKPLFDALHSALSRVEHEIVLVDDGSSDGT
FT                   VATIEALRTPNVKLVVLNKNYGQTTAMAAGIAEAEGELIATMDGDLQNDPGDIPMMMQY
FT                   LHDHDLDVVAGRRAGRKDGMMLRKIPSAIANAIIRNMTDVHIRDYGCTLKVFKQDVAKN
FT                   LGLYGELHRFIPVLVQLYGAKMEEVDVRHHARKFGTSKYGIGRTFKVLSDLLFMVFFQK
FT                   YSQRPMHLFGTLGFLSLFIGLAMNLYLLTVKILGEDIGSRPLLSLGIILTFIGIQLITT
FT                   GFIAEFIMRTYYESQNKKPYIIRKIVGKH"
FT   gene            complement(546421..547968)
FT                   /locus_tag="Plut_0465"
FT   CDS_pept        complement(546421..547968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23353"
FT                   /db_xref="GOA:Q3B5M8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23353.1"
FT                   /translation="MLPKSSSRESAIFAGLLAFILALTCFAVLGQAPLFDVDEGAFSEA
FT                   TREMLQSGNYVTTYLNGVPRFDKPVLIYWLQLLSIRTFGITEFAFRLPSALAAAGWAFA
FT                   LFLHEARRNGARRAFLAAAMLVLSLQVTIIAKAAIADALLNLCLAGTMLAILSHYRTQS
FT                   KASLLLAYAAMGFGMLTKGPVAVLIPLAATFFFQLSQRSLGAWFRMVLNPAGILLFLAI
FT                   TLPWYVMEYRAEGMAFIEGFFFKHNVDRFSTSLEGHSGSLFYYVPVVLIGLMPFTGLLY
FT                   TVVRNFRTLAGDPENRLLGIWTLFVFVFFSLSGTKLPHYMIYGYTPLFLLMARALHMAK
FT                   RPALTLLWPLLLLGALAVLPQALPAAEELAGDAYVRDVLHAARELLGQRHIQLTLLAAA
FT                   TMSALALIRPVPVEFRLIASGVVFALYINMHVMPTAGRLMQEPVKEAALLAKQKGWEIV
FT                   MWEVDYPSFLVYSESFAQKRAPVRGEVVLTTSKQLERLKNPVVLFRKNGIVLLRTTQ"
FT   sig_peptide     complement(547876..547968)
FT                   /locus_tag="Plut_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.787 at
FT                   residue 31"
FT   gene            complement(547943..548566)
FT                   /locus_tag="Plut_0466"
FT   CDS_pept        complement(547943..548566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0466"
FT                   /product="Phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23354"
FT                   /db_xref="GOA:Q3B5M7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23354.1"
FT                   /translation="MSTQSRYAISTAIVLIASALSFTFLDRQTALFYRALDTPPWHEVF
FT                   DTITRFGQSEWYLVPGLILYVLFRKSRPTLSWTALFVFAVTAVSGIAANIVKFILGRAR
FT                   PGLFFQEGVYGLDWFNAAHAWTSFPSGHSATAFSVAAALVLIYPGAAPLFYGAAAIIAF
FT                   SRIFLGQHYLSDVIAGSFLGIATSLILYNRYFKQRIHAPQELKP"
FT   sig_peptide     complement(548501..548566)
FT                   /locus_tag="Plut_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.886) with cleavage site probability 0.532 at
FT                   residue 22"
FT   gene            548697..549578
FT                   /locus_tag="Plut_0467"
FT   CDS_pept        548697..549578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0467"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23355"
FT                   /db_xref="GOA:Q3B5M6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23355.1"
FT                   /translation="MLSIPMHQEPNPTAILLLSCRDRRGLVSRISHFIYERGGNIIDLD
FT                   EHVDAGEGMFFIRVSWSTDRLTIPVSALEDAFRPLGTEFEASWNIRFTGRPTRFAIFVS
FT                   RYDHCLQELLWRYSMGEFSAEIPLVISNHPDLEPLAAHYGIPFHQFRVTADTRADVEAE
FT                   QQALLDANDIDAIVLARYMQVLSPSFARRWHGRAINIHHSFLPAFVGGNPYRQAYERGV
FT                   KIIGATCHYVTEELDQGPIIEQDIMRVTHRDTLQGLIRRGRDLERMVLARAVRLHAEHR
FT                   ILLNGRKTIVFD"
FT   gene            549591..550499
FT                   /locus_tag="Plut_0468"
FT   CDS_pept        549591..550499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0468"
FT                   /product="Cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23356"
FT                   /db_xref="GOA:Q3B5M5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23356.1"
FT                   /translation="MSAGHSHPHHHHQAAGDIGTAFFLNLAFTLVEFVGGWLTGSTAIL
FT                   ADAVHDLGDSFAFGQAWYFEKLSLSGSSERYSYGYRRFSLVGALISALILFGGSIFVLL
FT                   QAIPKIFAPGTPDAGGMALLAVAGVSVNFLAMLRLRKTGGMNARVVTLHLLEDVLGWVA
FT                   VLVVAVVLLFWDIPVLDPILAIAITLFILYGALKNLRSMVPVFLQAVPDGISLQAVVRE
FT                   AEALDGVRGVHNAHIWSLDGTHRVFTAHLQVDPELDACAYIELKKRIAGLVQSHGIEHS
FT                   TVEIEYPGEVCRITDNEEETP"
FT   gene            550496..551047
FT                   /locus_tag="Plut_0469"
FT   CDS_pept        550496..551047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0469"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23357"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23357.1"
FT                   /translation="MKITAILKRALCLLLFLPAGCTGVPDGLQVVEDFSLESYLGTWYE
FT                   IARIDNSFEKNFEEVSATYRLDDDGSVRVENRGFDTERQQWKSVNGRAKFAGPVERGAL
FT                   KVSFFGPFYASYNVLALDHEGYRWALVSGHDRDLLWILARHPVMEPELLEELKAKAAAM
FT                   GFDASRIRKVSQTGVPAGTK"
FT   sig_peptide     550496..550567
FT                   /locus_tag="Plut_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.760 at
FT                   residue 24"
FT   gene            551099..551386
FT                   /locus_tag="Plut_0470"
FT   CDS_pept        551099..551386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23358.1"
FT                   /translation="MQEHDEREARYRAMVDGIVGEWAVGKPPNPRAGSPTAKPSGFYRL
FT                   TGWLLEYLLRHDAFPVGVHPMPEGMDSQGRIEPSFPVDFDQLLGNRPFPL"
FT   gene            complement(551388..552413)
FT                   /locus_tag="Plut_0471"
FT   CDS_pept        complement(551388..552413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23359"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23359.1"
FT                   /translation="MNDRQQQSDTGAKKRIFVVGATGYIGKFVTRELVARGHEVVSFAR
FT                   PRSGVDAATTAEETRRQLAGSEVRFGDVGDLQSILREGIRGEHFDAVYSCLTSRTGGIE
FT                   DAWNIDYRATKNALEAGIKAGITHFVLLSAICVQKPMLEFQHAKLKFEAELMASGVSYS
FT                   IVRPTAFFKSIAGQVESVKNGKPYVMFADGELTRCKPISEADLARFMADCIENPSLQNR
FT                   ILPIGGPGKAISAREQGAMLFELLGKEPKFKKVPIQIFDVIIPVLTMLSKFIPKLRDKA
FT                   EFARIGKYYCSESMLLFNHETGRYDEEATPSYGTDTLRDFYARVLKEGLKGQELGAHSM
FT                   F"
FT   gene            complement(552594..554330)
FT                   /locus_tag="Plut_0472"
FT   CDS_pept        complement(552594..554330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0472"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23360"
FT                   /db_xref="GOA:Q3B5M1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23360.1"
FT                   /translation="MNELLRLTRIVRPWAGWMLLAALLSFAATGSGIGLLMTAAYLIAK
FT                   AALQPPLAALQIGIVGVRFFGLARGVLRYLERLASHDTTFRILTSLRLWFYDALEPLAP
FT                   ARLMQFRSADLLQRIVDDIQSLENLYTRVLAPPVTALLTALLLWFLLGFWSPLAALILL
FT                   FFHLIAGIGVPLLTARLSRGTASGILCRKAEEQMLAVDFAQGLAELQMYGGVERHRNRL
FT                   ELAESGKLALERKSSLIDGMQETLIGILMNAAVLGVLSAVLPLVSGGTLSGIALSIATL
FT                   AVMASFEPFLPLPGSLRHLEADIHAGRRIFEILDATPEVTEPSAPLPLEGELPIEAREL
FT                   SFTYPGNLRPALDRVSFMIPQGARVAIVGPSGSGKSTLTALLVRFWNPGSGILTVGRHP
FT                   IAAYSPEALRRRIALVSQRTYVFAETIRENLLLARPGATDHELREALRAAGLDHFRTRL
FT                   DEFAGQHGMQLSGGERQRLAIARAILQDAPVVILDEATASLDAPTEQEVLRRIEEASEG
FT                   KTIITITHRLQQMERFGNILVLKDGRLAETGTHTELLEKQSVYHTMWNIQHQSIFVQPG
FT                   TD"
FT   sig_peptide     complement(554247..554330)
FT                   /locus_tag="Plut_0472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.408 at
FT                   residue 28"
FT   gene            complement(554327..556093)
FT                   /locus_tag="Plut_0473"
FT   CDS_pept        complement(554327..556093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0473"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23361"
FT                   /db_xref="GOA:Q3B5M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23361.1"
FT                   /translation="MNIDRRMFSLIGGHRAPFILSIAASGAAAVMVIGQAAALSRLVND
FT                   AFIEKAAPAELVPSIGFFALFSILRMLLGWLGHNEANRGTIAVRRDLFAHLTEAIALRG
FT                   PIYARSLPSGRLSTTLIKGVEALDAYFSQFLPQLFLALLAPLIILIAVFPVDPVSGFIL
FT                   LGTAPLIPLFMALIGKRAGAMTDRQWETLSRMSGYFLDMLQGLPTLKLFARSRSQHDAI
FT                   ADAGERFRTATMKVLRVAFLSSLTLELVGTIGTAMIAVAIGLRLLTAGLAFQTALFVLL
FT                   LTPDFYLPLRQLGLKFHAGMEGASASKDIFAVLDGPVDDPEPAGHPKMPLAHTIKPDVA
FT                   GISRWDIRFEGVTYSYPDSREPALSSLTCTIPAGKTTAVTGPSGAGKSTLMNLLLRFQD
FT                   PCSGTITAGGRPIGEYRVEAWRELIAWVPQHPFLFNDTLRENIMMANRGATEETLRYAV
FT                   RLAGLEELVNRLPAGLDTPVGEQGVRFSGGEAQRIALARAFMKDAPILVLDEPTSHTDP
FT                   ELEAVLQRAIRTLMQGRTTLIIAHRLETIRSADAILVLEGGRGSATGTHRELMEGSAFY
FT                   RSAFQNPEEAGT"
FT   sig_peptide     complement(555983..556093)
FT                   /locus_tag="Plut_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.607 at
FT                   residue 37"
FT   gene            complement(556131..557144)
FT                   /locus_tag="Plut_0474"
FT   CDS_pept        complement(556131..557144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0474"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23362"
FT                   /db_xref="GOA:Q3B5L9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23362.1"
FT                   /translation="MELQTLWFILVAVLFTGFFFLEGFDFGVGILLPFIGREDQERRAL
FT                   INTIGPFWDGNEVWLVTAGGAMFAAFPHWYATLFSGFYPALLLMLAAIIFRGVAFEFRS
FT                   KHKHPAWRNFWDWSIFVGSAVPALLWGVALANIIRGVPIDASMNYAGGFLNLLNPYALA
FT                   CGIASLLIFTLHGAVFLTLKTNGEIRERSMRAAKSVWLPAVALSFVFMFYTYVETDLYL
FT                   HLGINPGIIPVFSVLALLSVKVLLDKNASGWAFAMTGIAIAFSSATIFMGLYPRVLVSS
FT                   LNPDWSLTIQNASSSPYTLGIMSMVALIFVPLVLLYQGWSYWVFRQRVTTDSHHEY"
FT   gene            complement(557165..558520)
FT                   /locus_tag="Plut_0475"
FT   CDS_pept        complement(557165..558520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0475"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23363"
FT                   /db_xref="GOA:Q3B5L8"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23363.1"
FT                   /translation="MDILFLARLQFALTSVFHFFFVPLTLGLSIFTAILETAWVRTGNE
FT                   KYLKLVQFWGRLFLINFAVGVVTGIVMEFQFGMNWSEYSRFVGDIFGVPLAIEALLAFF
FT                   MESTFLGIWIFGRDRLPKAVHAASIWLVALGSNLSALWILVANSFMQAPVGFRMAADGS
FT                   RAEMTDFAALLFNPNVWKQFPHVLAGGIVTGGFLVIAISVWHLMKGTKDREAFITSMKF
FT                   GTIYAFIGTIFVTMAGHTQMQHIMKTQPMKVAAAEALWETENPASFSLFTIGNEEKLED
FT                   VFSIRIPRLLSFLAYNSFEGEVKGIRDLQAEYETKYGTGNYIPSIITAYWSFRLMVGAG
FT                   TLMLFVSLLGLWKVSRDDYRFSPFIGALFFWSMLLPWIANSTGWILAEMGRQPWIVFGL
FT                   LKTEQAVTPASVVSSGELILSITLFTLLYLMLAAADLFLIRKYAALGLEAAE"
FT   gene            complement(558726..559787)
FT                   /locus_tag="Plut_0476"
FT   CDS_pept        complement(558726..559787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0476"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23364"
FT                   /db_xref="GOA:Q3B5L7"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23364.1"
FT                   /translation="MIDAISFKNGTFRYLDQRYLPLQELHVETRDHREAIEAIKTLAVR
FT                   GAPLIGASAGYTVVLGVNSFKGSKEEFPAYFGQLIKDVEASRPTAVNLFFATKKMKAVY
FT                   DANFEGDSLETLKTKMTDEAHKIYNDEVDNCDRIARHGVEQIKRDCADILKTRKLNVLT
FT                   HCNTGTLACCGIGTALGVIRLAWQEGLIERVITAESRPLLQGLRLTAWELEHDGIPFIS
FT                   ISDSSSAFLMQRGMIDFGVVGADRITANGDTANKIGTYAHAVSANHHGIPFYIAAPVST
FT                   IDITLKEGAQIPIEERNADELRTIFGTQVATPTTPVLNYAFDVTPGTLLRGIITEKKAV
FT                   VGNYETGLREICS"
FT   gene            complement(559803..560711)
FT                   /locus_tag="Plut_0477"
FT   CDS_pept        complement(559803..560711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0477"
FT                   /product="Purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23365"
FT                   /db_xref="GOA:Q3B5L6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23365.1"
FT                   /translation="MGGFFSDGGSGYIEGLHRELHRQTKNTPTMIAQKAKIEEAVSFIR
FT                   KKTQDEYPVGIVLGTGLGALAKEIDVEFALDYADIPNFPISTVETHHGKLIFGTLAGRK
FT                   VVAMQGRFHFYEGYSMQQIVFPIRVMKHLGVKTLGITNACGGLNPGFQKGDIMLIDDHI
FT                   NMLPGNPLIGHNDPETGSRFPDMCEPYSKRLLKIAEEVALEHKIKVQRGVYIALSGPCL
FT                   ETRAEYRMLRTLGADVVGMSTVPEVIAAVHQGTEVFGMSIITDECFPDNLHPVSIEEII
FT                   EVSNHAEPKMTTIFKNVVAKL"
FT   gene            complement(560751..561440)
FT                   /locus_tag="Plut_0478"
FT   CDS_pept        complement(560751..561440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0478"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23366"
FT                   /db_xref="GOA:Q3B5L5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23366.1"
FT                   /translation="MEGIASNLLEIRRRVHDAARAAGRDPSAVRLIAVSKTKPAGMIRE
FT                   AFDAGQTLFGESYLQEFLEKCDDAELEGCPLEWHFIGHLQSNKVRSVIGRVSLIHGIDK
FT                   VSTAEELSKQAVKRGINADYLLEINTSGEATKYGMQPLEAKAAAETLFGLPGITLRGLM
FT                   TIASPDPSQAETEFRDLRLLLDAIKTQAPHPEELTELSMGMSGDFEAAIRQGATLVRVG
FT                   TAIFGWR"
FT   gene            complement(561450..561941)
FT                   /locus_tag="Plut_0479"
FT   CDS_pept        complement(561450..561941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0479"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23367"
FT                   /db_xref="GOA:Q3B5L4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23367.1"
FT                   /translation="MAASYIIKTSLGDIQISLYDDTPQHRDNFMKLVGEQYYDGIRFHR
FT                   VIEGFMIQTGDPLSRHDDKRMLHGTGGPSYKVPAEISHPNKKGTLAAARDNNPQKASSG
FT                   SQFYINQADNDFLDGQYTVFGVVESGIEVVDSIAAVNTDPNDNPLKPVTIETIVEAPKA
FT                   "
FT   gene            complement(561975..562667)
FT                   /locus_tag="Plut_0480"
FT   CDS_pept        complement(561975..562667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0480"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23368"
FT                   /db_xref="GOA:Q3B5L3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23368.1"
FT                   /translation="MNDNDIQPIRTEEKKTAVDNLLYFAIRYKNLIAGALILILIGGAA
FT                   IFFWTERQASRENEAAPMMAAAAMAFDRGDFQRAIDGTEKEPGLKTIAEQYNGTPSGEM
FT                   AELLLANAYYAIGKPKDALKAFDAASPVSPDLAAAAIAGKASCQSDLQQYDAAAKSFLS
FT                   ASEKAENNALKAQYLMAAADCRLGAGDTEKAGELFGQVVDRYPGSSGARAAQQALWKIS
FT                   GMQEVSNK"
FT   gene            complement(562756..563526)
FT                   /locus_tag="Plut_0481"
FT   CDS_pept        complement(562756..563526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0481"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23369"
FT                   /db_xref="GOA:Q3B5L2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23369.1"
FT                   /translation="MLADAHCHLSFPEFDPDRQEVIQRMQAAGVTLLIDPGTDLATSRR
FT                   SVELAKQFGFIRANVGLHPHEAEGAVADAVYEALEELARCPEVVAIGEIGLDYHYPGHS
FT                   PRHQEDAFRTMLRMAAGLDLPVVIHSRDAWPDTLRILDEERHSGLRGVMHCFSGDTAVA
FT                   RECIRRGLFISIPGTITFKRSILPEVVRSVPLASLLAETDAPYLAPVPFRGKRNEPAHV
FT                   RLVAEAIADAREISPAAAAEAIYQNTLDAFGISA"
FT   gene            complement(563516..564019)
FT                   /locus_tag="Plut_0482"
FT   CDS_pept        complement(563516..564019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0482"
FT                   /product="signal peptidase II, Aspartic peptidase, MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23370"
FT                   /db_xref="GOA:Q3B5L1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5L1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23370.1"
FT                   /translation="MKMFSMLALFVIAADQFTKKLAVFFLRDMQQSITIIPDFFSFTYA
FT                   ENRGVAFGMEFAPPFVLLMLTGAIVLGVLVFVARSRNRTPIFLSAFGLIAGGGIGNMID
FT                   RIASGRVTDFIYFDLYKGELFGHWVSLWPIFNVADSAITIGACMLVLFYNRIFPDTEET
FT                   RHAG"
FT   gene            complement(564048..564938)
FT                   /locus_tag="Plut_0483"
FT   CDS_pept        complement(564048..564938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0483"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23371"
FT                   /db_xref="GOA:Q3B5L0"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23371.1"
FT                   /translation="MSHAKLIYGLIGRAVDYSLSPLIHNTAFSLLGIEACYTIFNIASP
FT                   EEVPVALKGMRALGIAGCNVTIPYKAAVVPSLDALSDDARSIGAVNTIVNENGRLTGHN
FT                   TDIAGFAAPLLPQKAALFGRPAVMFGNGGAALAAIEALMRHFSPSSLTVFVRDPATARD
FT                   RLLPYIQKGFVELARQDDLFGGDESAMNICREAALIINATPKGTYGRPDAMESIIPTGA
FT                   GLLHSGQTVYDMVYNPEHTPLLAAAKAAGANTVPGIAMLLAQAARSFQLWTGHEMPARD
FT                   IEPIVLHELQLQRSR"
FT   gene            complement(564935..566242)
FT                   /locus_tag="Plut_0484"
FT   CDS_pept        complement(564935..566242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0484"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23372"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23372.1"
FT                   /translation="MFDAEELIDRIVQLNEDGFTAEALLGARRLEEIAPYNTETWFHLG
FT                   NCLTLNGMCEEALDAFRQASILSPADSEMILNLSLAWFNTGNLDMALEVIEGVIGDSSM
FT                   EKDYHYYRGNILQRLDRFEEAEADFLRTLELDPDFSEAWYELAYSRDLLGKFEESNACY
FT                   KKNLDLDPYNINAWYNNGLVLSKMKRYDEALECYDMALAISEDFSSAWYNRANVLAING
FT                   RIEDAAESYRQTLIYEPDDINALYNLGIACEELELYTEAVECYQKCIAQSADFADAWFA
FT                   LACCYDAMEKYPDAFHAVMESLKHIPDSIEYLLLKAEIEYNMNDLDDSIETYRRVIDLD
FT                   PESPQIWVDFAMVLKEAGHMNTSIEALEQSLKLQPLSADAHFEIAAAYFAMGDKLSTLK
FT                   ALSKAFKIDPDKKQLFQSAFPELYQQDSVRRMLGIS"
FT   gene            complement(566446..568332)
FT                   /locus_tag="Plut_0485"
FT   CDS_pept        complement(566446..568332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0485"
FT                   /product="Excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23373"
FT                   /db_xref="GOA:Q3B5K8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5K8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23373.1"
FT                   /translation="MAAETDTTLPELRETVASLPTGPGIYQFKNSAGKVIYVGKAKNIR
FT                   SRVRSYFRDPRQLTGKTQVLVGHITDLEIIITSSEVEALILENNLIKELKPRYNVNLKD
FT                   DKTYPWLVITGEPFPRVFISRNRTRDKSTWFGPYTEAGQLRSILELIGSIFPVRSCRYS
FT                   LTPENIAAKKHKLCLDYHIGKCKGPCEGLQNEAEYLEMIGEIVRLLKGRTAGLLKELHE
FT                   KMLTAAAELRFEEAAELKMQLQSLRRYADRQKMVAADGMDRDVSAIASGDDEACGVVFR
FT                   IREGKMLGARHFILTNTAGEPEKKLLGKVLEGYYLKSPEAMPEEVLLSAQLDLEDTESL
FT                   QALSREREEECPTRRKAVKFTVPQIGEKAHLVEMCRQNARHHLAEYLVQKQKRGEAARE
FT                   HYGVKALGESLHLETPPKRIECFDNSHLQGTDYVSSMVCFVNGKPLKSAYRKFRLQSLE
FT                   EACGTGSSDDYAAMEQVLGRRYGGSLQDELPLPDLIVVDGGKGQANSAKKVLDRLGITV
FT                   PVIGLAKRLEEVFTPDADGPFNLPKTSPALKLLQQLRDEAHRFAITYHRNIRSKRTLET
FT                   GLTTIPGVGEKIAFALLERFGSVDGVAAASAEELSQFAGKVKGMSIFRHYHP"
FT   gene            complement(568445..570229)
FT                   /locus_tag="Plut_0486"
FT   CDS_pept        complement(568445..570229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0486"
FT                   /product="sodium:solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23374"
FT                   /db_xref="GOA:Q3B5K7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23374.1"
FT                   /translation="MDVQMWTYTIVGITFLIYIAIAVWAKAGSTKEFYVAGGGVPPVLN
FT                   GMATAADWMSAASFISMAGLISFMGYDGSVYLMGWTGGYVLLALLLAPYLRKFGKFTVP
FT                   DFVGDRYYSNAARTVAIICAIFVSFTYVAGQMRGVGVVFSRFLEVDITTGIIIGMCIVF
FT                   FYAVLGGMKGITYTQVAQFCVLIFAYLVPAIFLSIQIANNPIPQIGFGGAGADGIPLLE
FT                   KLDMLHKDLGFAAYTSGSKPMIDVFAITFALMVGTAGLPHVIVRFFTVPKVRDARISAG
FT                   WALIFIALLYTTAPAIATFARLNLIDTVSNKSYEGLPNWFKKWENTGLLAWMDKNGDGI
FT                   IQYTGKNIGGGDAFEGSKPAFTKETGAHGEPLLSNKPNDNSNELYIDKDIMVLANPEIG
FT                   GLPDWVIALVAAGGLAAALSTAAGLLLVISTSIAHDLVKKQLNPGISEKSELLFARVAV
FT                   AVAIVIAGYFGINPPGFVAEVVAFAFGLAAASFFPVIILGIFSKRMNKEGAIAGMLVGL
FT                   IFTAAYIVNFKFLNPGMNKPEFWFMGVSPEGIGTVGMLINFAVSYVVSRFTPAPPQEIQ
FT                   DLVDSLRYPKGAGEAVEH"
FT   gene            complement(570283..570540)
FT                   /locus_tag="Plut_0487"
FT   CDS_pept        complement(570283..570540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23375"
FT                   /db_xref="GOA:Q3B5K6"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23375.1"
FT                   /translation="MEKGKLQEYWKINLGYLIGLLVVWFVVSYGFGILFVNQLNAIQIG
FT                   GFKLGFWFAQQGSIYVFVILIFVYVALMNKLDKKFDVRED"
FT   gene            complement(570729..571133)
FT                   /locus_tag="Plut_0488"
FT   CDS_pept        complement(570729..571133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23376"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23376.1"
FT                   /translation="MPGLMLTTHESRYATVEETCAALTSSIEANNWQSPATRDMTASIA
FT                   KQGITLDKQVSIVELCNAKYAQEVLATNPEVSTLMPCAWGVYEGEGGKIYVTGMNMGLM
FT                   AKIFGGNIAKVMGGSVADDEAKMLAPVIAE"
FT   gene            complement(571386..572480)
FT                   /locus_tag="Plut_0489"
FT   CDS_pept        complement(571386..572480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23377"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23377.1"
FT                   /translation="MKKMLSLAAMLAVLSYASPASAELKFGGDASVRERAEFKSFQNDD
FT                   VKSQYRIRLKAAADLGSGYFFKTMLMNEENLAGGWQTVGYGNSEKITVDVSNFYFGRMM
FT                   ADSHYMMGRIPLNSFNNPVLDLSLYPMQALDTPVFNINYDRAYGFNYGTKLGNGDLSAT
FT                   ILVLDNIAPTSREGLLNDGYGVHLSYKTTVGDVTLEPQFLTVLGSTDIWSQTKVYTAAA
FT                   TAAATGYADPTADLTFAKRVTPWTFGATASVPAGEAKLSGAAFYNFANDGAVDYHSTLV
FT                   RVKGEYGPVMAWVDYNAARDNALGHDYSNTFVWAQYKYSVYESAAGTFSLQPTVRWLTT
FT                   SDETATSNTDNSTLRAELWATVTF"
FT   sig_peptide     complement(572412..572480)
FT                   /locus_tag="Plut_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            572732..573238
FT                   /locus_tag="Plut_0490"
FT   CDS_pept        572732..573238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0490"
FT                   /product="NUDIX/MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23378"
FT                   /db_xref="GOA:Q3B5K3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23378.1"
FT                   /translation="MGDVTLRVSALCIRDGHVLLVEHKSFASGDSLLPESYWILPGGGV
FT                   ERGETLEDAVRREMMEETGLSCNVGGLIFVKELLYPYPGVAGQGERHHSVSLGFHCEVT
FT                   GGETITGRDPEYPDDQQMIMRVDWLAVADLHRYDLYPPFLPDYLRKGAQEGFSGAVPEF
FT                   FDSLL"
FT   gene            complement(573328..573870)
FT                   /locus_tag="Plut_0491"
FT   CDS_pept        complement(573328..573870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23379"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23379.1"
FT                   /translation="MKTTHTPFKAGILALITALCMLPLQAEAATSDWLHEARVGILAHD
FT                   TDINLWGAVPSEQGVDFNAELIFTPEWEFWGGSARPNVGLSLNSSGDTSHIYGGGLWEY
FT                   QWKNGVFFDAGVGLSANNESGKDLGSAVLLRLALEVGYNLSECNRMSLMMDHISNANTA
FT                   DPNPGIDNIGIRFGHLF"
FT   sig_peptide     complement(573784..573870)
FT                   /locus_tag="Plut_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.833 at
FT                   residue 29"
FT   gene            complement(573910..574815)
FT                   /locus_tag="Plut_0492"
FT   CDS_pept        complement(573910..574815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0492"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23380"
FT                   /db_xref="GOA:Q3B5K1"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23380.1"
FT                   /translation="MSAGTLSGLLDKTEGFKKELTAPAPSFSPSLQGRRIALVFFENST
FT                   RTRFSFELAARNLGASTLGFSASTSSVTKGETLSDTIKNLEAMQVDAFVLRHPSSGSAE
FT                   FISGITKKPVVNAGDGANEHPTQALLDMFTLREHFGTLKAIKVAIIGDVLHSRVARSNI
FT                   HGLLTMGAEVGLCSPVTLLPPDSEKLGVSLFTDLDQALGWADAALVLRLQLERATGGYL
FT                   PSLQEYSVHYGLTDERLERTARHLLVLHPGPINREIEISNRVADRIQPPGYSKSMLLEQ
FT                   VTNGVAVRMAVLQTLLADTP"
FT   gene            complement(574978..576939)
FT                   /locus_tag="Plut_0493"
FT   CDS_pept        complement(574978..576939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0493"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23381"
FT                   /db_xref="GOA:Q3B5K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23381.1"
FT                   /translation="MFEARNLSLSVGTKELLSDTSFRVGDKDRVGLVGLNGTGKSTLLK
FT                   LISGTTAADSGLISNGQFIKSAETTIGYLPQEISFADDLEKTALQYALQANARLYELSG
FT                   KITTMEHELALPEQDYESAGYHDLIERYSDATHEFEHLGGYTMQSDAEKVLAGLGFSEI
FT                   DFHKKVKSFSGGWQMRLHIAKLLLQNPTLLLLDEPTNHLDIDSLRWLENYLLNYEHSYM
FT                   IVSHDRFFLDKLTTKTLEIAFQRIDEYKGNYSRYEIEKAERFELLMGKYENDKKKIAEL
FT                   QSFVNRFRAKATKARQAQSRLRQMEKLEKEIECPEEDLSRISFRFPKAQPSGRKVMRLD
FT                   GVGKSYPLPDGTTKEVLRGIDLEIMRGDRIAIVGSNGAGKTTFCRILAQEIDFEGKLSV
FT                   GHNVSMNYFAQHQTETLAPEKSIYTEMLDAAPTAEAQKKVRDILGCFLFSGDAIEKKIK
FT                   VLSGGEKSRVALARILLQASNLLVMDEPTNHLDMRSKEMLIDSLENYDGTLLLVSHDRY
FT                   FLDSLVNKVVELKNGSIQLYLGTYAEYLEKAEKNLEEEKAREAAAMKAKAAAEKPAKTG
FT                   TQAPAAKPAAKKDRKKIEAIEKEINRLEQEKERMETLMANEDFYMKSQAETAATLEGYH
FT                   ALSAELEQMFSDWEKAGG"
FT   gene            577242..578522
FT                   /locus_tag="Plut_0494"
FT   CDS_pept        577242..578522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0494"
FT                   /product="FusA/NodT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23382"
FT                   /db_xref="GOA:Q3B5J9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23382.1"
FT                   /translation="MKRSIVFPVLLFLGLAPAVLHAEEAVSWRGCVMEARARHPDLASS
FT                   RALLRQAEAERLLAGSTLLPSLGVTGSVTTGGTVGSGASGASSLFSYSVTARQLLYDGR
FT                   KNSKLRDASAESVKARESSMAGVSADVRFVLRSAFTELLKAQEMVELSSDIALRRKNNA
FT                   RLIALRYRAGREHIGSLRRAEADLAAAEFEVAQASRGLVLARCVLSSALGRRERSPLRV
FT                   AGSFTAPVPETRLAPDFQAIARRNPLVVELEAVRNAAGYSLAAAESAFAPELYLRSSAG
FT                   RSETSDWPPENVSLHAGVELVVPIYEGGAGRARVAGARAALSGKDAAVESGMLQVLDLL
FT                   EASWKQFVDARERLTVQKKYLDAAVERSSIADAQYSNGLISFDDWVIIEDNLVSAKKEF
FT                   LNAGGNLWIAEAQWIQAKGGGLDEVVD"
FT   sig_peptide     577242..577310
FT                   /locus_tag="Plut_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            578506..579477
FT                   /locus_tag="Plut_0495"
FT   CDS_pept        578506..579477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0495"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23383"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23383.1"
FT                   /translation="MKLWIKVLSAVALLGLVSGSVLFFTAGGRKESATRYSVVMPERGR
FT                   IVLKVSTTGEVEPRNRLKILPSVAGRVEEVRAEEGAMVRKGQVLALLSSSERAALLDAA
FT                   RLQGSSEQSYWQSVYRPTAVLAPIDGQVIVRSIEPGQTVTSSDSLFVLSDRLIVKAYVD
FT                   ETDIGRVKVGQKALIGLDAYPEIRLNGRVSHIYYESHLQNNVNIYYVDVIPETVPDVFR
FT                   SGMSANIDIIVREKTDALLVPVATFSTRNGRTTVLLEGERGGEGRPQEVRVGLTDDGRA
FT                   EILEGLTDSSRVLLPDTTFVLPENNGGSNPFMPKRKKKDKKP"
FT   sig_peptide     578506..578598
FT                   /locus_tag="Plut_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.442 at
FT                   residue 31"
FT   gene            579474..581486
FT                   /locus_tag="Plut_0496"
FT   CDS_pept        579474..581486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0496"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23384"
FT                   /db_xref="GOA:Q3B5J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23384.1"
FT                   /translation="MTSMLPMAPTTPLLELVDVHRTYPVGESTVNALRGVSLEIREGEF
FT                   VAIMGSSGSGKSSLLHILGLLDNPDRGEYRILGRNVNALPEDGQAGLRNHVAGFVFQQF
FT                   HLLKRMSIVDNVRLPHIYSGLKGDFRHEALESLKKVGLMHRLDHTPGQLSGGEQQRVAI
FT                   ARALIGNPMILFADEPTGNLDSRNSLEIMKILEELHREGRTIVMVTHEDEIAAYADRVI
FT                   TMRDGLVVSDQRRDRVCLPAGPSVPLTLDPHAMMDASRNLSVWQDGRFIGFVQQAFQSI
FT                   FANKVRSLLSVLGILVGVASVIAMMALGEGAKVSIEEELKSMGSNLISVRGGSARVRGA
FT                   AQGDGAVARFTFKDVKDISRMHSLVKGAAGTVNGSGQIVFGNRNWSTTLDGVGYEYGSM
FT                   RAFVPSIGRWFTRDEIRKREKVAVIGVTVARELFGNNNPIGHTVKINRINFKVIGIAPA
FT                   KGFSTHRDQDDVVLVPVTTAMYRVLGRDYLNSIYVEVRSAEGIDGAKEAVSDLIVKNHR
FT                   LREGDDSFNIRDMTEIQEMLSSTTRTMSMLLGAIAAISLLVGGIGIMNIMLVSVTERTR
FT                   EIGLRKAIGARREDIMLQFLVESVGLTLSGGIIGIIAGIGISALLAVFAGWAVKTSIVS
FT                   IVLATFFSAITGIFFGLWPARKAAELRPVEALRYE"
FT   gene            complement(581886..583061)
FT                   /locus_tag="Plut_0497"
FT   CDS_pept        complement(581886..583061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0497"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23385"
FT                   /db_xref="GOA:Q3B5J6"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5J6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23385.1"
FT                   /translation="MNIHEYQGKDILRKFGVAVPKGIVAYSAEEAKQAAEQLFAEQDSP
FT                   VVVIKAQIHAGGRGKAGGVKLAKSPEEAHEIASQMLGTTLVTHQTGPEGKEVRRLLVEE
FT                   GMNIDREFYVGITLDRATSNNVLMISTEGGMEIEKVAEETPELLLKIQVDARFGLQGFQ
FT                   AREAAFFLGLEGEQFRNAVSFITALYNAYTSIDAALAEINPLVVTKEGRVLALDAKINF
FT                   DSNALYRHKDFIELRDISEEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMATMDMIQ
FT                   LAGGRPANFLDVGGGASPQTVEEGFKIILSDKNVKAILVNIFGGIVRCDRVAGGIIEAA
FT                   RKIGLNLPVIVRLEGTNADIAQKMLDESGLNLIAADGLKDAAQKVNQALSA"
FT   gene            583231..583692
FT                   /locus_tag="Plut_0498"
FT   CDS_pept        583231..583692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0498"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23386"
FT                   /db_xref="GOA:Q3B5J5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23386.1"
FT                   /translation="MDFTYFMELAFREARKAFEAGEVPVGAVVLDASSHVVGRGYNQVE
FT                   TLSDATAHAEIIALTAAMATLGNKYLNDCTLVVTLEPCPMCAGAIVNAKVGRVVFGAYD
FT                   PKMGAAGSVLNVTGCRALNHQPEVFGGIMEARAQGLLQDFFAELRRKVR"
FT   gene            complement(583708..584730)
FT                   /locus_tag="Plut_0499"
FT   CDS_pept        complement(583708..584730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23387"
FT                   /db_xref="GOA:Q3B5J4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23387.1"
FT                   /translation="MKRKATALLYAFTAAAILLVGVFTLNQITAAAGLFDTIIPYGGLA
FT                   FIALSTTVIVWLAWTAVRFLSTPRHPALPGDAGAKDLASYAAWMGSRMPVHPMHPDRNG
FT                   KQSDLRWVRANLKLLEAEALTATKEVATKNFFVGAFAQGTAYGTSTSFFNMIRLVWRIY
FT                   CMHHRRQNFREFIALTRGVYELLPLSDFQKEEIPAHIKPIIQSSFSNTLSSLLPAGNLL
FT                   TPFFLNLFLAGSTNAYLTCLAGMITTRRCQMTTEEDRREIVQQSMFEAAFMLKEIVREC
FT                   NPVLSVTISTAVKKAGIESLDTVTPPTAGSGIAQDLFSHLANSVKHIIRENISVEKGGE
FT                   "
FT   sig_peptide     complement(584635..584730)
FT                   /locus_tag="Plut_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.371 at
FT                   residue 32"
FT   gene            complement(584821..586080)
FT                   /locus_tag="Plut_0500"
FT   CDS_pept        complement(584821..586080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23388"
FT                   /db_xref="GOA:Q3B5J3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23388.1"
FT                   /translation="MKVDNFRLKLGAREYVPIIIGGMGVNISTTELALAAEKLGGIGHI
FT                   SDAETGYVCDRIFNTSFVSTKRKRYAAFTDSRDKSEVKFDLGEVAEAQKRYIEHTVSQK
FT                   TGNGLIFLNCMEKLTMNGANETLKVRLRSAMDAGIDGITLAAGLNLRTLDLIQDHPRFR
FT                   DVKIGIVISSVRALSIFMKRAVRLERLPDYIVVEGPLAGGHLGFGPDDWKKFDLHTIFT
FT                   EVLAFIKEEGLQIPVIPAGGIFTGTDAAQYMAEGAGAVQVATRFTITAEAGLPANVKQE
FT                   YLNAREEDIVVNMASTTGYPMRMLRQSPTLRYAIKPNCEGLGYLLENGGKCTYIDAYHK
FT                   ALEERRPGEPLEVEEKTCLCTGMAKYDCWTCGHTTYRLKETTNRMADGTWQLPPAEDIF
FT                   LDYQHSQDHSIRLPKHPEGR"
FT   gene            586404..587147
FT                   /locus_tag="Plut_0501"
FT   CDS_pept        586404..587147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0501"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23389"
FT                   /db_xref="GOA:Q3B5J2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23389.1"
FT                   /translation="MIKLVLLRHGESQWNLENRFTGWHDIDLTERGRKEAANAGKLIRA
FT                   EGIVFDVAYTSVLKRAIRTLWSVLDEMDQMWLPVHKSWRLNERHYGALQGLNKTETSQK
FT                   YGEEQVLVWRRSYDTPPPALGRDDERWPGADPRYRGMAEGEIPLSECLKDTVARFLPLW
FT                   HETIAPQIRSGKSVAIVAHGNSLRALVKYLDNISEDDIVGLNIPTGIPLVYELDDDLKP
FT                   LKSYYLGDQDAVKQAVAAVAGQAKA"
FT   gene            587260..591861
FT                   /locus_tag="Plut_0502"
FT   CDS_pept        587260..591861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0502"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23390"
FT                   /db_xref="GOA:Q3B5J1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23390.1"
FT                   /translation="MKVTSNAGLYDPQFEHDACGVGFVAHIKGVRSHDIVEQGLQINEN
FT                   LKHRGACGCEKNTGDGAGILLQVPDLFLRRVCGERNIELPPEGRYGVGMLFLPPDISQR
FT                   RAIEDICRLMIQAEGQKCLGLRKVPTDNSTIGDTARSEEPVVKQLFIGWGEDVTSELEF
FT                   ERKLYIIRRRITKRVKYTAGLLGSNYFYISSMSARTIVYKGMLLPEQVGEFYPELHDPD
FT                   MESAIAMVHSRFSTNTFPSWDRAHPYRFLSHNGEINTLRGNVNWMKAREKNVRSKVFGD
FT                   AIEDIKPVIMEDGSDSAILDNTFEFLVLSGRSLAHAAMMIIPEPWSGNKSMSDGKRAFY
FT                   EYHSCLMEPWDGPASVVFTDGRQIGAVLDRNGLRPSRYYITKDDLVIMASEVGVLDIAP
FT                   ERILKKDRLQPGRMFLVDTVEGRIIADEEIKASIASEKPYGEWISRNVIDISALPDHPQ
FT                   MRNPDEDKYSLTARQKVFGYTREDITMQIIPMSEKGVEMVGSMGNDTPLAALSNKPKLL
FT                   YDYFKQLFAQVTNPPIDSLREEIITSTSVMLGTEGNLLEAEEVNCRRVKLPHPILTNQD
FT                   LEKIRGIDKPGFRAVTIPIFYDVAKGGKGIEAAMQDIYRQAEQAAQVGVNIVILSDKGE
FT                   IERDRAPIPALLAVSGLHNFLINAGIRTEIGLVLESAEPRAVHHFAMLIGYGAGAVNPY
FT                   MAFETIRSLVAEGQIRFDEKTAIYNYVKAAVKGVVKTMAKMGISTIQSYRGAQIFEAVG
FT                   LNSKLVDAYFTRTPTRIEGIGLSTVAEEVHRRHASVFPPSGNKVNRGLEAGGERKWRHD
FT                   GEYHLFSPEALHFLQHSCRTGDYDLFQKYEGLIDDQSRNLCTIRGLLDIRFPAEGIAIE
FT                   EVEPVEAILKRFKTGAMSYGSISQEAHETLAIAMNRLGGKSNTGEGGEDPSRFVKDANG
FT                   DSRMSAIKQVASGRFGVTSEYLASADEIQIKMAQGAKPGEGGQLPGTKVYPWVARVRHS
FT                   TPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPVARINVKLVSTVGVGTIAAGVAKAHA
FT                   DVVLISGHDGGTGASPISSIMHAGMPWELGLAEAHQTLMLNNLRSRIVVEADGQLKTAR
FT                   DILIAALLGAEEFGFATTTLVVMGCIMMRACQDDSCPVGIATQNPKLRKNFKGKPEHVE
FT                   NFMRFLAEGVRQYMARLGVRSLNELVGRTELLGMKKTVEHWKAKGIDLSKILYQMDLPE
FT                   EGTRYCSMAQEHALEESLDCTALLEICEPAIKRREKVTSTLPIRNTNRVVGTIVGYEVT
FT                   KAYGAAGLPDGTIKLKFTGSAGQSFGAFIPKGMTLELEGDANDYVGKGLSGGRIAVYPS
FT                   KGSSFLPEENIIIGNVGFYGATSGEAFIRGMAGERFCVRNSGLHAVVEAIGDHGCEYMT
FT                   GGTVVILGRTGRNFAAGMSGGVAYVYDRDGSFRDNCNPEMVSVTPVDDPMECAALQSMI
FT                   EKHVEYTRSDLGQSILDAFPTLIGKFVKVMPNDYRRALEAMKEVEAAGITGEAAVMAAF
FT                   EKNVHDPSRVSGN"
FT   gene            591914..593371
FT                   /locus_tag="Plut_0503"
FT   CDS_pept        591914..593371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0503"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23391"
FT                   /db_xref="GOA:Q3B5J0"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23391.1"
FT                   /translation="MEFQRAVPRDRAPLERIKDWNEFHLEMEDAGLRDQGARCMDCGTP
FT                   FCHTGIMLAGMTTGCPIHNLIPEWNDLVYNGYWADAYDRLMKTNNFPEFTGRVCPAPCE
FT                   GSCVLGIIEPPVTIKNIECAIIERAFAEGQVEPKSIAFRTGKSVAVVGSGPSGLAAADQ
FT                   LNKAGHTVTVFERDDRCGGLLMYGIPNMKLDKEQVVQRRIGLMQQEGVDFRVRTEVGVD
FT                   FPAEQLLSDFDAVVLCTGSTKPRDLDAEGRREASGIHFAMDFLRSSTKSLLDSTAPALS
FT                   AEGRHVVVIGGGDTGTDCVATSIRQGCMSVVQLEIMPKPALERPDDNPWPQWPKTFKVD
FT                   YGQEEAAALQGDDPRKYSMMTKKFITDGSGNLKGVEASEVEWVKKDGRFIPQPVSGTEQ
FT                   IFPAELVLLAMGFLGPEEALLDQLHVERDLRMNIKAPETTYRAGEGKIFAAGDARRGQS
FT                   LVVWAIQEGRAAARECDRFLMGETFLP"
FT   gene            593462..593734
FT                   /locus_tag="Plut_0504"
FT   CDS_pept        593462..593734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23392"
FT                   /db_xref="InterPro:IPR025516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23392.1"
FT                   /translation="MEQQKLRELLESLHHELEQVDSLDESTSRVLCDLKEDLGRLAGQQ
FT                   GAADICRDEPFMERMNDAVDHFETDHPKLSMALQHVLDSLAKMGL"
FT   gene            593787..595112
FT                   /locus_tag="Plut_0505"
FT   CDS_pept        593787..595112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0505"
FT                   /product="ClpX, ATPase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23393"
FT                   /db_xref="GOA:Q3B5I8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23393.1"
FT                   /translation="MTRERETAKGKTRNINRGGDGGEQVYCSFCGRSAQEVSSMVAGPM
FT                   AFICDRCIKTSYDILRKELSAIQHPEVIAEQPFLPRLVSPKAILESLNQYVVGQERAKR
FT                   SLAVAVYNHYKRIDSQEWRHDDDEIVIEKSNIMLIGPTGTGKTLLAQTLANLLEVPFSI
FT                   VDATSLTEAGYVGDDVETILARLLHASDFNLERAERGIIYVDEIDKIARKSANVSITRD
FT                   VSGEGVQQALLKILEGAVVGVPPKGGRKHPEQQLININTKNILFICGGAFEGLDRLIAR
FT                   RISKSSMGFGSSVTDKQSGYDPEILKHVTQDDLHEYGLIPEFIGRLPVLSTLDPLDADA
FT                   LRSILVEPKNALVKQYGKLFEMDGVELEFTPEALERVVAIAIERGTGARALRSVLENVM
FT                   IDIMFELPTMKGVGKCIITEEVIDRKGEPIYLDGAGRKKKRA"
FT   gene            595182..595255
FT                   /gene="tRNA-Val2"
FT                   /locus_tag="Plut_R0007"
FT   tRNA            595182..595255
FT                   /gene="tRNA-Val2"
FT                   /locus_tag="Plut_R0007"
FT                   /product="tRNA-Val"
FT   gene            complement(595600..596388)
FT                   /locus_tag="Plut_0506"
FT   CDS_pept        complement(595600..596388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0506"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23394"
FT                   /db_xref="GOA:Q3B5I7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23394.1"
FT                   /translation="MLFRVMSDIHNEFCREESSENWQVPELAEDNESVLILAGDIGLLS
FT                   RKQTWFGFLSQCSKQFRDVFVIEGNHEWYHGNIEKHSWQNAIAEHRFHNVDTGQLILEK
FT                   EKIAIIGTTLWTDFFGGNPIAMFDVSQGLNDYRLIKVGADYHRLRPEYLLALHHKQKKR
FT                   LFEDVDHYTGLGYTVIVVTHHHPSLQGIAPGYRNDLLNAAYVSDLEKEVLSHKIAYWIC
FT                   GHCHTAMEYSIGETRVICNPKGYPHEYGNGFDPLKTLNVQ"
FT   gene            596651..597262
FT                   /locus_tag="Plut_0507"
FT   CDS_pept        596651..597262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23395"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23395.1"
FT                   /translation="MSQQSTVADKAKALILAQGGLIRTREAISLGIHPRTLYSLRDSGE
FT                   LEELSRGIYQLKGWKQLEYPDLVTVALRVPNGVLCLVSALSFHEMTTQVPHSVSLALEK
FT                   GAEQPRIEYPPVTVFRFSPSCFKIGIETHQLDGVSVKIYSPEKTLVDCFKFRNRIGMDI
FT                   VLEALKLYRQRVQKNLHALMQYAEVCRVASIMKPYLEATL"
FT   gene            597259..598197
FT                   /locus_tag="Plut_0508"
FT   CDS_pept        597259..598197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23396"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23396.1"
FT                   /translation="MSANAIKNIGASVRQRLLNKARQENRPFQELLQYYAIERFLYRLS
FT                   VSSFADRFILKGALLLRVWQAPLARPTMDIDMLGKTGNAPESIMTIIHQVLAVEKQGDG
FT                   IVFDPESITVEPITEDADYEGLRIRFRGDLDAARLTIQLDIGFGDKVYPDPVQESLPSL
FT                   LNFPQAEMYCYSRESMIAEKFEVMAKLGILNSRMKDFYDIWMLSRQYDFEGASLAEAIR
FT                   QTFAQRGTTLVQMKEIFSGEFIEEKQVQWNAFRKRIGLEYLPASFADVVQQVQVFLSPA
FT                   VEALRAKRFFQDNWIAPDSWRSNHEKPEVRA"
FT   gene            600048..600884
FT                   /locus_tag="Plut_0513"
FT   CDS_pept        600048..600884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23397"
FT                   /db_xref="InterPro:IPR018547"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23397.1"
FT                   /translation="MKNIILCCFSRTIHVPKNMNLSRYIDGLQAKGSFCFSGAEASSAL
FT                   CSSAIATRDALRRLRYKRVVAMPYRGFYVVVPPEYRQIGCLPANQFIPSLMEYLKEPYY
FT                   AGLLSAGEYYGAAHQRPQSFQVILEHIRPAIICGSVKVDFIQRNNAALMPTRNFKTPRG
FT                   YLKVSSPEVTAFDVTGYPHHAGGLDNAATVLAELAEGMDAGKLLDIAGLSPVTWSQRLG
FT                   YLLELIGEDGLAEGLAAYVAERKPVPALLSPSQPHHGVHQVPRWRLLPNETVSPDL"
FT   gene            600956..601726
FT                   /locus_tag="Plut_0514"
FT   CDS_pept        600956..601726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23398"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23398.1"
FT                   /translation="MIICRSLVELYSHPVAAANLVFRGGTALFKLHLSPARYSEDIDLV
FT                   QKEPGPIGPVMDAIKEKLNPWLGEPRRKQSEGRVTLIWRVDSEEGMPLRLKVEINSRER
FT                   FSVLGYQQLPFEMTSRWYSGSAAITSYGRDELLGTKLRALYQRKKGRDLYDLWYAAKTM
FT                   PLNPEAMVSCFLRYMEHEQHTVTRAEFEMNLLEKLDDPRFLGDIGPLLAPLLTSKTEWD
FT                   AKSAGIYVLEALTPLMPGDAWQKTQEKLAAFKAN"
FT   gene            complement(602051..603262)
FT                   /locus_tag="Plut_0515"
FT   CDS_pept        complement(602051..603262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23399"
FT                   /db_xref="InterPro:IPR014544"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23399.1"
FT                   /translation="MSGTKKDWTTPADIREQVQRLWDRGTLLNALVDDRDLFPLRLGHS
FT                   RPDSREISDRFIEVRDWIARLKAAEGPYRIVSRTLNHRVHGSDSIPYEIWIDSADDALG
FT                   LIGKRRAAAAFVDMIELTRRYEPALLPWISKRPLRALELATVWPLMLNIVEWLRQHPRP
FT                   AVYLRQIDIAGVHTKFIERHRGVLSELFDLALPKSSIDEHATGTTNFCRRYGFRDKALR
FT                   VRFRILDSAYSILPYCTDQEITLTHTDFARLHLPVETVFVTENEINFLVLPPIPRAMVI
FT                   FGAGYGFSNLAVVSWLQDKKLYYWGDIDTHGFAILNQFRQYFPTATSFLMDRETLLAHR
FT                   QYWQREPCPETTALQRLTDPEQSLFNDLRQNNLGEHIRLEQEKIGYSMLLDALRKNPAL
FT                   SASS"
FT   gene            complement(603259..606624)
FT                   /locus_tag="Plut_0516"
FT   CDS_pept        complement(603259..606624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23400.1"
FT                   /translation="MAEALELGFISDDRLAGFRLQRIEVFNWGTFDSRVWTLRLDGLNG
FT                   LLTGDIGSGKSTLVDALTTLLVPSQRIIYNKAAGADIRERSLRSYVLGFYKSERQESLG
FT                   GGAKPVALRDSSAYSVVLGVFRNEGYDKTVTLAQVFWMKDPSGPPARIYAAAERDLSIA
FT                   IDFSGFGPEITALRKRLKAGGVELFDSFPKYGSWFRRRFGIDNDQALELFHQTVSLKSV
FT                   GNLTDFVRTHMLEPFDVEPRIAALINHFEDLKRAHEAVLKAKQQISMLDPLVEDCNRHR
FT                   ELSASNEELRGCRETLRPWFATLKLDLLHHRLTSLEEELVRHESSLRRLEAERLEQQER
FT                   DRSLRLTIRESGGDRIESIASDIRMKQGELEHKKLKATRYAELLKPLGETPASSLEEFL
FT                   HKRTLQVTMRENAAGQEARIQNELNELGVTLTREEQEYRELMAEIESLKARTNNIDDRQ
FT                   IAMRRDLCRALGIDENEMPFAGELLQVRQEENGWEGAIERLLRNFALSLLVPDRYYASV
FT                   AEWVDCTHLKGRLVYFRVRTPSRSETMPPGPATLPHKLMIKADSPHFEWLEGEINRRFD
FT                   VVCCDSQEMFRREKKAITMAGQVKMAGERHEKDDRHRLDDRSRFVLGWSNAAKITVLEE
FT                   NARQKNDCLGELNSRMKALRQEQTALKERLAILSRLDEYSDFHELDWQPVAVAIARLEA
FT                   EKRELESTSDILRTLTLQLQEVEQELRETERQLNERKSRHAKTEQKISDAKELAEQAGQ
FT                   CLNEAVPESAERFPRLESLRLEMTENRAITIESCDNCERDMRDWLQSKIDAEDNKIRRL
FT                   NDKIIRLMTEYNEKWKLETREVDVNIASADEYRSMLGNLRADDLPRFEVRFKDLLNENT
FT                   IREVANFQSQLARERETIKERIGRINESLTKIDYNPGRYILLEAEMNLDADIREFQTEL
FT                   RSCTEGALTGSDSEYSEAKFLQVRRIIDRFRGRDEYSELDRRWREKVTDVRNWFVFAAS
FT                   ERWREDDSEHEHYADSGGKSGGQKEKLAYTVLAASLAYQFGLEWGEVRSRSFRFVVIDE
FT                   AFGRGSDESAHYGLKLFAQLNLQLLIVTPLQKIHIIEPFVSSVGFVQNKDGRNSELRNL
FT                   SIEEYRTEKQKMAQ"
FT   gene            complement(606617..607252)
FT                   /locus_tag="Plut_0517"
FT   CDS_pept        complement(606617..607252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23401"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5I0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23401.1"
FT                   /translation="MTTPIDAQTPRPATAPEELSPLVVTLLKGVLYEEENTALWNALLN
FT                   MQAGVRDYISVLGLELILDEAEGYAFLRSRAAGEEESQDSMPRLVARRQLSYPVSLLLA
FT                   LLRKKLAESDAGGGDTRLILSREEVVELIRIFLPAGSNEVKLIDQVDASLNKIAELGFI
FT                   RRLRNDKQTIEVRRIIKAFVDAQWLADFDRRLDEYRQLSGKSTEETDG"
FT   gene            complement(607252..608700)
FT                   /locus_tag="Plut_0518"
FT   CDS_pept        complement(607252..608700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23402"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23402.1"
FT                   /translation="MALDYTTLDLLRQNHPAWRLLRAQHAPLVSSFLHRAFIAPNVRTL
FT                   SEADLVEQLEDELFALRRQLGDTAYPGSAQSYLNDWAENDKGWLRKFYPVGEDEPHYDV
FT                   TPATEKALAWLESLSERAFVGTESRLLTLFELLRQMSTGSQADPELRIAELNRRREEID
FT                   GEIARIHAGDISLLDDTALKDRFQQFLQLARELLTDFREVEQNFRTLDRRVRERIALWE
FT                   GSKGALLEEIMGQRDAIADSDQGKSFRAFWGFLMSQSRQEELSVLLDEVLNLPPVVEMH
FT                   PEPRLKRVHYDWLEAGEHTQRTVARLSGQLRKFLDDKAWLENRRIMDILHDIESSALGL
FT                   NGQMPEGSFMPIADASASIELPFERPLYRPPFKPVIEGIALEAGDAEIDTAALYAQVII
FT                   DRAELTGNIRKALQEQKQIGLGELIALHPLQHGLAELVTYLQIAGEWPRTAVDDEVEER
FT                   IEWEGENGFMRRATLPRIIFVRND"
FT   gene            complement(609213..610220)
FT                   /locus_tag="Plut_0519"
FT   CDS_pept        complement(609213..610220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0519"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23403"
FT                   /db_xref="GOA:Q3B5H8"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23403.1"
FT                   /translation="MDSETLKETARALAAGDKGILAMDESVPTCNRRFAILGIEETEEK
FT                   RRQWRELIATSPGIGDFISGAILFEETIRQKTAAGQPIVEVLREAGIIPGIKVDERAKA
FT                   MALHPGEKITEGLDGLRERLEKYREAGARFAKWRAVITIAEGIPTRGCIEANAHALARY
FT                   AALAQEAGLVPVVEPEVLMEGTHTMDQCEEVTEVVLREVFSSLVHQRVLLEGTVLKTSM
FT                   VLPALGCPIQNTIMEEADATLRCMLRTVPAAVPVIAFLSGGQPGQLASARLSAINERYR
FT                   QTAPWALSFSFARAIQQTAMAQWNGEDAQREAAQTTLLHRSRSNAMARRGEYIE"
FT   gene            610430..612262
FT                   /locus_tag="Plut_0520"
FT   CDS_pept        610430..612262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0520"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23404"
FT                   /db_xref="GOA:Q3B5H7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23404.1"
FT                   /translation="MKKGRERSGMFRAWSLVLLLALSGIVPAAWSALHAAGPADPSSAF
FT                   RLRGELLRNGSVSLRWEIAEGYKLYGDQVRLEVDSGSVSMTPPVLPEGEQALDPLTGEA
FT                   AAVYHDSLRLTVPFTATGSPFVLRVWHQGCADEGICYPPAATLFRIDPEKPGPLRAEAG
FT                   SAGFGVLPASPSASFEPPSDTAPSPVMATLMEGSLWKIGAVFFVFGLLLSLTPCILPML
FT                   PILSSIIAGEASPSRSRGLLLALVYSAGMAVVYTGMGVAAGLAGEGLAGFLQQPPVLLG
FT                   FAFLLILLSLSMFDLYQLQIPASLQKRLNSASVTLKGGRFPGVFLMGAISALVIGPCVA
FT                   APLAGTLIFISQTGDLLLGGMALFSMAAGMSVPLLLLGLSAGFLLPRAGGWMVAVKYLF
FT                   GILLIAVAINMASPVLPPPAVMTAWAMLLVLAAYFLGVFQRSGGNASSLNLAGRATGFL
FT                   CLLLAAVMVFGAATGARSPGDLLRVLGGTAVDGRQPALQFLMISSDAELDRELRDADRP
FT                   VMLDFSADWCVSCRELEHITFRDPEVAAALGRMRLLRVDVTRHTPEDRRLMKRFGVFGP
FT                   PALVFFDSKGRELSGLRVDGFIAPKDLLELIRRP"
FT   sig_peptide     610430..610537
FT                   /locus_tag="Plut_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.867 at
FT                   residue 36"
FT   gene            612645..614933
FT                   /locus_tag="Plut_0521"
FT   CDS_pept        612645..614933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0521"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23405"
FT                   /db_xref="GOA:Q3B5H6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23405.1"
FT                   /translation="MKPNDHILINEFLFMRGESSLGAEIVNFLSEHEGQRYRSVELAKA
FT                   MGYGESRQLPGFWYVLHKMQDEGTLDKDSNRCYGMPGPDASYEDHLQHQKPFPIPDKDQ
FT                   YKVDSTYTGFITTHPNGYGFVKVEGFDDDVFIKADVMNSAIHGDEVELTVTKVPKTYSS
FT                   RSTPHQRCEGMVTKIIQRKVSTIVGTLVRGNRRFTLKADERKILPEIIISIKNAAKAKD
FT                   GQKVMVGELDFSKEGAIQGKVLEILGTAGDSAVEVSAIARSKGIDETFDKEIVKAASAM
FT                   KMGVTDKDLQERLDVRDKVLFTIDPVDAKDFDDALSVEPLENGLWKIGVHIADVSHYVT
FT                   EDSPLDKEALKRATSVYLVDRVIPMLPSRLSEDICSLNPGVDRMAFSVFFTMTEDGKVQ
FT                   KHEFHKTVIHSKRRFTYEDVQEILNNKKGDYLMELQLLEKISVLLREERFRHGGLDFET
FT                   EEVRFKLGKKGEPLEVMKKERLGSHRLIEEFMLLANRKVAEFLTKTFKEGKKVPQPVIY
FT                   RVHDSPQQERVIILANFVKKIGYDLKINKGKDGPIVSAKSLRELLQKVHGTNVEFLVNE
FT                   LVLRCMSKAVYTGENDGHYGLGFEHYTHFTSPIRRYPDLIVHRLLFEYEAFRKKRRKMP
FT                   EARIAELKQKIDTVCRISNEREKVAVEAERESIKLKQVEYMQSHTGKVYPGVISGATEY
FT                   GIYVRMVDFAIEGLVHMRNLTDDYYEFDEKSYSLVGKRRKKRLQIGQKVMVKVHEVDMQ
FT                   RRTIDLTLG"
FT   gene            complement(614930..616417)
FT                   /locus_tag="Plut_0522"
FT   CDS_pept        complement(614930..616417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0522"
FT                   /product="Deoxyribodipyrimidine photo-lyase type II"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23406"
FT                   /db_xref="GOA:Q3B5H5"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23406.1"
FT                   /translation="MIDPRCISVLNSAPGISGPVIYWMSRDQRVEQNRALHYARFRAVA
FT                   DGAPLIVAFTLSPSFIGATFRQYDFMLRGLMEVERRLRELEIGFVLLEGDPAEAIVRFR
FT                   ESIGSGCVVTDYSPLRISRRWKATAAAALPVLFIEVDAHNIVPCLMASPKQEYSARTFR
FT                   PKVNRLLGEFLIALPPVERVPASEPWAPTDWERVRARLPVERPAGTVRHPQPGEAAAIR
FT                   HLETFIRERLAWYGERRNDPNADATSGLSPYLHFGHIWAGTVAIAVRGVMNVVNSPSPE
FT                   GWEAIGVVNSTSPEGREASGVVNSTSPEGWEATGVVNSPSPEESKAAFLEELIVRRELS
FT                   DNYCAYNSRYDSFDGLPIWAQDSLARHAADLREAIYTPEEFEKAVTHDPLWNAAQQELL
FT                   RTGSIHGYMRMYWAKKILEWSPSPREAFETAVWLNDRYALDGRDPNGYAGVAWSIGGLH
FT                   DRPWFERPVYGKIRYMNAAGCRRKFDVERYIREQKEP"
FT   gene            complement(616414..617142)
FT                   /locus_tag="Plut_0523"
FT   CDS_pept        complement(616414..617142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0523"
FT                   /product="glutamine amidotransferase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23407"
FT                   /db_xref="GOA:Q3B5H4"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23407.1"
FT                   /translation="MQERLLIVKNITHEGPGLLEGLLLDRRIDADIADLSRGDPFPDPD
FT                   SYRALVVLGGPQSVNDPTPEMQGELKQIEKALKKEIPYLGICLGMQALVHAAGGRVVPC
FT                   PEKETGFFDPTGDPYRMELSEEGQSDPLFKGLGDRFRVFQLHGETVVPATGTVLLGTGH
FT                   RCHHQAVKAGKHAYGLQCHFEMTRDTLDRWTEIDPDLKAMGRERLLGEFDELQEEYRTT
FT                   GLRLLGNFLDIAGFKAEGTA"
FT   gene            complement(617280..617648)
FT                   /locus_tag="Plut_0524"
FT   CDS_pept        complement(617280..617648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23408.1"
FT                   /translation="MLLKGGACSDVTQRLSSIQQTHTDMANSNGVFSDLFNAVGAPIQN
FT                   VADGVANGAASVLSVAESGVNLCATALTATINTGMDVFKSVADSVGSFGKPAAAKPAAP
FT                   AAAPKSAPGSNPFNPAKP"
FT   gene            617705..619156
FT                   /locus_tag="Plut_0525"
FT   CDS_pept        617705..619156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0525"
FT                   /product="Pep581 peptidase, Metallo peptidase, MEROPS
FT                   family M20C"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23409"
FT                   /db_xref="GOA:Q3B5H2"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23409.1"
FT                   /translation="MHDELLQLEPRPLWRHFHLLCQTPRPSGHETAVRRLVVGFGRTLG
FT                   LETLKDEAGNVIIRKPATPGMEERPGVVLQAHLDMVPQKDAGCSHDFANDPIEAYVDGD
FT                   RVRARGTTLGADNGIGAGAAMAVLESSTIVHGPLEALFTANEEAGMTGALGLKPGVLKG
FT                   SILLNLDSEDEGELFIGCAGGLDATIAFDCPQEHLPPGNRAFEVRVKGLSGGHSGMDIN
FT                   LGRANANRVLAALLLRGAETHGMRLASFEGGSLRNAIPREASAVVTVPDEDAGRFHGMF
FT                   PDLAAAIGEQLAAADPGCSIDIIPGDEPSSVIQRDAAGRFLRGLSNCPNGVIRMSADID
FT                   GLVESSSNLAIVRTSPGRAIAECLLRSSTDGGMEELKDAFTGVFPPLGATALFSGGYPG
FT                   WRPDPASPVLRLMQEAYRSLYGRAPGVSAVHAGLECGIIGDLCPGLDMVSFGPTIRHPH
FT                   SPGEYVVISSVGRFWDFLVRVLAEI"
FT   gene            complement(619167..619436)
FT                   /locus_tag="Plut_0526"
FT   CDS_pept        complement(619167..619436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23410"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23410.1"
FT                   /translation="MHDYNNDKTMMKMAEETTVQGRGATSGLVDATARLGQLQVEMMAG
FT                   GLRAVMALLVPLSRASVELSLGMLKTFSRVMDGITTALVPKRQV"
FT   gene            619696..620277
FT                   /locus_tag="Plut_0527"
FT   CDS_pept        619696..620277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23411"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23411.1"
FT                   /translation="MSEQLTFREAMGPISGDGNIDCSGRGLTSLEGAPQEVRWDFNCSG
FT                   NRLESLEGGPVGAYINIDCSGNMLSNLIGAPPIVGSFNCSGNQLTTLQGGPMEVAADFD
FT                   CSDNMLDSLDGGPAFVSGKYSCADNQLTSLIGAPAEVGDFDCSGNRLMSLAGCPDVVNG
FT                   DFICGDNDELFTEEEVREACEVRGNVINGI"
FT   gene            complement(620342..620935)
FT                   /locus_tag="Plut_0528"
FT   CDS_pept        complement(620342..620935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0528"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23412"
FT                   /db_xref="GOA:Q3B5G9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23412.1"
FT                   /translation="MKKVLWFDLETTGIDPDRHGIIQFAGLAEIEGVVAESFEIKMQPH
FT                   EGAMIEDEALAVSGFSREQIASFTPHAEAYKAIDGFLARHVSRFERNDKFYPAGYNVRF
FT                   DLDFLSRMFRRYDQYGLGSFINWRSLDPQPILNIMEYMGRLSLPNHKLQTVCEHLGVRL
FT                   ENAHDALSDIKATRELMELLMEHVSIAPFTGLRT"
FT   gene            complement(621050..621667)
FT                   /locus_tag="Plut_0529"
FT   CDS_pept        complement(621050..621667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0529"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23413"
FT                   /db_xref="GOA:Q3B5G8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23413.1"
FT                   /translation="MTEENIGQRIKELRGQKGLSQEELARRIAMPRTAVTKIESGSQEV
FT                   RFRELAKFAEALGISLGTLLEERRPVRESVEDAFLRVSDSAQGYGHIRPELETMLHVIL
FT                   LSAAGDPLLDGRRITETVLEADRMHLAAYGKSISGMPKGSSSEMEHAISTTLANMVKEH
FT                   VLHMVVDRESGARRYLPLMKPDLQELSAAAYVLIEKAVAMTG"
FT   gene            621866..622468
FT                   /locus_tag="Plut_0530"
FT   CDS_pept        621866..622468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23414"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23414.1"
FT                   /translation="MKKGYTHITVILDRSGSMGIIRDDTIGGLNAFVDRQAAEPGDATL
FT                   TLVQFDSGDPYEVRLHFMPIGEVRALNPETYVPRGMTPLLDALGRAINDIECGIAKLEE
FT                   GRRPETVVVAVITDGQENSSTEFTKPQVEKMVGRKSAEGWEFIFLSADLSAIEDAQQLG
FT                   FRQDATALFDKSPEGVACCMEMLSSRVSEKRIAPDDA"
FT   gene            622611..622967
FT                   /locus_tag="Plut_0531"
FT   CDS_pept        622611..622967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23415"
FT                   /db_xref="InterPro:IPR021474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23415.1"
FT                   /translation="MELTGKLVSVLPEQTGNGKNGVWRKQDVVIETEGKFPKKICVSIW
FT                   GDKADRSILQPGAQLKVSFDLESREFNGRWYTDVKAWKVETAGGGKAGGERFAPAEGVY
FT                   DSGPTSYDDGDMPF"
FT   gene            622994..623182
FT                   /locus_tag="Plut_0532"
FT   CDS_pept        622994..623182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23416"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23416.1"
FT                   /translation="MAMHVEIRDGKLCIEIDLEKPTPSSSGKTLVVASTRGNAVTEVKV
FT                   DGKPLTIGLNAYIPRKG"
FT   gene            complement(623218..623592)
FT                   /locus_tag="Plut_0533"
FT   CDS_pept        complement(623218..623592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0533"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23417"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23417.1"
FT                   /translation="MAKVKEVNPTTAFDMTKKGALIVDVREPHEVSRKAFDVADVMLAP
FT                   MSRFSGSMAEIPANRNVIMACHSGSRSIIAARMLAEHGHKRVTNMQYGIAYWERAGLPV
FT                   KKAPKKPPFVWLKKLFGKEG"
FT   gene            complement(623735..623821)
FT                   /gene="tRNA-Ser4"
FT                   /locus_tag="Plut_R0044"
FT   tRNA            complement(623735..623821)
FT                   /gene="tRNA-Ser4"
FT                   /locus_tag="Plut_R0044"
FT                   /product="tRNA-Ser"
FT   gene            complement(623924..625060)
FT                   /locus_tag="Plut_0534"
FT   CDS_pept        complement(623924..625060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0534"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23418"
FT                   /db_xref="GOA:Q3B5G3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23418.1"
FT                   /translation="MSLNPISSMQTPHRHRLSAMIPHRLALVSLLFMIMLSSACLRTAD
FT                   GTERELKIATKHAPPFAMQDEHGKWNGLSIDLITAIAEKQGFRATFVPMSLLDMLEAVN
FT                   RGEVDLAAAALTMTVEREKQLDFSHPYFQSGLAIAVREKEDGWKYALGRLFSPAFLRIL
FT                   GGLSLLLLLSGFLVWLFERRQNPGDFGGGPAEGIWSGFWWAAVTMTTVGYGDKAPKTRP
FT                   GRMVALVWMFTSLIVISGFTAAITTSLTVGSLGSGIQEMDDLYGKKVGTLEASTSSSFL
FT                   EELAIKGQYFPTVKEAMQALEKGQIDAVVYDEPILRYMITSGEIHGVRVVERSFKPEYY
FT                   AFALPPGSPETETLNRNLLGIINSLAWKEIKYKYLREE"
FT   sig_peptide     complement(624929..625060)
FT                   /locus_tag="Plut_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.659 at
FT                   residue 44"
FT   gene            complement(625153..625228)
FT                   /gene="tRNA-Gly3"
FT                   /locus_tag="Plut_R0043"
FT   tRNA            complement(625153..625228)
FT                   /gene="tRNA-Gly3"
FT                   /locus_tag="Plut_R0043"
FT                   /product="tRNA-Gly"
FT   gene            complement(625335..626534)
FT                   /locus_tag="Plut_0535"
FT   CDS_pept        complement(625335..626534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0535"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23419"
FT                   /db_xref="GOA:Q3B5G2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23419.1"
FT                   /translation="MSTTAYSAPDSAGKFGAFGGRFTPETLMQNAAGLEAEYLKAKSDP
FT                   EFQRTLEGLLGDYVGRPTPLYHAEGLSGMLGGAEVWLKREDLCHTGAHKINNALGQVLL
FT                   ARRMGKRRVIAETGAGQHGVATATVCALFNLQCVVYMGEEDIRRQAPNVARMKLLGAEV
FT                   RPVSSGSRTLKDATSEAIRDWMNNPEETFYIIGSVVGMHPYPMIVRDFQAVIGRETRRQ
FT                   ILDKAGRLPDVITACIGGGSNAVGMFYDFLPDAGSIELIGVEAAGEGLDRRHAASLTMG
FT                   SPGVLHGAMTMLLQNEDGQIQEAHSISAGLDYPGVGPEHCHLQELGLVKYTSVTDADAL
FT                   SALRTLAETEGIICALESAHAVRYAITRAPEMAKDKIIIVNLSGRGDKDMGTIMEELNL
FT                   "
FT   gene            626676..629318
FT                   /locus_tag="Plut_0536"
FT   CDS_pept        626676..629318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23420.1"
FT                   /translation="MLLLVCLSILPAAVHAAESAGQDSSSSRYNFAFPEEKTDSLASGH
FT                   DSQGTPSRPVSYAARDSMVYHLDTKIVELWGKGSVADGGTNIRGSKILINRNSSTLTAF
FT                   GKFDSEHVLDEPATFSDAGGSFEGEAITYNFDTQKGKTFKASSVAQNIIFSGNDVTRLP
FT                   DGDLSIKGGSFTTCDDEEPHYWFSASHMHVVPDSRLHAWPLVMYVRPEIFSYRLPALPI
FT                   LPLPYMVFPISSGRKSGLLIPRPGEDGGGFMLSGVGYYWAMNDYMDLRLEGDLHANSDS
FT                   RTAERFRYVKYGDYSGSITGEQKTEGLSKSWYYNMAHTQMVDPTTSLGLNFQFYGGERE
FT                   TDLNSIDSQSIVSEQSNASAYIAKTFDDNNSIASLGYSRSEDLRNSNSSQRISALFFQN
FT                   RLYPYLDAGPDDWHRDLSLSSGVSYIGDFIASGTGTSTDGHILNANTEAGYFHRYSDNF
FT                   SALYTLGLSAQSVVPDTTLSAHAFSGSRLVMPLRMQSSINKHFHLNPALTLNHYEPDAG
FT                   NGDPFSSMVFTLDGTTRLYGRPIGTGFLENLTGMKALRHVFIPTLTYAWNPEYPGTDFY
FT                   DSSYQWADPLRYGRFESPMYTGVAAGQSTIGISLRNLIQGRFRGGEYPSPGAEDGGDYS
FT                   RQLLSLTAATSYNFAAESMPLAPITVLATSNAISDHLLLSTGGMYDYYSFNPATGERID
FT                   RSSSDDGHGLLRFVKGFVNMSVSFEGERKGSAPRPSVRDSGVPFVMNSNQALFLERFNM
FT                   GDFSDIDYGIPWQLRMSMFLYTDHDPNRSYAASSPSSMSLLNAMLRIGLTRNWQVAVNS
FT                   GYDFLNNNVVFPMVQVNRDLHCWQLSFQWVPSGVFKSYSIQIGLKAPQLRDIKFSKKGT
FT                   SLSELKEGI"
FT   sig_peptide     626676..626726
FT                   /locus_tag="Plut_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.948 at
FT                   residue 17"
FT   gene            complement(629364..630242)
FT                   /locus_tag="Plut_0537"
FT   CDS_pept        complement(629364..630242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0537"
FT                   /product="dihydrolipoamide acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23421"
FT                   /db_xref="GOA:Q3B5G0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23421.1"
FT                   /translation="MKETEKDRHFLWQLSEETGAKIRYREYGPSDAAGTPILFLHGYGA
FT                   MLEHWNLNIPEFSGHRRIYAMDLIGFGRSEKPNVRYSLELFAAQIEAFLQLKKLQRIVI
FT                   VGHSMGAASAIWYADHRPEKVEALILANPSGLFGDTMDGMNSVFFGLVGSPLIGEVLFT
FT                   AFANPVGVSQSLAPTYYNQAKVNLKLITQFTRPLQDRGAAWSYLSPSRRPGDFRLDDLE
FT                   KPSHYKGKAFLIWGAEDTALPPHKIIPEFQQLLPQAGAWIIPKAAHCIHHDADEAFNER
FT                   LQAILDSIESA"
FT   gene            630372..630782
FT                   /locus_tag="Plut_0538"
FT   CDS_pept        630372..630782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0538"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23422"
FT                   /db_xref="GOA:Q3B5F9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23422.1"
FT                   /translation="MLQVSRKFEYGLHAVAYLASRGVDRVVTVKEMAEEIGFSPEFLAK
FT                   AMQSLTRAGIASSVQGVKGGYQLARKAESITVADIGTAIEGAPHLVRCVVKADNCEIYS
FT                   SCPHRGYMTSLQNRIQGLLASTTVQALLDTET"
FT   gene            630807..633677
FT                   /locus_tag="Plut_0539"
FT   CDS_pept        630807..633677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0539"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23423"
FT                   /db_xref="GOA:Q3B5F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23423.1"
FT                   /translation="MTNHRLKGSAPAEPSLPDIVLKGITTHNLQNISVRIPRNRFVVLT
FT                   GVSGSGKSSLAFDTLYAEGHRRYVESLSAYVRQFLERMPRPEIEVVEGIAPAIAIEQRS
FT                   IPRNPRSTVGTVSEIYDYLRLLYARIGKIYSRDTNELVLKHTPDDVVMQAGFFLEGTKF
FT                   YAGFLFPSHEDGSHHLCTVDEEISNLLKKGFFRVVSGDTVLDLNSPDDCRKVAMMSEAA
FT                   RRALLVLVDRFVTRHDKKFQSRVAEAAESCFSESGGHAVLQVVGGKTYRFSDRLELNGI
FT                   EYQEPSPQLFAFNSPIGACTTCQGFGRIAGIDEHAVVPDRSLTLAEGAIVCWNSEKYRW
FT                   NLEELLLAAPKAGIPVDVPYEKLSHAEKERIWKGVPGTGYRGIWPFFAEIEKDAGYKMH
FT                   FRVFLSRYRGYAICPDCEGSRLNPDARLVRVSGRNITDVARMNIADAHAFFKNLEISPF
FT                   DRKVAESVIEEIEKRLGYLLDVGLDYLTLDRLTHTLSGGEFQRINLSTSLGSPLVGAIY
FT                   ILDEPSIGLHQSDSARLITLLQKLRDLGNTVVVVEHDREIIEAADEVIDLGPQAGRLGG
FT                   EVVFHGSVEEMKRSGTSMTAEYLQDRRSIPLPEVRRTPDFTACIEINGAMQNNLKNIDV
FT                   RFPLGVMTCVTGVSGSGKSTLVNDILNRGLMREKEGVKDEVGTHRAITGGWQIDRVEHV
FT                   DQSPIGKSSRSNPVTYLKIFDDIRSVFAQTPDARARGWKAGYFSFNIPGGRCEACSGEG
FT                   SVKIEMQFLADIEAVCEECGGLRYKADTLEVKYRGRSIAEVLDMTVEEALVFFAREKSI
FT                   SRKLGVLDEVGLGYIRLGQSSSTLSGGEAQRLKLASFIARADVEHTLFLFDEPTTGLHF
FT                   EDIRKLLGCFSKLLEQHNTLIVIEHNPDIISQADWVIDLGPGAGDRGGQVIGEGTPEDL
FT                   AGMEQSLTGRHLQPLFRRLGKTKKVT"
FT   gene            complement(633684..633983)
FT                   /locus_tag="Plut_0540"
FT   CDS_pept        complement(633684..633983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23424.1"
FT                   /translation="MNMQEEIESRLQSLVGKVAMEKLDSILSKIKDDTATSIDREHAAI
FT                   LREIQALAKNRLSVEVNESGFRRGDEVWVERTSESHFPHIRLHGGALEDDPILD"
FT   gene            634140..634427
FT                   /locus_tag="Plut_0541"
FT   CDS_pept        634140..634427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0541"
FT                   /product="chaperonin, 10 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23425"
FT                   /db_xref="GOA:Q3B5F6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23425.1"
FT                   /translation="MNLKPLADRVIVKPAPAEEKTKGGLYIPDTGKEKPMYGEVVAVGA
FT                   GKMSDSGQLLAMPVKAGDKVLYGKYSGTEVSVEGEDYLIMRESDIFAILA"
FT   gene            634475..636118
FT                   /locus_tag="Plut_0542"
FT   CDS_pept        634475..636118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0542"
FT                   /product="Chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23426"
FT                   /db_xref="GOA:Q3B5F5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23426.1"
FT                   /translation="MTAKDILFDADARAKLKVGVDKLANTVKVTLGPAGRNVLIDKKFG
FT                   APTSTKDGVTVAKEIELDDAIENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGL
FT                   KNVAAGARPIDLKRGIDRAVKEVVAELRNISRSISGKKEIAQVGTISANNDPEIGELIA
FT                   EAMDKVGKDGVITVEEAKGMETELKVVEGMQFDRGYLSPYFVTNSETMEAELEDALILI
FT                   HDKKIGNMKELLPILEKSAQSGRPLLIIAEDIEGEALATLVVNRLRGTLKVCAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEEKGYKLENATVNYLGQAARITVDKDNTTIVEGKGTQD
FT                   EIKARINEIKGQIDKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDA
FT                   LHATRAAVQEGIVVGGGVALIRAIKGLSNAIADNEDQKTGIDIIRRALEEPLRQIVANT
FT                   GTTDGAVVLERVKQGEGDFGFNARTEQYEDLVAAGVVDPTKVTRSALENAASVASILLT
FT                   TEACITDIKEDKSDMPAMPPGGMGGMGGMY"
FT   gene            636237..636920
FT                   /locus_tag="Plut_0543"
FT   CDS_pept        636237..636920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0543"
FT                   /product="ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23427"
FT                   /db_xref="GOA:Q3B5F4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23427.1"
FT                   /translation="MKAVLLLSGGMDSLVTTAIAHREGYELAAMHVNYGQRTWQKELQS
FT                   FRSIADHYSITERLEVNADFLGRIGGSSLTDHSMPVAGADLRGSGIPTSYVPFRNACFL
FT                   SMAVSWSEVIGAERLFIGAVEEDSSGYPDCRRVFYDAFNRVIELGTRPETGITILTPLI
FT                   AMQKAQIVRNGMELGAPFEHSWSCYRSEGRACGVCDSCARRLRAFELQGIRDPIDYEVR
FT                   PQYID"
FT   gene            636974..637615
FT                   /locus_tag="Plut_0544"
FT   CDS_pept        636974..637615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23428"
FT                   /db_xref="GOA:Q3B5F3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5F3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23428.1"
FT                   /translation="MSSLPLALGLVVLIWLSGLAGHFTPLQEWPALALYVIGSIGLAIF
FT                   LGRNGGWESIWLSGGQLRRSLFWGGLAGLVLFVMDITNTVLYYKNGGAPMVEMQVLLVH
FT                   RSLLYLFPVLILAEEFLWRGVLFSAMIGRGMNPHLTVALTTLLYALNHFAVAPVGMLER
FT                   AMMAMMAFPIGILGGYLVLKTRNVWGSVLVHMITMISMVLDIFVIPQMLF"
FT   sig_peptide     636974..637036
FT                   /locus_tag="Plut_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.820) with cleavage site probability 0.633 at
FT                   residue 21"
FT   gene            637627..638439
FT                   /locus_tag="Plut_0545"
FT   CDS_pept        637627..638439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0545"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23429"
FT                   /db_xref="GOA:Q3B5F2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23429.1"
FT                   /translation="MTQKKENRITARLREDRKLLLAYYMPEFPVAGSTLPVLEALQDGG
FT                   ADIIELGIPFSDPVGDGPVIQNAAHIAIRNGVSVRSLLELVRKARAGEGCRKITVPILL
FT                   MGYSNPLIAYGGDCFLHDAVKAGVDGLLIPDLPPEESADFLQRAKSLGLTVVYLISPVT
FT                   PPERIEWIDSLSTDFSYCLAVNATTGTAKLADASTEASVDRYLERVRLHARKKFVVGFG
FT                   IRDRARVEHMWRLADGAVVGTALLEHIAGAPNPGEAARRAGEFWRGLR"
FT   gene            638436..639482
FT                   /locus_tag="Plut_0546"
FT   CDS_pept        638436..639482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0546"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23430"
FT                   /db_xref="GOA:Q3B5F1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23430.1"
FT                   /translation="MTGPEERPPVIAGRPSVDIIIPHYLQRDMLERCLGSLALTDYPGM
FT                   GIIVIDNGGFLAGLDALVAAYPAARLYRLGENRGYAGGCNEGLKHSRAEFVVFMNDDTV
FT                   VRDPLWLNHLVDEALCHPGAAAFQPKLLSMKRVVGPRRMFDYAGAAGGMIDRLGYPYCL
FT                   GRTITGSETDRGQYDAPRSIFWASGAAMFARREAIEGVGGFDEDFFMHMEEIDLAWRLL
FT                   LAGWSVRSAPAAEVFHEGGASLGEGSPEKIYFNHRNNMLMLLKNRSTGGLFRILPLRYL
FT                   LEFAAVLYYLPHAPEGRRKAAAVFRAMRDAFLQLPLTLRKRRHVQSSRKVGERVVFSGM
FT                   PFFQLLRR"
FT   gene            complement(639497..640540)
FT                   /locus_tag="Plut_0547"
FT   CDS_pept        complement(639497..640540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0547"
FT                   /product="Nucleoside-diphosphate-sugar epimerases-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23431"
FT                   /db_xref="GOA:Q3B5F0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5F0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23431.1"
FT                   /translation="MTTPRTISVTGASGYIASHIIEQLLKEGYGVRGTVRRTASAYPWL
FT                   TALKGAAERLELFSADLLEAGSFERALSGCDTLLHTASPYVINVNDPEHDLLAPALEGT
FT                   RNVLSACQRAGTIRRVVLTSSIAAVTDEPDSRHTFTEADWNSRSSLGRNPYHYAKTMAE
FT                   RAAWEFMEREKPGFSLVVLNPTLVTGPSLGPGVNTTNGILRDILTGVYPGIMDMNWGFV
FT                   DVRDTAAAHILAMNTPEARGRYLCSSGELTMHEVVDLLRQNGYSGYRLPKIDLSSKAGT
FT                   ALMKMLSYTQPKDTGTFIRTHIGRAIHISNEKIRRDLKMTFMPPEKSILDAVGDMISQG
FT                   HLADKKS"
FT   gene            complement(640552..641115)
FT                   /locus_tag="Plut_0548"
FT   CDS_pept        complement(640552..641115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23432"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23432.1"
FT                   /translation="MQNKPQSIDSFVPTHPLPGILRAGEATVQLRFLENDILGVSGAIL
FT                   VNAPPALLWHALTEYDNLHNTLPKVVQSRLVSRQQGSVVLEQTGKTGIFFFEITVRFRL
FT                   KVREDPFNAIAFEQVDGDFSIYRGSWKLEPVEDGIRTLLSYSAEIRPDFFAPSFLVGFV
FT                   QRQDLPEILKAHKKRAESLWKEQQ"
FT   gene            641292..642266
FT                   /locus_tag="Plut_0549"
FT   CDS_pept        641292..642266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0549"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23433"
FT                   /db_xref="GOA:Q3B5E8"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23433.1"
FT                   /translation="MLLFLFAVVLGLAILVWSAERFVEGSAALADHFGLPPLLIGMVVV
FT                   GFGTSAPEMAVSALASIEGNPDLAIGNAYGSNITNIALILGLTALISPINVESKILRKE
FT                   LPVLGAITALAAFQLRDGYLSGVDALVLLGVFALMLTFTVVAGLYKKSDALADEIDLEL
FT                   DIHAMPLSRSLFFLGIGLVLLVLSSRMLVWGAVGIAAELGVSNLIIGLTVVAVGTSLPE
FT                   LATSVVATRKGAHDIALGNVLGSNIFNTLMVVGLAGVIHPFAIQPEVFLRDIPVMAILT
FT                   VSLFIFGFGFSRQGRINRVEGAVLLGCYIAYTVYLVVSSFQHG"
FT   sig_peptide     641292..641348
FT                   /locus_tag="Plut_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.897) with cleavage site probability 0.680 at
FT                   residue 19"
FT   gene            complement(642283..643662)
FT                   /locus_tag="Plut_0550"
FT   CDS_pept        complement(642283..643662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0550"
FT                   /product="Cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23434"
FT                   /db_xref="GOA:Q3B5E7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23434.1"
FT                   /translation="MDTTGKKQRVALSSVAASALLTLMKAVVGIMTGSIGIISEAAHSM
FT                   LDFGAAALTWYAVRMSGKPADRKHHYGHAKVESVTALIEAGLLFVTSLWIIYAATERLI
FT                   SGTTEIDVTWYAIAVIVLSIVVDISRAGALNKVAKETGSQALEADALHFTSDILSSAVV
FT                   LAGLGFVRLGIGWADAAAGIAVALLVAKAAFTLGKKTIDVLTDAAPEGIADRVEEITRK
FT                   IEGVIDIDKIRVKPTGPQVFIEMSVTLSRTLSAENARRICTDIEERIHREFPVADMTIN
FT                   TRPVALTGESIAERVHVTGLNHGLHAHNIATGFNDGVSHVTFDVEIEQTLTIREAHDAV
FT                   SALEHDLHRELDGNLEICIHIDPLRSTERPTAPVPETEAASLRTLISAAADHIEAIEDV
FT                   HDITLLKTEAGKLFITLHCSFPGDKPLEAVHTATSRLEGAIYHAIPEAGKVVIHAEPLA
FT                   G"
FT   sig_peptide     complement(643576..643662)
FT                   /locus_tag="Plut_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.876) with cleavage site probability 0.476 at
FT                   residue 29"
FT   gene            complement(643694..644908)
FT                   /locus_tag="Plut_0551"
FT   CDS_pept        complement(643694..644908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0551"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23435"
FT                   /db_xref="GOA:Q3B5E6"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23435.1"
FT                   /translation="MEKGAGIIVEQDRSTTAEGRMVELVERKGIGHPDTICDSVMEAAS
FT                   LALSKAYREQFGRILHHNLDKGLLIAGRTAVKPGGGRVLEPMKMIFGDRATSLHRGVKI
FT                   PVGEIVEAAAQSWLQHNLRFVDPLRHITFQNEIKPGSDELTDLFSRQLRGANDTSAGAG
FT                   YAPLSATELMVLQMERFINSSGFKKRFPESGEDVKVMGFRNAGQLTLTVAMAFVDRHIS
FT                   GVEDYFMRKSAILEVLRQFAIEQDHPFEGIQVDFNTLDDPSRGTGGMYLTVLGTSAEGA
FT                   DGGEVGRGNRVNGLIAFGRPLSLEAAAGKNPVNHTGKIYNILAFEIARRIHRETEAVLE
FT                   VSVFLCSQIGRPLSSPLAASARVVLQGKTSIEEVRGAITGIMEDELARVEDFTRKIAEG
FT                   AFPVC"
FT   gene            645082..646233
FT                   /locus_tag="Plut_0552"
FT   CDS_pept        645082..646233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0552"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23436"
FT                   /db_xref="GOA:Q3B5E5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023881"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23436.1"
FT                   /translation="MKIGISCHHTYGGSGAVATELGKALASKGHTVHFFSQGAPFRMGS
FT                   FSPNIFYHEVEAMHYPLFDCPFHSLALASKIAEVAWYEELDVVHAHYAIPHAMSAMLAR
FT                   QMLEDRCPDASCFRLATTLHGTDITVVGADSSMQAAVRLVINKSDGVTAVSEYLKDETV
FT                   RMFLPKKDIAVIPNFVDTSLFTRSVNPDLRKELGLGSGKTVIHISNFRPVKCIGDIVKV
FT                   FHGLVDSIDATLLLVGDGPERSEAETQVRRLGITSRVRFLGKINEIVPLLSVSDLMLMP
FT                   SNAESFGLAALEAMACGVPVIGTDVGGFPEFIEDGRHGFLCRPGDVASMTGRARQLLSD
FT                   GGMWHAFSDACVLQARRYETALLVDRYEAFYRELMQEGKRKSP"
FT   gene            complement(646268..647305)
FT                   /locus_tag="Plut_0553"
FT   CDS_pept        complement(646268..647305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0553"
FT                   /product="Cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23437"
FT                   /db_xref="GOA:Q3B5E4"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23437.1"
FT                   /translation="MPAMSLFNSLFRDIAIDLGTANTLIFIRDQGVVLNEPSIVARDRN
FT                   TGKVVAIGHDALLMHEKTHPGIVTIRPLASGVIADYEATEELIKGLINKTKSKFSFGIR
FT                   RMVIGIPSGITEVEKRAVRDSAEHVGAKEVYLIAEPMAAAIGIGLDVKEPMGNMIVDIG
FT                   GGTTEIAVISLGGIASGESLRVAGTDITSTIIRHFRKAYNLAIGERTAEDVKIKIASAY
FT                   KLDKEMTMTVRGRNLVTALPEEREVNSPTIREAIATPISQIITSIKKSLEVTKPELSAD
FT                   ILDRGLFLAGGGALIKGLDKKINEETKLAVHISEDPLTAVARGTGEVLENLDKYRSVLI
FT                   STKRY"
FT   gene            647524..648855
FT                   /locus_tag="Plut_0554"
FT   CDS_pept        647524..648855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0554"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23438"
FT                   /db_xref="GOA:Q3B5E3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23438.1"
FT                   /translation="MSPVHYRTSTSTIVAVLKLYRFLDDRDALFRQIGRSVDFDPEVQR
FT                   AVTDILEAVRLRGDMAVLEYTERFQGAVLTSMQVPEEDILRAREEADPAFIRVLEEAWE
FT                   NILRFHRHEVENSFFYEGEGGVVLGQRVTPMDRAMLYVPGGKASYPSSVLMNAAPARVA
FT                   GVGEIFMTTPCDASGAVSPHILAAASVAGVTSVYRLGGAQAVAAFAYGTQTIPKVDIIT
FT                   GPGNKYVALAKKQVFGHVAIDSIAGPSEVVVVADDDADAEFITMDLFAQAEHDPDASSV
FT                   LITPSMRLAEEVRDLAAARVGSMLRGEVIAEALSNNGAIVVVADIEEACRVSDMIAPEH
FT                   LELHVLHPWELLASIRHAGAVFMGGYSCETVGDYYAGPNHTLPTNGTARFFSPLSVRDF
FT                   VKHTSIISYTRRQIMACGERIASFADHEGLEAHAEAVRARLKKG"
FT   gene            648852..649877
FT                   /locus_tag="Plut_0555"
FT   CDS_pept        648852..649877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0555"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23439"
FT                   /db_xref="GOA:Q3B5E2"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23439.1"
FT                   /translation="MRVADFDYPLPEERIAKYPPLQRGSTRLLVICREGGTVSHARYRE
FT                   LDTFLRKGDLLVLNNTRVVKARLMAEKSTGAAIELMLLEKHGQEQSLVLFRGRVKQGDR
FT                   LRSHGHEFLVEEIVDHGVARLSLPEGRSIQPVFEAHAEVPIPPYLRRPAEPVDRERYQT
FT                   VFAEHAGSVAAPTASLNMTPELLLRLRDGGVETSSITLHVGLGTFLPIRVDSMEEHVMH
FT                   REFYSIPAATIEKIRATKASGGRIIALGTTVTRALEHAALSLSGHSGPGPLEGEADIFI
FT                   YPGCSFRLIDALLTNFHAPRSTVLMLTAAFAGPDLLRRAYREALDKEYRFLSYGDSTLI
FT                   L"
FT   gene            650154..652724
FT                   /locus_tag="Plut_0556"
FT   CDS_pept        650154..652724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0556"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23440"
FT                   /db_xref="GOA:Q3B5E1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23440.1"
FT                   /translation="MSLVNKYRAHTQERAQLGIPPLPLSAAETRELVELLKASAPQEKE
FT                   YLLELFTEHVSPGVDDAALEKAAFLDAIVKGEVSCSVISALAAVGILGTMLGGYNVKPM
FT                   IDALSSSDSAVAAEAAAMLKKTLLVYDSFDVVVGLAKTNRYAAEVLESWANGEWFTSRP
FT                   ELPEKVTLTVFKVPGETNTDDLSPASEAFTRSDIPLHALSMLGSKMDDPIGTIAKLKEK
FT                   GHPLAYVGDVVGTGSSRKSGINSVQWHLGQDIPAVPNKRTGGVVIGSIIAPIFFNTAED
FT                   SGALPIQADVTSMETGEVIVVYPAKGIIEKSGLEIARFSLSPNTIADEVRAGGRIALII
FT                   GRTLTAKARKALGLGEIDIFSTPEQPADSGKGYTLAQKMIGKACGLPGVRPGMYVEPET
FT                   LTVGSQDTTGAMTRDEVKELAALSFSADLFMQSFCHTAAYPKPSDVKLHRSLPYFVMSR
FT                   GGVALRPGDGVIHTWLNRMVLPDTLGTGGDSHTRFPIGVSFPAGSGLVAFAGVTGTMPL
FT                   NVPESVLVRFTGELQDGITLRDLVNAIPYVAIKKGLLTVEKKGKKNVFAGRVLEIEGLP
FT                   KLKVEQAFELSDASAERSAAACTVRLDKEPVIEYLSSNVKLLEQMIENGYGDPDTLRRR
FT                   IGKMQEWLKNPTLLEPDADAEYAEVIEVNMSEITEPILACPNDPDDVATLSEVLLDESR
FT                   PKQINEVFVGSCMTNIGHFRALGEVLRGRGPASARLWVVPPTKMDMNQLIAEGYYSVFG
FT                   AAGARTEIPGCSLCMGNQARVADNAVVFSTSTRNFDNRMGAGAQVYLGSAELAAVAALL
FT                   GHLPDKDEYLEVVGRNLSGEKRNDIYRYLNFHTVKAEEMSMLMD"
FT   gene            652871..653065
FT                   /locus_tag="Plut_0557"
FT   CDS_pept        652871..653065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23441"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23441.1"
FT                   /translation="MKKLFIFLFLLSSVSFVGCAKTEAPAPEAPATEEAAPAVEEAAPA
FT                   VEEAAPAAEEAAPAAEEAK"
FT   sig_peptide     652871..652933
FT                   /locus_tag="Plut_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.869 at
FT                   residue 21"
FT   gene            complement(654403..655311)
FT                   /locus_tag="Plut_0559"
FT   CDS_pept        complement(654403..655311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23442"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23442.1"
FT                   /translation="MGSRFIFQVSISRNTLNPTLMKKFIPLSILLATLGATNAQADGQD
FT                   TPPQATTNAPSWVTSWDVTVPCPVYVSENQADNIFFEGGFDYQDARKTVDGALGYRHLM
FT                   SDNKVMLGANVLYSHEFPRNHQRISYGAEIRTSVFEINSNYYHRLTDWKLTGVDNNEEK
FT                   ARGGYDVELALAVPYVPSAHFRVKHFCWNGIASNDSNNPIDDLKGNTFSVSGSVYDGLS
FT                   VEVGYIDYTSGNADYSKAGGERFLKVSYNFDIFGTHVNKATKPRFSNTPYEFERMDDRR
FT                   FEKIRFEQKVISAHNNEQPPA"
FT   sig_peptide     complement(655186..655311)
FT                   /locus_tag="Plut_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 42"
FT   gene            complement(655439..655511)
FT                   /gene="tRNA-Gln2"
FT                   /locus_tag="Plut_R0042"
FT   tRNA            complement(655439..655511)
FT                   /gene="tRNA-Gln2"
FT                   /locus_tag="Plut_R0042"
FT                   /product="tRNA-Gln"
FT   gene            complement(655593..656486)
FT                   /locus_tag="Plut_0560"
FT   CDS_pept        complement(655593..656486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0560"
FT                   /product="permeases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23443"
FT                   /db_xref="GOA:Q3B5D8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23443.1"
FT                   /translation="MFDLAFLLAPTFATFAIGILLRKLGVLDTVAIDSLFKIIYNLALP
FT                   ALLLSVLPFVSLEPGMLFLPLSAIIIIMLSAGGAAVSGRLLHLENKTEGVLFAGSIIMN
FT                   LGFVVPFVKSFYGDEGLARLFVFDLPNSLSAYTIAYGFACRGNGAGSLAIARKIALSPP
FT                   VWALMAGLFLNLASHRPGPIEAGIINSLSALAVPLLLLALGASARFAKVRMKDIIAGIG
FT                   VRMVLGLAAGFLLADLFNLRGLDRAILIIAASAPAGFNTLTFAAIENLDRDYAASLVTT
FT                   SMLLSLLLIPILLTIL"
FT   gene            complement(656539..656615)
FT                   /gene="tRNA-Arg4"
FT                   /locus_tag="Plut_R0041"
FT   tRNA            complement(656539..656615)
FT                   /gene="tRNA-Arg4"
FT                   /locus_tag="Plut_R0041"
FT                   /product="tRNA-Arg"
FT   gene            complement(656666..656739)
FT                   /gene="tRNA-Glu2"
FT                   /locus_tag="Plut_R0040"
FT   tRNA            complement(656666..656739)
FT                   /gene="tRNA-Glu2"
FT                   /locus_tag="Plut_R0040"
FT                   /product="tRNA-Glu"
FT   gene            complement(656769..656842)
FT                   /gene="tRNA-Met3"
FT                   /locus_tag="Plut_R0039"
FT   tRNA            complement(656769..656842)
FT                   /gene="tRNA-Met3"
FT                   /locus_tag="Plut_R0039"
FT                   /product="tRNA-Met"
FT   gene            complement(656931..658205)
FT                   /locus_tag="Plut_0561"
FT   CDS_pept        complement(656931..658205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0561"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23444"
FT                   /db_xref="GOA:Q3B5D7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23444.1"
FT                   /translation="MDKLVITGGKRIEGEITASGSKNSSLPIIAATLLSGSGTFTLHRI
FT                   PDLQDITTFRQLFDHLGAETAFSHNTLTITTANVQSVLAPYELVKKMRASIYVLGPLLA
FT                   RFGHARVSLPGGCAFGPRPIDLHLMAMEKLGARITIETGFIDAVAEGGRLKGATIDFPV
FT                   SSVGATGNALMAAVLAEGTTIIRNAAAEPEIEALCHFLQAMGADIRGTGTTELIIHGCD
FT                   SLRHVEFSNIFDRIEAGTILAAAAITGGSVTIRGVIPSHMESVLQKFSDAGCRIETTDD
FT                   TVILKSTGRLKATDITAEPFPAFPTDMQAQWMALMTQAEGTSEITDHVYHERFNHIPEL
FT                   NRLGAHIDIEGNRAVVHGPQALSGTKVMSTDLRASASLVLAGLVAEGTTEVLRVYHLDR
FT                   GYERIETRLQNLGAEIKREKYSEFG"
FT   gene            658423..659820
FT                   /locus_tag="Plut_0562"
FT   CDS_pept        658423..659820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0562"
FT                   /product="Membrane-bound metallopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23445"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23445.1"
FT                   /translation="MSIERRQPIPLNVTESSIPGRFRPFSFSHSAARLFVLSVIFFLFH
FT                   LAAFPPAAYGATAGELSKIKRERQDVERTLINLKKELDVYQKKLNATKRQETTSLRRLK
FT                   TLQNKITALGELIRENQRYLAVLDRDIDRLEGQFKENRQVYGRVSSAFGRTAVAVYKYG
FT                   VDREMENVFAARSVNDAIVKAQYIGFFAQAVHGHVDTLQQVARELEHNRAELEKSYRAK
FT                   AEAVKDQERQLKNYAASKSEKETALVKLKEEKAAYTEKVLAARRKRRQLQGRIEALIRA
FT                   EQRAIEAEQARRLAAQPAPQKAPAPGKAPAPAAGRRVPPPPDSPELRKVSADFDRAFGQ
FT                   LPWPVANGRVSQRFGSVTDAELKIVTTNNGIDIAVPAGTPVKAVSGGKVAQIAFMPTFG
FT                   NIVIIRHPNSYLTVYANLGDLRVTKNDLIASQQLIGLSGRNPDGGSVVHLEIWKAGVKQ
FT                   NPEKWLR"
FT   gene            659825..660373
FT                   /locus_tag="Plut_0563"
FT   CDS_pept        659825..660373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23446"
FT                   /db_xref="GOA:Q3B5D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23446.1"
FT                   /translation="MQGGLKQLFGAMVAVLFRYRRFWLELKAGAWPEGLDVQRAYAVPV
FT                   IAMVQLLKFPLIGVPRPAMFFAIASFIIDMAAFYVLSGATSRILFQEKAGEMEGGVVTV
FT                   LSYAMTPVWLFELFYFTGSWSWIFALLALGHMLLISSSGFSSLFSLSGRSMKTAALFAG
FT                   VLQASVFVLYMSLVRLFNF"
FT   gene            660387..661220
FT                   /locus_tag="Plut_0564"
FT   CDS_pept        660387..661220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0564"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23447"
FT                   /db_xref="GOA:Q3B5D4"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23447.1"
FT                   /translation="MQPQDLDLNYGLLEDILKAFLQNEIRKFGFSSVVLGLSGGIDSAV
FT                   VAELAVRALGPEHVLALKMPYKESSRESLEHADLMIRRLNIKAEERPVTPMADDFFRDV
FT                   PEGERLRRGNIMARTRMVLLYDVSARDGSLVAGTSNKTELLLGYGTMFGDMASAVNPLG
FT                   DLYKTQVRGLARHLGIPSILIDKAPSADLWEGQSDESDLGFSYGEVDLLLYMMLELRME
FT                   REAILGEGVSASFYDRVRKMVVRNQYKRLMPVIAKISGRTPGIDFRYARDWQEVR"
FT   gene            complement(661264..662877)
FT                   /locus_tag="Plut_0565"
FT   CDS_pept        complement(661264..662877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0565"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23448"
FT                   /db_xref="GOA:Q3B5D3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23448.1"
FT                   /translation="MRHLTPMTEEIKTDVLVIGSGIGGLYFAIHMADHAKVTIITKKES
FT                   STSNTNWAQGGIAATIDQNDSTEYHVADTLDAGAGLCNQGMVETMVREGPRHIQRLISL
FT                   GVQFTTSDHDHLHLGKEGGHSRSRIVHAQDLTGREVETALLNRVNSHPNITLLEHHFAI
FT                   ELITEHHRGIKTNDITCYGAYVLDSLQRKPKKILAKITMVASGGLGHVYPHTTNPDIAT
FT                   GDGVAMAYRAGAEIANMEFIQFHPTSLYHPKAKSFLISEAVRGFGGILRLKNKEAFMHK
FT                   YDKRENLAPRDIVARAIDSEIKKSGEECVFLDVTHIEAEKTIEHFPNIYETCLEFGIDM
FT                   TKEMIPVVPAAHYSCGGIRTDDRGRTTLNRLYACGETSCTGVHGANRLASNSLLEALVF
FT                   AWRSYEQIQTELHSIQNSVSFPDWDDSGTVNPEEWILVSHNKREAQQVMNDYVGIVRSD
FT                   LRLQRAQRRIDFLKEETESYYKKTKITTQTLELRNIIKVASLIIEGAIKRRESRGLHYT
FT                   TDYPETDDRHFHLDTVLRSF"
FT   gene            complement(662982..663602)
FT                   /locus_tag="Plut_0566"
FT   CDS_pept        complement(662982..663602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0566"
FT                   /product="DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23449"
FT                   /db_xref="GOA:Q3B5D2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23449.1"
FT                   /translation="MPMPLSEALLHIGSLDELILQGGYLLLFLLVFAETGLFAGFFLPG
FT                   DSLLITAGLIAASGQLELSLVMITLASGAVLGDLTGWLIGKHLGRRLFMKSDSRFFHRE
FT                   HLEKTEAFYQKHGPKAVFLARFIPVVRSFAATLAGVTGMPLASLLFFSIAGSTVWVSIF
FT                   TLIGYFVASLFPELVTWVHAIIVVGILVILASAIKQLAPPRKA"
FT   gene            complement(663701..664246)
FT                   /locus_tag="Plut_0567"
FT   CDS_pept        complement(663701..664246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0567"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23450"
FT                   /db_xref="GOA:Q3B5D1"
FT                   /db_xref="InterPro:IPR002724"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23450.1"
FT                   /translation="MSFVPSKVFFTKGVGRHKEYLSSFELALRDAKIEKCNLVTVSSIF
FT                   PPKCERVSVEEGVKMLTPGQITFAVMARNSTNEYNRLIAASIGVAIPADDTQYGYLSEH
FT                   HPFGEDAEQSGEYAEDLAATMLATTLGIEFDPNKDWDEREGIYKMSGKIINSYNITQSA
FT                   EGENGMWTTVISCAVLLP"
FT   gene            complement(664357..665574)
FT                   /locus_tag="Plut_0568"
FT   CDS_pept        complement(664357..665574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0568"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23451"
FT                   /db_xref="GOA:Q3B5D0"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23451.1"
FT                   /translation="MSFPSLQEQLDIITANTVEIISSAELEQKIQHSIKTGAPLKVKLG
FT                   ADPSRPDLHLGHSVVLRKLREFQDLGHEAILIIGDFTAMIGDPSGKSKTRPQLSAEEAR
FT                   ENGASYFEQASKILDPHKTTICYNADWLGNMTFADVIRLSSHYTVARMLERDDFERRYR
FT                   SSEPISIHEFLYPLAQAMDSVHLRNDVELGGTDQKFNLLVGRDLQREYGILPQVCITMP
FT                   LLVGTGGEDKMSKSLGNAVCFNDLPSDMYGRVLSIPDTLIENWCRLLLPLTGEGRRAIL
FT                   EGWEEDPRTAKRRLAREIVMQYYSAGEAGAAEEHFDRLFVHKQAPTEIELTRFSEPELP
FT                   LVDLLTTLGAAASKTDARRMIQQNAVSIDEEKITDVKTIITLSDEPKTLKAGKRKFFRI
FT                   ATAGNS"
FT   gene            complement(665600..666073)
FT                   /locus_tag="Plut_0569"
FT   CDS_pept        complement(665600..666073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0569"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23452"
FT                   /db_xref="GOA:Q3B5C9"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23452.1"
FT                   /translation="MAKKQQTRSYTEAIQNRKARYEYQILETIVAGIELLGSEVKSVRL
FT                   GKASLNESFATIHHDEVWLENMQITPYEFNHLDALEPKRSRKLLLHKEEIRRLQSKINE
FT                   KGLTLIPLKAFFDKNGRLKVELALAKGKKLYDKRETIKGRENERHLQQLRKQY"
FT   gene            complement(666082..667569)
FT                   /locus_tag="Plut_0570"
FT   CDS_pept        complement(666082..667569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0570"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23453"
FT                   /db_xref="GOA:Q3B5C8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23453.1"
FT                   /translation="MIHKQDPASIQSYLEDTSNLKTGHTEGVYIPETPEEISALLREAA
FT                   ALGRRYTISGNGTGTTGGRIPLGGHVISMEKLNAIGEPRQTEPGKAIMRVQAGAMLADV
FT                   QKKAEAAGWFYPPDPTEKLCFIGSTIANNSSGARSFKYGATRRHIERITILLPEGDMLS
FT                   LQRGEHRADAQGIFRLELPSGEHREFHRPRYRMPGTTKHNAGYYTAERMDLIDLFIGSE
FT                   GTLALILEADLMLIPLPERLISAIIYFQELDGLMGFTGALRAIEGPRRPRALELFEKNA
FT                   LGFLRQKYPDTPGDTAGAVFLEQETTTGAEDEDLEALFSIVEEHGGMAEESWIALDREE
FT                   QDRMREFRHSLPLLVNEWLSRQAESKVSTDMAVPFPRFRELFDFYRTACEQHGFVYIIF
FT                   GHIGDGHVHLNILPRSHLEFIEAKALYLEFIAKVLELGGTLSAEHGIGKLKSGYLAAMY
FT                   GEEGLREMAALKRTFDPFQVLNIGNIIPVEYLENRNK"
FT   gene            complement(667559..669463)
FT                   /locus_tag="Plut_0571"
FT   CDS_pept        complement(667559..669463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0571"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23454"
FT                   /db_xref="GOA:Q3B5C7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23454.1"
FT                   /translation="MDRLQHSTRIVSILIVTIFAVLLGRLFWIQVLDFQKLGSISSSNS
FT                   IRRVWIQPPRGRIIDRNDIIMVDNRPLYSVKVIPAEFNDSGTEALAWLIRRPMEEVAEK
FT                   IERGRNFNRFSAVTLRRDLESQDVERLGENLWELPGVLIEAENKRKYADSRYGAHLFGY
FT                   LRQIARKDVAELVLQGYAQDDKIGFSGLEKQYEDRLKGTKGARFEMVTPLGRYAGKYDD
FT                   GRSDIPAVRGDDLYLTIDSGLQQLAGELLEATGKSGAIIAIDPSTGGILALESAPGYDL
FT                   ETFNGATDPDGWRAIISDPRKPLFNRTVQAVYPPGSIYKMVLAMAALEGNRIDPEQKVL
FT                   DNGVFTYGRRRFLSHGGRGHGWVNMRRAITVSSNLYFYRLIFDVGFAEWTRYGAMFGFG
FT                   TETGIDLPGERSGLLPSTAYYDRRYGKGRWTKGYLVSLAIGQGELGATPVQLAAYAAAI
FT                   ANGGTLHQPHIASGYRDTETGRFVPLPSLSRPVPVSEASFRLIRESMEEVVREGTGQLA
FT                   AVPGVRVAGKTGTAQNPGGKDHAWFIAFAPVDNPKIAIAVLAENAGFGGTISAPIAGKL
FT                   IQHYLHPVLPSPPAADSLTVSGPTPETSPDSLGESLPVIETAPPPPEAATAEPAPHDP"
FT   gene            complement(669467..669958)
FT                   /locus_tag="Plut_0572"
FT   CDS_pept        complement(669467..669958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23455"
FT                   /db_xref="GOA:Q3B5C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23455.1"
FT                   /translation="MARNIFVLLFVLLIVCILQVLGFSRLTLLHTAPDAIALFLGFSAV
FT                   TLGRNAGTGFGFLGGMLCGLMTGDMGLHMLAGTTGGFMAGSFHIPRDSHATPSQKMRRI
FT                   YGATAAAAFVSHTVLAIGLNPLGLSPLYRIVVLGFLATLFTLVLAFAANLLILKNTISD
FT                   "
FT   sig_peptide     complement(669890..669958)
FT                   /locus_tag="Plut_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.743 at
FT                   residue 23"
FT   gene            complement(669999..670799)
FT                   /locus_tag="Plut_0573"
FT   CDS_pept        complement(669999..670799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0573"
FT                   /product="rod shape-determining protein MreC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23456"
FT                   /db_xref="GOA:Q3B5C5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23456.1"
FT                   /translation="MLSGISLIITAIEQNDVPSKVAVAGYNLRGYVAERIQSLGHLLHM
FT                   KEENNRLLAQNSRLLARLLVAETALQRQSALEHIHAATPPAMQGFKTARVIDRTFSERE
FT                   NMLLVDKGRNDGIRKDMTVLTPDGLVGRVVSVSAHYASIMPLIHSDFKVSVVSAETRTT
FT                   GLVSWDGGRADMANVEHIPISSSLAKGEELLTTDFSTFAIAGLPVGRVTSVMPGRLFSM
FT                   VTMKPAVDFSRLDYVLLAPLNNEPEKLRMLGTPGPGKRDPLTKQ"
FT   gene            671028..671399
FT                   /locus_tag="Plut_0574"
FT   CDS_pept        671028..671399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0574"
FT                   /product="chaperonin, 10 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23457"
FT                   /db_xref="GOA:Q3B5C4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23457.1"
FT                   /translation="MNISKFVVVGDRVLVKPKSLEEQTKSGIYLPPGVQEKEKIQSGYI
FT                   LKAGPGYPVAPPSAEEPWKESVSSTQYIPLQARVGDLAIFLQASSHEIDYDGERFLIVP
FT                   NAAILLLVREDDDLEYYLK"
FT   gene            671401..672366
FT                   /locus_tag="Plut_0575"
FT   CDS_pept        671401..672366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0575"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23458"
FT                   /db_xref="GOA:Q3B5C3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23458.1"
FT                   /translation="MNTSHAGSEPEAFSTTGLQERVRALKKEMHAVILAHYYTLPEIQE
FT                   VADIVGDSLALARAAETVDAEVIVFAGVYFMGETAKILNPSRTVLMPDRNAGCPLADSC
FT                   PEEEFAEFRRRHPGAVAITYINSTAATKAQSDITCTSSNALSIVRQIPPDQPIIFGPDR
FT                   NLGDYIARQLGRDIILWQGFCYVHEAYRADMMKTAQREHPGAELIAHPECRREVLELAS
FT                   FVGSTQALLDYTQKSPSEAFIVATEPGILYEMQRRSPGKTFIPAPRDMTNPRSVCTQMK
FT                   QNTLEKLYRCMLERSPEITVPEPLLSAALKPIRRMLDMSA"
FT   gene            672369..673151
FT                   /locus_tag="Plut_0576"
FT   CDS_pept        672369..673151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23459"
FT                   /db_xref="GOA:Q3B5C2"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23459.1"
FT                   /translation="MGAERAPTPGSRRQKFLSAVPAAILILPVLLSLRGDALGWHDRTH
FT                   VAIARAAGFERWYSAAAPDVAKSKYPCGAYEGKNHYFHNPENRQVTGGMVQRQISLHDR
FT                   ADDQEGHLYGAIVASVREYRALRARGKFADYPMVYCPHYAGDLSMPLHNVAYDAFNRAR
FT                   HHANDGVIEESAFRDAALLRSRIYPIRIGNEDELCLEIARIAELSRQLALRMQREGRDM
FT                   TRTEALGQAVHSASLLQAILIYAGCPVLDLPESALELP"
FT   gene            673675..678240
FT                   /locus_tag="Plut_0577"
FT   CDS_pept        673675..678240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0577"
FT                   /product="ribonucleotide reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23460"
FT                   /db_xref="GOA:Q3B5C1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR013678"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23460.1"
FT                   /translation="MKISRLFTSPGENVYDRFEYTQKSSVLRNTDGSKVFEMNELEVPK
FT                   HWSQMAADILAQKYFRKTGVPQVDGDGNPLLDEEGRPVTGSEHSIRQVVHRLAGCWRQW
FT                   GEKHGYFDSPEDAEAFYDEVAYMLIAQQGAPNSPQWFNTGLNFAYGITGPAQGHYHVDP
FT                   ATKKVVESEDAYTRPQAHACFIQSVNDDLVNEGGIFDLAVREARVFKFGSGSGTNYSNL
FT                   RSSGEKLSGGGSSSGLMSFLKIFDSAAGAIKSGGTTRRAAKMVIIDIDHPDVEKFIEWK
FT                   AREEDKVASLVAGSRICSRFLQAIVEEAILNGADRLENPKLQRLIENALHRAVPMSYII
FT                   RVLALVEQGYTTLDFEEYDTHYESEAYQTVGGQNSNNTVRVTNAFMKAVENNELWMLKE
FT                   RTTGKTARAVNARELWEKILLSAWKCADPGLQFDTTINEWHTCPAAGRINASNPCVTAE
FT                   TLVATDRGLERIGELVGQSRGIRGIEGKLHWVEKIFPTGTKEVYELRTKAGYRLKLTGD
FT                   HPVYTENRGDVKACELSKDDVVRLVGAEFGKESTGSVDVAQLIGLLVGDGCITRNAELT
FT                   ASGEQRRVAFLAMDKAEAEITGWANTLINDLRPELGEHNKQGSLTQTLTSSRVAVGSPR
FT                   ILNLLENYAVLDGGSEKKMFSDAVFRLQQAEQAALLRGLFTADGTVANYGVKSRYVALD
FT                   STSLDLLLQVQLLLLNFGIKAKIYENRRAGDLVSMLPDGKGGMREYPVQEMHSLRISRS
FT                   SRVLFQESIGFMEESRKAEALARLNMTVDTYRDPLVDRVASLRSIGRQPVFDLTEPENH
FT                   HFIANGIGVHNCSEYMFLDNTACNLASLNLIHFVDEESGHVKINELRHAAALWTVVLEI
FT                   SVLMAHFPSPDIARLSYEYRTLGLGFANLGTVLMVLGIPYDSPKALALAGAISAIITGQ
FT                   AYVTSAEISRDLGPFDGYQANSKEMLRVIRNHRRAARNESEEEYEELSVKPRGIDSEYC
FT                   PKELFEAAGSVWDEALQKGKKYGFRNAQVSVIAPTGTIGLVMDCDTTGIEPEFAIVKFK
FT                   KLAGGGYFKIVNQSVHKALKRLGYAAQEIEEIEKYCKGSGSLEGCPSINSQWLMNRGFT
FT                   EEKIALLESNLAAVFDIRFAFNKWILGEEFCQSLGFTEAQLNDPGFDMLQALGASAEDA
FT                   EAANDFICGTMTIEGAPHLKLEHLPVFDCASRCGQKGLRFINHMAHVRMMSSVQPFISG
FT                   AISKTVNMPATATTAEIGEVYLSGWQHMVKAITVYRDGSKLSQPLNISSYQDLDEVIML
FT                   GNEEDLDETKGPREVQERIIERVYHRSERRLLPKRRKGFIREAYVGGHKVFLRTGEYED
FT                   GSLGEVFIDMYKEGASFKGLLNCFAVLASKALQYGMPLEELVDSFTFTRFEPAGAVQGH
FT                   NAIKNSTSILDYVFRSIGYDYLGRKDFVHVKAVDEVPEHGADAKNSNGQTSPVAALEAE
FT                   AVPAAHHAGSEYTNTLKSQVMQAKVQGYTGEQCENCGSMRVKQNGTCKVCEDCGMTTGC
FT                   S"
FT   gene            complement(678367..679062)
FT                   /locus_tag="Plut_0578"
FT   CDS_pept        complement(678367..679062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0578"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23461"
FT                   /db_xref="GOA:Q3B5C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23461.1"
FT                   /translation="MISFVNLDIELNRKPVFSNLNLTIQPGELVFIAGKSGSGKSTLLK
FT                   TMYMEIKPKKGELIIAGYNSRTIKKREIPLLRRKLGIVFQDFRLLEDRSVYDNLAFVLK
FT                   VTGTKEKLIREKVMHALESVGLSDVAGELPIRLSGGEQQRVSIARALVREPLVILADEP
FT                   TGNLDPDTSIEILEYLKKINQKGIIVVIGTHDYELIRHSPSRTLLIQDRSLVEASIREG
FT                   ATGFRPVPA"
FT   gene            complement(679059..680075)
FT                   /locus_tag="Plut_0579"
FT   CDS_pept        complement(679059..680075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0579"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23462"
FT                   /db_xref="GOA:Q3B5B9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23462.1"
FT                   /translation="MRIVFSLGDPHGIGPEIILKGFLELQKSGHRFAVAGSYRVLEHYR
FT                   QALGLPIELERVEDARALEHLPSCSCGVLPVLSVAEPLSIEPGTVTAEAGSIAMQSVKA
FT                   AAELCRNGQFDALVTAPLHKESLALAGCPDSGHTGMLGRMFSVPSPIMLFADRVSGLKV
FT                   ALLTIHEPLERVPLLVRKTDIDRFLLRLARCLETDFGLEHPAVAVLGLNPHASDGGIMG
FT                   REEEELIRPAIQRLQQRMHIEGPFPADGFFGARMQSRFDVVLAMYHDQGLLPFKVLAFH
FT                   SGVNVTLGLPIVRTSPDHGTGFDRAGKGTASAESLHEATLLAATIAENRKKKTGPPL"
FT   gene            complement(680078..680542)
FT                   /locus_tag="Plut_0580"
FT   CDS_pept        complement(680078..680542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23463"
FT                   /db_xref="GOA:Q3B5B8"
FT                   /db_xref="InterPro:IPR025635"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23463.1"
FT                   /translation="MLARIQTLYLFLVALLACGSMLFPFWGFSALEYFPIGDFTPFEGA
FT                   GILFTAGTIASGIFSPLTAIAALAAIFLYKQRALQQKVIALGVLLFVGDLLSTLTAAHF
FT                   MNQYFLAGGAGFVHGPETGFFMILPEPVLFWLAMKGVQKDEKIANAYKRL"
FT   sig_peptide     complement(680444..680542)
FT                   /locus_tag="Plut_0580"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.521 at
FT                   residue 33"
FT   gene            680798..681472
FT                   /locus_tag="Plut_0581"
FT   CDS_pept        680798..681472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0581"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23464"
FT                   /db_xref="GOA:Q3B5B7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23464.1"
FT                   /translation="MSQHPEEELYYDISMPLLGDEFPELDVQTTHGPMNIPGDLKGSWF
FT                   VLFSHPADYTPVCTTEFVAFQERVPEFDKIGCKLIGMSVDQVFSHIKWVEWIEEKLNVE
FT                   ITFPIVAANDRIANKLGMLHPGKGSNTVRAVFVGDPQGKVRLVLYYPQEIGRNMDEILR
FT                   AVTALQYSDKHKVAMPADWPNNTMLKDRVIIPPANNVADAKKRPSQYECYDWWFCHKAM
FT                   EK"
FT   gene            681621..682115
FT                   /locus_tag="Plut_0582"
FT   CDS_pept        681621..682115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0582"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23465"
FT                   /db_xref="GOA:Q3B5B6"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23465.1"
FT                   /translation="MGTRGREIVGEHIDRVLELLNKAFADEWLAYYQYWIGAKIVEGPM
FT                   KDAVMAELLQHAADELRHADMVTTRIIQLGGKPLVNPKLWFEWTNCGYDAPDNPFVRNI
FT                   LEQNISGEQCAISTYHSIIEEIGMKDPITYNLAVQIMQDEVEHEEDLQSLLEDLGMFLR
FT                   K"
FT   gene            682166..682666
FT                   /locus_tag="Plut_0583"
FT   CDS_pept        682166..682666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0583"
FT                   /product="rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23466"
FT                   /db_xref="GOA:Q3B5B5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23466.1"
FT                   /translation="MPTTHENLKSAFGGESQAFMKYVTFAKKAEKDGFKNIARLFRTTA
FT                   EAERIHAEAHLMADDAVGSTAENLETAIGGETYEHNEMYPPMYEQAVSEGHKAKRMFGF
FT                   AVEAEKVHAALYRHALESVKNGQDIVETAVWLCPVCGHIELVTPPEKCPICNVKAEVYV
FT                   QVA"
FT   gene            complement(682841..683290)
FT                   /locus_tag="Plut_0584"
FT   CDS_pept        complement(682841..683290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0584"
FT                   /product="putative ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23467"
FT                   /db_xref="GOA:Q3B5B4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23467.1"
FT                   /translation="MMNATTEGSMTEEFMLRCRAHGLKITPQRLAIFKALAGSKEHPSA
FT                   DGVYRKLVALHPTISFDTVNRTLLTFAEIGIIETVESHSGVRRFDTDLMSHHHLHCVQC
FT                   GRIIDFTDETLDKVPVPEKAIGNFTVLGKRMVVSGICESCRKKHA"
FT   gene            683461..684702
FT                   /locus_tag="Plut_0585"
FT   CDS_pept        683461..684702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23468"
FT                   /db_xref="GOA:Q3B5B3"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23468.1"
FT                   /translation="MSMKRCPVTKLPVTESPRWQVEHPEPGYRVFFEVIGPDIIHAKVV
FT                   GDEPTYLDYIDVDVFQNICEEMQLNGRKVFVVVDYDPINEVRLSYKRDFGNLFYNWGPW
FT                   IAVLVVYNVRPAITAHMLGLGALCPARSEALIVGSYREAMEHIADYKRRYGPADVPEPP
FT                   VADSVEDIAGRFFAAVSRISWLDMLDQPVTAPPEENEFRLFFTALDELRRDLLVREEEH
FT                   QEKLRKLREEYRRREEECRIQINLRQDLSRRDAEQYEAELYRLRNILSAKEDELAGVAG
FT                   MFDSKISSLVKLCQEIDRVDATAELRETISTLCHKISLRKNAEIELSTELTDADACFLA
FT                   ALQDRHPGLNERERRLSLFIKLNYATKDIARSAGISLRGMENIRYRLHKKLGLQPHQSL
FT                   KNYFSMLASEACLG"
FT   gene            complement(684656..686023)
FT                   /locus_tag="Plut_0586"
FT   CDS_pept        complement(684656..686023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0586"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23469"
FT                   /db_xref="GOA:Q3B5B2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23469.1"
FT                   /translation="MKQPHRPEHCAPPSPLRPMTPGPVSIYTLLVPAVAAVLKAAGPFS
FT                   PGLRKFFAARRGVFPELEEKSRNVAEGRPRLWVHAASVGEFEQARPLITLLKESVPGLA
FT                   VFVSFLSDSGYEARKDYPDADAVFYLPLDTPANARKTAELVRPDLFMLMRYDFWPSHLL
FT                   ALKRRGAGMILAAAVLQEGSSYFNPVLKAFYRPLFQLFDHIFTVAEKDARAFRDVFGCR
FT                   AAERAGEPRIDQVIQRSRNSERVGHIAAFFKQRPVLVAGSVWEKDEEVLLGAWLELASR
FT                   PSLVLVPHKVGPENILRIGRELERLQIGWRRVRQLDASFDASREVLVIDETGYLVELYS
FT                   VASMAYVGGGFGVNVHNTLEPAVYGIPVIFGPRHHNSPEAEGLLEAGGAYTIRNSEELG
FT                   AVLRRLVDGSREAEKAGKAAYGFIHSQAGAASRIADAARKILTQGRPRRPASKNNS"
FT   gene            686304..688076
FT                   /locus_tag="Plut_0587"
FT   CDS_pept        686304..688076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0587"
FT                   /product="ATP-dependent RNA helicase CsdA"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23470"
FT                   /db_xref="GOA:Q3B5B1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23470.1"
FT                   /translation="MSAETPEPIRNFTDLNLSEPIMRALKEVGYETPTPIQARTIPLML
FT                   EGRDVLGQAQTGTGKTAAFALPILSGIDLSLTDPQVLVLAPTRELAIQVAEAFHKYAEY
FT                   LKGFHVLPIYGGQDYGGQLRMLKRGVHVVVGTPGRVMDHMRRGSLNLDSLQCLVLDEAD
FT                   EMLRMGFIDDVEWILGETPKERQVALFSATMPAPIRRIAQKYLNSPAEVTIEGKTTTVE
FT                   TIRQRYWIVGGSHKLDILTRILEVEPFEGMLIFVRTKTMTLELAEKLQARGYAAAALNG
FT                   DMVQNQRERTVDQLKDGSLNIVIATDVAARGLDVERISHVINYDVPYDTESYVHRIGRT
FT                   GRAGRSGEAILFVAPREKNMLYAIEKATRKRIELMELPSTEIINDKRIEKFKQRISDTI
FT                   AAEDLGFFTRLIEQYCHEHDVSELEAAAALAAMVQGDTPLLFSAKPEKQVRREERDRPS
FT                   DEAPFRKKPRRDDMYGDEKREVYRIEVGSEHGVQAGNILGAIINEIGLDPEAIGRISIS
FT                   DAFSTVELPAGMPNDIFQELRKVRVCGRQLRVSKMEGGQGGGSPYGGKGAKRPARPSGK
FT                   DGGFFTGPKKKRKG"
FT   gene            688140..689534
FT                   /locus_tag="Plut_0588"
FT   CDS_pept        688140..689534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0588"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23471"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23471.1"
FT                   /translation="MEIEFYGATERVTGSCHILRVGRFTVLLDCGLIQGSDVEEALNRA
FT                   PFAFDPERVEAMILSHGHIDHSGRIPLLVKRGFTGPVFTGDATADLARVLLLDSASLAE
FT                   RDALDRRKHPRTAADRHAEPLYTRDDAVRALNSFKPVPYGRRFPVVPGLEACFRDAGHI
FT                   LGSAVVELWLTEGGVSRKLVFSGDLGQYGSPILNDPEAVTDADALIIESTYGDRLHRDY
FT                   DQTLQELGEIFNSASRGSGNILIPAFSIGRSQELLYLFARHYEEWGMQHWQVYLDSPMA
FT                   IEASMIYLGYPELFDREALASRNDKRLLPTLKNLHFTPKVEQSQAINKERSGAIIIAGS
FT                   GMCNGGRILHHLKHNISRPECHLLITGYQAEGTLGRQIVEGAAEVEIHGRHYPVAAAVH
FT                   TVGGLSAHGDREDMLRWVSGFKSSPRVFVVHGDPAAKEAFRNSIEERLQLTASIPRPGE
FT                   RYDFSS"
FT   gene            689573..690028
FT                   /locus_tag="Plut_0589"
FT   CDS_pept        689573..690028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23472"
FT                   /db_xref="GOA:Q3B5A9"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23472.1"
FT                   /translation="MPDSSIREFIPILQTSIGPVILISGIGLLLLTMTNRLGRIIDRSR
FT                   ALLAGLDSSVERSADTLNRELDILWKRARFIRMAILLSTLTCLGASVMIMLLFYSVLAN
FT                   IDTTILIAVLFFFCMASLSVSLVYFIFDVNLTLTALKIEQEIHPKLR"
FT   gene            complement(690039..690115)
FT                   /gene="tRNA-Lys3"
FT                   /locus_tag="Plut_R0038"
FT   tRNA            complement(690039..690115)
FT                   /gene="tRNA-Lys3"
FT                   /locus_tag="Plut_R0038"
FT                   /product="tRNA-Lys"
FT   gene            complement(690247..691167)
FT                   /locus_tag="Plut_0590"
FT   CDS_pept        complement(690247..691167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0590"
FT                   /product="Tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23473"
FT                   /db_xref="GOA:Q3B5A8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23473.1"
FT                   /translation="MSMVELDAAYSRVLEGFLDYLFIERNFAGNTRESYRNDLGRYLLA
FT                   MQEDDVPLEAITAERINHFVLALHQAGLEPSSIARNVSAIRSLHRFLFNEHRLASNPAE
FT                   TLHQPKQARYLPAVLTLQETERVLEAPMLQSPPGRFLLRDRAILELLYASGIRVTELVD
FT                   MTQQNLYLDERFIRIFGKGSKERLVPIGDAAAAWIRRYREELRMKLSNRNSLDHLFLNA
FT                   RGRKLTRMAVYNMVKEYARLAGIEKNISPHTFRHTFATHLLEGGADLRAVQEMLGHSSI
FT                   VATQIYTHIDRTFVKEVHRTCHPRG"
FT   gene            complement(691167..692495)
FT                   /locus_tag="Plut_0591"
FT   CDS_pept        complement(691167..692495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0591"
FT                   /product="Fmu, rRNA SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23474"
FT                   /db_xref="GOA:Q3B5A7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23474.1"
FT                   /translation="MTSARELAFNILQQLEAGTRHSDSLLHELLEASSLKGPDRALATA
FT                   LTSGVLRQRLQLDFIIAKFYSHDIQKASPAVLNILRLGVWQLLFLDRVPRWAAVNECVR
FT                   LARRYKGERMSKLTNAVLRKISPETVHLDLWLKDASLSERLSVLHSHPEPLVRRWIGNY
FT                   GEQRTESMLRYDNEHPLFGIRHNPLKGTNAKGAEGEESGWQESGIPGIRLAADFHLFEP
FT                   LLRQGLASVQNPTQALAVLLLDPQPDWKVLDLCAAPGGKAAHAAELMGNRGEIIALDRY
FT                   PQKTLRIQALADTLGISIIEARTGDAREFTPPFQPDAILVDAPCTGTGVLGRRAELRWK
FT                   TGPEKLRELSGLQEEILRHAAGLLAEGGLLLYSTCSVEPEENQLQVEAFLQQHPAFRIE
FT                   QATGKVPEPFCLERTPEGGILTLPGARPGFDGGYAVLLRKQGG"
FT   gene            692836..694131
FT                   /locus_tag="Plut_0592"
FT   CDS_pept        692836..694131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0592"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23475"
FT                   /db_xref="GOA:Q3B5A6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23475.1"
FT                   /translation="MTDKKPTPYRFETLQVHAGQTPDPLTHSRAVPIYQTTAYTFDSAR
FT                   HGADLFALKEAGNIYTRLMNPTTDVFEQRMAALEGGKAALAVSSGHSAQFIALTSLCQA
FT                   GDNIVSSSYLYGGTYNQFKVSFARLGIGVHFTRGLEAEDFRRCIDENTKALYLESIGNP
FT                   AFHVPDFEAVAAVADEHGIPLIVDNTFGCGGCLCRPLEHGASIVTESATKWIGGHGTSM
FT                   GGVIVDGGTFDWGSGRFPMLSEPSEGYHGLCFHETFGDLAFIVKARVEGLRDFGPAISP
FT                   FNSFLLLQGLETLSLRVERHLSNTIALARWLLSRPEVAWVNYPGLESHPTHRNAARYLR
FT                   NGFGCVLTFGLKGGYERAVSFIDGVRLASHVANVGDAKTLVIHPASTTHQQLSVEEQAS
FT                   AGVTPDMVRVSVGLEHIDDIREDFEQALRTQA"
FT   gene            694128..695204
FT                   /locus_tag="Plut_0593"
FT   CDS_pept        694128..695204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0593"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23476"
FT                   /db_xref="GOA:Q3B5A5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23476.1"
FT                   /translation="MNRGMKPINELISPDTKHYSFTEPFQTELGATLPSVEVAYRTWGT
FT                   LNEARDNVILICHALTGSADADQWWGGLFGEGCGFDATRDFIICSNVLGSCYGTTGPLS
FT                   PNPATGRHYGPDFPLITIRDMVHVERHLLRHLGIERVKLVVGASLGGMQVLEWGALYPE
FT                   VALALMPMGISGRHSAWCIAQSEAQRQAIMADALWKDGWYEEDAPPARGLGAARMMAMC
FT                   TYRSFRNFEEKFGRQRQEDGTFKAVSYMHHQGGRLVERFDANTYITLTRAMDMHDLGRG
FT                   RSGYEEAVCAMTQPVEILSIDSDVLYPKSEQQELACLLPNSKILYLDEPYGHDAFLIDV
FT                   ERVSRMVRDFLQAISRKG"
FT   gene            complement(695188..696480)
FT                   /locus_tag="Plut_0594"
FT   CDS_pept        complement(695188..696480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0594"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23477"
FT                   /db_xref="GOA:Q3B5A4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B5A4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23477.1"
FT                   /translation="MLDINYIRQNPEEVATMLHDRQLQGDEPKLQRLLFIDTERRTLVQ
FT                   KTDELKALRNTRSKEIAELKKSGSGSADQLIADMQAVGEEIAGLDSRLSALNMEMEEIL
FT                   LALPNRLDPSVPVGRTAEDNLVFGEPVHFPHPLEFDVKNHLELGKALGILDFERGAKVT
FT                   GAGFPVYVGKGARLERALINFMLDRHTEEHGYTEVFPPFLVNRDSLRGTGQWPKFADQV
FT                   YHMEEDELYAIPTAEVPVTNLHRDEMLSAEALPISYAAYSACFRREAGSYGKDTRGFLR
FT                   VHQFNKVEMVKFTRPEESYAALETIRGHAEAILCALEIPYRVLLLCSGDISANAAKCYD
FT                   IEVWSPAERKYLEASSCSNFEDYQARRANIRFKADGKSKPEFVHTLNGSGLATSRLMVS
FT                   IIEHYQTLEGGIRVPEVLVPYTGFSQISPSC"
FT   gene            complement(696508..696963)
FT                   /locus_tag="Plut_0595"
FT   CDS_pept        complement(696508..696963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23478"
FT                   /db_xref="GOA:Q3B5A3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23478.1"
FT                   /translation="MSLKEQIDADLKASMKSGDKTRLNAIRSIRATLLEKEVSIRVGGK
FT                   AELSLDQEMDVLSSLAKRRRDAMEQFTQGGRPDLAENEQAELKVIEEYLPAPASQEEIE
FT                   AVVREVITKSGAASMKDMGRVMGESMKALKGKADGTAVQQAVKALLS"
FT   gene            complement(697057..697788)
FT                   /locus_tag="Plut_0596"
FT   CDS_pept        complement(697057..697788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0596"
FT                   /product="sepiapterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23479"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B5A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB23479.1"
FT                   /translation="MQHIIIITGAGKGIGRAIALDFAYAHQRNPEFNPMLILVSRTAAD
FT                   LEPLAVLCRNAGAEAETAVVDIADIAALEGLVESVMERHGRIDCLVNNAGVGTFKPIGE
FT                   ITEKEYDRMAAVNMKGTFFLTQKVFRHMQCQRSGHLFFITSVAAEKAFPSSSVYSMTKF
FT                   AQKGLVESVRLYARTCGVRVTNVMPGAVLTPMWGEVDDAMREVMMMPEDISGPVVDAYL
FT                   LPARTVVEELVFRPVAGDINE"
FT   gene            698008..698277
FT                   /locus_tag="Plut_0597"
FT   CDS_pept        698008..698277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plut_0597"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Plut_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABB23480"
FT                   /db_xref="GOA:Q3B5A1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniPr