(data stored in ACNUC7421 zone)

EMBL: CP000097

ID   CP000097; SV 1; circular; genomic DNA; STD; PRO; 2234828 BP.
XX
AC   CP000097;
XX
PR   Project:PRJNA13655;
XX
DT   28-OCT-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Synechococcus sp. CC9902, complete genome.
XX
KW   .
XX
OS   Synechococcus sp. CC9902
OC   Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae; Synechococcus;
OC   unclassified Synechococcus.
XX
RN   [1]
RP   1-2234828
RA   Palenik B., Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina T., Hammon N., Israni S., Pitluck S., Martinez M., Schmutz J.,
RA   Larimer F., Land M., Kyrpides N., Ivanova N., Richardson P.;
RT   "Complete sequence of Synechococcus sp. CC9902";
RL   Unpublished.
XX
RN   [2]
RP   1-2234828
RG   US DOE Joint Genome Institute
RA   Palenik B., Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina T., Hammon N., Israni S., Pitluck S., Martinez M., Schmutz J.,
RA   Larimer F., Land M., Ivanova N., Richardson P.;
RT   ;
RL   Submitted (08-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a0ab6c425e82d3d2a66fb62b6f79b4a9.
DR   BioSample; SAMN02598312.
DR   EnsemblGenomes-Gn; EBG00001457917.
DR   EnsemblGenomes-Gn; EBG00001457918.
DR   EnsemblGenomes-Gn; EBG00001457919.
DR   EnsemblGenomes-Gn; EBG00001457920.
DR   EnsemblGenomes-Gn; EBG00001457921.
DR   EnsemblGenomes-Gn; EBG00001457922.
DR   EnsemblGenomes-Gn; EBG00001457923.
DR   EnsemblGenomes-Gn; EBG00001457924.
DR   EnsemblGenomes-Gn; EBG00001457925.
DR   EnsemblGenomes-Gn; EBG00001457926.
DR   EnsemblGenomes-Gn; EBG00001457927.
DR   EnsemblGenomes-Gn; EBG00001457928.
DR   EnsemblGenomes-Gn; EBG00001457929.
DR   EnsemblGenomes-Gn; EBG00001457930.
DR   EnsemblGenomes-Gn; EBG00001457931.
DR   EnsemblGenomes-Gn; EBG00001457932.
DR   EnsemblGenomes-Gn; EBG00001457933.
DR   EnsemblGenomes-Gn; EBG00001457934.
DR   EnsemblGenomes-Gn; EBG00001457935.
DR   EnsemblGenomes-Gn; EBG00001457936.
DR   EnsemblGenomes-Gn; EBG00001457937.
DR   EnsemblGenomes-Gn; EBG00001457938.
DR   EnsemblGenomes-Gn; EBG00001457939.
DR   EnsemblGenomes-Gn; EBG00001457940.
DR   EnsemblGenomes-Gn; EBG00001457941.
DR   EnsemblGenomes-Gn; EBG00001457942.
DR   EnsemblGenomes-Gn; EBG00001457943.
DR   EnsemblGenomes-Gn; EBG00001457944.
DR   EnsemblGenomes-Gn; EBG00001457945.
DR   EnsemblGenomes-Gn; EBG00001457946.
DR   EnsemblGenomes-Gn; EBG00001457947.
DR   EnsemblGenomes-Gn; EBG00001457948.
DR   EnsemblGenomes-Gn; EBG00001457949.
DR   EnsemblGenomes-Gn; EBG00001457950.
DR   EnsemblGenomes-Gn; EBG00001457951.
DR   EnsemblGenomes-Gn; EBG00001457952.
DR   EnsemblGenomes-Gn; EBG00001457953.
DR   EnsemblGenomes-Gn; EBG00001457954.
DR   EnsemblGenomes-Gn; EBG00001457955.
DR   EnsemblGenomes-Gn; EBG00001457956.
DR   EnsemblGenomes-Gn; EBG00001457957.
DR   EnsemblGenomes-Gn; EBG00001457958.
DR   EnsemblGenomes-Gn; EBG00001457959.
DR   EnsemblGenomes-Gn; EBG00001457960.
DR   EnsemblGenomes-Gn; EBG00001457961.
DR   EnsemblGenomes-Gn; EBG00001457962.
DR   EnsemblGenomes-Gn; EBG00001457963.
DR   EnsemblGenomes-Gn; EBG00001457964.
DR   EnsemblGenomes-Gn; EBG00001457965.
DR   EnsemblGenomes-Gn; EBG00001457966.
DR   EnsemblGenomes-Gn; EBG00001457967.
DR   EnsemblGenomes-Gn; EBG00001457968.
DR   EnsemblGenomes-Gn; EBG00001457969.
DR   EnsemblGenomes-Gn; EBG00001457970.
DR   EnsemblGenomes-Gn; EBG00001457971.
DR   EnsemblGenomes-Gn; EBG00001457972.
DR   EnsemblGenomes-Gn; EBG00001457973.
DR   EnsemblGenomes-Gn; EBG00001457974.
DR   EnsemblGenomes-Gn; EBG00001457975.
DR   EnsemblGenomes-Gn; EBG00001457976.
DR   EnsemblGenomes-Gn; EBG00001457977.
DR   EnsemblGenomes-Gn; EBG00001457978.
DR   EnsemblGenomes-Gn; EBG00001457979.
DR   EnsemblGenomes-Gn; EBG00001457980.
DR   EnsemblGenomes-Gn; EBG00001457981.
DR   EnsemblGenomes-Gn; Syncc9902_R0001.
DR   EnsemblGenomes-Gn; Syncc9902_R0002.
DR   EnsemblGenomes-Gn; Syncc9902_R0003.
DR   EnsemblGenomes-Gn; Syncc9902_R0004.
DR   EnsemblGenomes-Gn; Syncc9902_R0005.
DR   EnsemblGenomes-Gn; Syncc9902_R0006.
DR   EnsemblGenomes-Gn; Syncc9902_R0007.
DR   EnsemblGenomes-Gn; Syncc9902_R0008.
DR   EnsemblGenomes-Gn; Syncc9902_R0009.
DR   EnsemblGenomes-Gn; Syncc9902_R0010.
DR   EnsemblGenomes-Gn; Syncc9902_R0011.
DR   EnsemblGenomes-Gn; Syncc9902_R0012.
DR   EnsemblGenomes-Gn; Syncc9902_R0013.
DR   EnsemblGenomes-Gn; Syncc9902_R0014.
DR   EnsemblGenomes-Gn; Syncc9902_R0015.
DR   EnsemblGenomes-Gn; Syncc9902_R0016.
DR   EnsemblGenomes-Gn; Syncc9902_R0017.
DR   EnsemblGenomes-Gn; Syncc9902_R0018.
DR   EnsemblGenomes-Gn; Syncc9902_R0019.
DR   EnsemblGenomes-Gn; Syncc9902_R0020.
DR   EnsemblGenomes-Gn; Syncc9902_R0021.
DR   EnsemblGenomes-Gn; Syncc9902_R0022.
DR   EnsemblGenomes-Gn; Syncc9902_R0023.
DR   EnsemblGenomes-Gn; Syncc9902_R0024.
DR   EnsemblGenomes-Gn; Syncc9902_R0025.
DR   EnsemblGenomes-Gn; Syncc9902_R0026.
DR   EnsemblGenomes-Gn; Syncc9902_R0027.
DR   EnsemblGenomes-Gn; Syncc9902_R0028.
DR   EnsemblGenomes-Gn; Syncc9902_R0029.
DR   EnsemblGenomes-Gn; Syncc9902_R0030.
DR   EnsemblGenomes-Gn; Syncc9902_R0031.
DR   EnsemblGenomes-Gn; Syncc9902_R0032.
DR   EnsemblGenomes-Gn; Syncc9902_R0033.
DR   EnsemblGenomes-Gn; Syncc9902_R0034.
DR   EnsemblGenomes-Gn; Syncc9902_R0035.
DR   EnsemblGenomes-Gn; Syncc9902_R0036.
DR   EnsemblGenomes-Gn; Syncc9902_R0037.
DR   EnsemblGenomes-Gn; Syncc9902_R0038.
DR   EnsemblGenomes-Gn; Syncc9902_R0039.
DR   EnsemblGenomes-Gn; Syncc9902_R0040.
DR   EnsemblGenomes-Gn; Syncc9902_R0041.
DR   EnsemblGenomes-Gn; Syncc9902_R0042.
DR   EnsemblGenomes-Gn; Syncc9902_R0043.
DR   EnsemblGenomes-Gn; Syncc9902_R0044.
DR   EnsemblGenomes-Gn; Syncc9902_R0045.
DR   EnsemblGenomes-Gn; Syncc9902_R0046.
DR   EnsemblGenomes-Gn; Syncc9902_R0047.
DR   EnsemblGenomes-Gn; Syncc9902_R0048.
DR   EnsemblGenomes-Gn; Syncc9902_R0049.
DR   EnsemblGenomes-Gn; Syncc9902_R0050.
DR   EnsemblGenomes-Gn; Syncc9902_R0051.
DR   EnsemblGenomes-Tr; EBT00001611582.
DR   EnsemblGenomes-Tr; EBT00001611583.
DR   EnsemblGenomes-Tr; EBT00001611584.
DR   EnsemblGenomes-Tr; EBT00001611585.
DR   EnsemblGenomes-Tr; EBT00001611586.
DR   EnsemblGenomes-Tr; EBT00001611587.
DR   EnsemblGenomes-Tr; EBT00001611588.
DR   EnsemblGenomes-Tr; EBT00001611589.
DR   EnsemblGenomes-Tr; EBT00001611590.
DR   EnsemblGenomes-Tr; EBT00001611591.
DR   EnsemblGenomes-Tr; EBT00001611592.
DR   EnsemblGenomes-Tr; EBT00001611593.
DR   EnsemblGenomes-Tr; EBT00001611594.
DR   EnsemblGenomes-Tr; EBT00001611595.
DR   EnsemblGenomes-Tr; EBT00001611596.
DR   EnsemblGenomes-Tr; EBT00001611597.
DR   EnsemblGenomes-Tr; EBT00001611598.
DR   EnsemblGenomes-Tr; EBT00001611599.
DR   EnsemblGenomes-Tr; EBT00001611600.
DR   EnsemblGenomes-Tr; EBT00001611601.
DR   EnsemblGenomes-Tr; EBT00001611602.
DR   EnsemblGenomes-Tr; EBT00001611603.
DR   EnsemblGenomes-Tr; EBT00001611604.
DR   EnsemblGenomes-Tr; EBT00001611605.
DR   EnsemblGenomes-Tr; EBT00001611606.
DR   EnsemblGenomes-Tr; EBT00001611607.
DR   EnsemblGenomes-Tr; EBT00001611608.
DR   EnsemblGenomes-Tr; EBT00001611609.
DR   EnsemblGenomes-Tr; EBT00001611610.
DR   EnsemblGenomes-Tr; EBT00001611611.
DR   EnsemblGenomes-Tr; EBT00001611612.
DR   EnsemblGenomes-Tr; EBT00001611613.
DR   EnsemblGenomes-Tr; EBT00001611614.
DR   EnsemblGenomes-Tr; EBT00001611615.
DR   EnsemblGenomes-Tr; EBT00001611616.
DR   EnsemblGenomes-Tr; EBT00001611617.
DR   EnsemblGenomes-Tr; EBT00001611618.
DR   EnsemblGenomes-Tr; EBT00001611619.
DR   EnsemblGenomes-Tr; EBT00001611620.
DR   EnsemblGenomes-Tr; EBT00001611621.
DR   EnsemblGenomes-Tr; EBT00001611622.
DR   EnsemblGenomes-Tr; EBT00001611623.
DR   EnsemblGenomes-Tr; EBT00001611624.
DR   EnsemblGenomes-Tr; EBT00001611625.
DR   EnsemblGenomes-Tr; EBT00001611626.
DR   EnsemblGenomes-Tr; EBT00001611627.
DR   EnsemblGenomes-Tr; EBT00001611628.
DR   EnsemblGenomes-Tr; EBT00001611629.
DR   EnsemblGenomes-Tr; EBT00001611630.
DR   EnsemblGenomes-Tr; EBT00001611631.
DR   EnsemblGenomes-Tr; EBT00001611632.
DR   EnsemblGenomes-Tr; EBT00001611633.
DR   EnsemblGenomes-Tr; EBT00001611634.
DR   EnsemblGenomes-Tr; EBT00001611635.
DR   EnsemblGenomes-Tr; EBT00001611636.
DR   EnsemblGenomes-Tr; EBT00001611637.
DR   EnsemblGenomes-Tr; EBT00001611638.
DR   EnsemblGenomes-Tr; EBT00001611639.
DR   EnsemblGenomes-Tr; EBT00001611640.
DR   EnsemblGenomes-Tr; EBT00001611641.
DR   EnsemblGenomes-Tr; EBT00001611642.
DR   EnsemblGenomes-Tr; EBT00001611643.
DR   EnsemblGenomes-Tr; EBT00001611644.
DR   EnsemblGenomes-Tr; EBT00001611645.
DR   EnsemblGenomes-Tr; EBT00001611646.
DR   EnsemblGenomes-Tr; Syncc9902_R0001-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0002-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0003-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0004-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0005-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0006-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0007-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0008-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0009-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0010-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0011-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0012-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0013-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0014-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0015-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0016-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0017-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0018-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0019-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0020-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0021-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0022-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0023-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0024-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0025-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0026-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0027-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0028-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0029-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0030-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0031-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0032-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0033-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0034-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0035-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0036-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0037-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0038-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0039-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0040-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0041-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0042-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0043-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0044-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0045-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0046-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0047-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0048-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0049-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0050-1.
DR   EnsemblGenomes-Tr; Syncc9902_R0051-1.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC3390001; 22768379.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01716; PhotoRC-I.
DR   RFAM; RF01752; psaA.
DR   RFAM; RF01753; psbNH.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000097.
DR   SILVA-SSU; CP000097.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Brian Palenik
CC   (bpalenik@ucsd.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2234828
FT                   /organism="Synechococcus sp. CC9902"
FT                   /strain="CC9902"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316279"
FT   gene            247..1404
FT                   /locus_tag="Syncc9902_0001"
FT   CDS_pept        247..1404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24976"
FT                   /db_xref="GOA:Q3B102"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B102"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24976.1"
FT                   /translation="MKVVCSQSELNAALQLVSRAVATRPTHPVLANVLLTADAGTNRLS
FT                   LTGFDLNLGIQTSLAASVETSGAITLPARLLGEIVSRLASDSPITLATEESGEQVQLTS
FT                   LSGSYQMRGLPADDYPELPMVESGMTLKLQPAGLVQALKGTLFASSADEAKQLLTGVHL
FT                   RFNAKALEAAATDGHRLAVLQVEDALEDAAANSDDAAEGFAVTLPARSLREVERLMAGW
FT                   RSDDPVSLFCDRGQVVFLAADQMVTSRTLEGTYPNYGQLIPDGFNRTLALDRRGLIAAL
FT                   ERIAVLADQHNNVVKFTSQPDEGVVQISADAQDVGSGSESLAANLTGDAIQIAFNVRYL
FT                   LDGLKAMGSDRVVLHCNAPTTPAVLKPEGDAEAFTYLVMPVQIRS"
FT   gene            1406..2155
FT                   /locus_tag="Syncc9902_0002"
FT   CDS_pept        1406..2155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24977"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B101"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24977.1"
FT                   /translation="MVLPNPLLLSDLLNHTVRCELGLDHGPGLMAWMHPPVHRLLGWVS
FT                   RPSALRMSRDVWRLDQCCGISDQQVFVRGEPAVSDQATLDRLPTLMNADLVDREGERIG
FT                   FLADLAFDPATGTIVHYLVSRSDPRLPGSSRWQLVPDRITDQRPGQVMTALRSLDDLPL
FT                   MRASVRQDLLQRTQRWREQLRDMGDRAGDRLEGWLDEPPWDEPEPEQRIDSNEPDEEAP
FT                   VNEVWDDDTWPESSFQRRVNRDEDPWV"
FT   gene            2195..4495
FT                   /locus_tag="Syncc9902_0003"
FT   CDS_pept        2195..4495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0003"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24978"
FT                   /db_xref="GOA:Q3B100"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B100"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24978.1"
FT                   /translation="MVSSSSYDVSAALKQEGLKSSDWDEICRRLGREPNRAELGMFGVM
FT                   WSEHCCYRNSRPLLSGFPTEGPRILVGPGENAGVVDLGDGHRLAFKIESHNHPSAVEPF
FT                   QGAATGVGGILRDIFTMGARPIALLNALRFGPLDDSANVGLMEGVVAGIAHYGNCVGVP
FT                   TVGGEVAFDPSYSGNPLVNAMALGLMETKDIVKSGAIGVGNPVVYVGSTTGRDGMGGAS
FT                   FASAELSADSLDDRPAVQVGDPFLEKGLIEACLEAFDSGDVVAAQDMGAAGLTCSCSEM
FT                   AAKGGLGVELDLDRVPARESGMTAYEFLLSESQERMLFVVKAGREEPLMKRFRRWGLQA
FT                   AVVGQVLEEPIVRVLHHGEVAAEVPATALADDTPIEKHALLSEPPVDLQEHWQWTEAQL
FT                   PDLADPAAALLGLLDDPTIASKRWVHRQYDQQVLANTVVSSGAADAAVIRLRPQQGDGS
FT                   LKTTTRGVAATVDCPNRWVALDPERGAMAAVAEAARNLSCVGSEPLAITDNLNFPSPET
FT                   PKGFWQLAMACRGISEACKAFQTPVTGGNVSLYNETRRDDGSLQPIHPTPVIGMVGVVD
FT                   DITKVTGLGWCQPGDVVVLLGVKPDADQDDRVGLAGSSYQQFTLGTITGRPPRIDFDLE
FT                   KRVQGLVRQAIADGLIASAHDSSDGGLAVALAECSIASGFGVELTLSVGTMSPARLLFA
FT                   EGGARVVVSVKADQLTRWQTMLTSNPDVSTTVLGTVASHGRFQLSFGVGSTIDLSVDQL
FT                   QQVYADALPRRLA"
FT   gene            4495..6000
FT                   /locus_tag="Syncc9902_0004"
FT   CDS_pept        4495..6000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0004"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24979"
FT                   /db_xref="GOA:Q3B0Z9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24979.1"
FT                   /translation="MQTSDGFLNRRPVQQQQLVAERPDRMEEACGVFAVLAAEQPVANL
FT                   AYFGLYALQHRGQESAGIAVFNQDKVLLHKDMGLVSQVFDQDVLARMSGDLSIGHNRYS
FT                   TTGSSRVCNAQPVVLMTRLGAFALAHNGNLVNAKELRVLVDDGKTEFTSTTDSELIAFA
FT                   VQQAVNRGLDWRSGIEAALKLCQGAFSLVIGTPAGLFAIRDGYGIRPLVFGFLGEQSLG
FT                   HWVVSSETCGLEIIGARYVDDVQPGELVHFELGSAEPFRKRWSDEPNRLCVFEMIYFAR
FT                   PDSRFFGESLYSYRQRIGRTLAKESAVDADLVIGVPDSGIPAAIGFSQESGIPYADGLI
FT                   KNRYVGRTFIQPTQAMREAGIRVKLNPLPDVLSGKRIIVIDDSIVRGTTSGKLVVALRD
FT                   AGATEVHMRISSPPVTHPCFYGIDTDTQDQLIASRLTLEEIKNHLKVDSLAYLSKEGMV
FT                   EAAKAESGNFCSACFDGNYPIPMDQELLSSKLTLEPSAGSINR"
FT   gene            complement(5990..8410)
FT                   /locus_tag="Syncc9902_0005"
FT   CDS_pept        complement(5990..8410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0005"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24980"
FT                   /db_xref="GOA:Q3B0Z8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24980.1"
FT                   /translation="MQRSYLEYAMSVIVGRALPDARDGLKPVQRRILYAMQELGLTPDR
FT                   PYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFASRHPLLDGHGNFGSVDDDPPAAM
FT                   RYTETRLAPIAHQALLEEIGDDTVDFASNFDGSQQEPTVLPAQLPFLLLNGCSGIAVGM
FT                   ATSIPPHNLGEVVDGLIALIRQPGLSDERLLELIPGPDFPTGGEVLLSSGLQDTYLQGR
FT                   GSIPMRGVAHTEEVQLGKGRHKRNAVVVTELPYQLSKAGWIEKLAESVNDGKIGGIADI
FT                   RDESDRDGMRVVVELRRDAEPEKVLKDLQRRTALQSNFGAILLALVNGQPQQLSLRQLL
FT                   QTFLDYRELTLIRRTSHALRKTEDRLEVVEGLITALNNLQAVIAMIQEAKDAASARASL
FT                   MVRLDLNERQADAVLAMPLRRLTGLEQESLRQEVDNLRNEKERLKLLLENRDQLLDAMV
FT                   AELKTLKKRFSTPRRTRLVEGGDALIAERAASQRPNTELLRQQALAALPGDGRLLIQAD
FT                   GQVKIVTPQVLGRLHFGDPCPVSDAPSPARVILPIEPPPRLLAISANGRVALVRWEFAG
FT                   QQPGALERFLPSGLEGEPIVAIAPLPMQESSDLSLGLLSSDGRFKRLPLAEVLELSGRA
FT                   TSVVKLKDGVQLKAAVICHEHHDLILVSDIGRMLRLPINEDVLPRMGRLAQGPMTMRLL
FT                   PGEHLIGALCPTKPTALLVSEQGRLARIDLTSIRSSQRGDLGSMAIQLVGDTDRITGLT
FT                   EASGLIGMVSTEQRHGRIDPTTLEITNPGEEFSNQIELHQGETITDLIPQISG"
FT   gene            complement(8498..9379)
FT                   /locus_tag="Syncc9902_0006"
FT   CDS_pept        complement(8498..9379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0006"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24981"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24981.1"
FT                   /translation="MLRGIKFKRSLTAALISISNFFLIAPAQALVPYVYLPTEVELSGS
FT                   SLGIGRTAAQLLQMGQPKEAAQLAALAVQLNPNDERLWTVLAEAQLRSNQLEDASQSLA
FT                   KAKKINPNNAGLWFAEAAIALRAQRPEEAIPLIQRGLQIDANNAAAYFDLGNARIMQNK
FT                   LAIALQSFEKATEIKPEFWEALNNQALVLFELGEHDEAIQRWRRVLKLDQNAEPMLALA
FT                   AALHQKGEQIEALSLAKEALSKNPNYVLPMHQKEQLWGSHVRQATANLLREAALASSVE
FT                   RAQANATWKKRQ"
FT   gene            complement(9399..10394)
FT                   /locus_tag="Syncc9902_0007"
FT   CDS_pept        complement(9399..10394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0007"
FT                   /product="4Fe-4S cluster binding"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24982"
FT                   /db_xref="GOA:Q3B0Z6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24982.1"
FT                   /translation="MKKQVLTIRSMSGQHPAQLKPLSRALKQRAKEEGFDPVGIARLPG
FT                   SPRLQLRTEALQRWLNHGYQADMAWMAAPRRRDASQLLEGVQSLLAVGLNYYVSEESAP
FT                   GSLKVARYGWGRDYHRVVEQRLRRVGRWLSDQRPNCQWRVCVDASPLLDKVWAEEAGLG
FT                   WIGKHSNVIHPHRGSWMVIGHLLTTEPLQADTPAASLCGRCVACIEACPTDAIREPFVV
FT                   DAQRCLAFHTIENRDPELPDSIKTSLGPWIAGCDICQDVCPWNHRDLPSSEDPDMQPRP
FT                   WLLNVNAQDLQNWDDATWDQQLRGSALRRIKPWMWRRNAAAAQPDLPPNL"
FT   gene            10401..11048
FT                   /locus_tag="Syncc9902_0008"
FT   CDS_pept        10401..11048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24983"
FT                   /db_xref="GOA:Q3B0Z5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24983.1"
FT                   /translation="MTGTETGRLASLLRWLGLTMVLVLVLQMAAVLVGSDWSVEATPPP
FT                   ITGPLVALAPLGFIGLLTCLIGSRLENPQQQVTPLRVVVCAFSALLAIGMVVAVPMSLS
FT                   NGAGDLSKTQNLEQGRAAMKEARAFRDDPEQVASLGEQLAQAGQLAADATDEDKLRAAK
FT                   TMIDEQIDQMDTQLKRVESQQTRESRQRLIGGTATAVVLAVAFVLLALTAVI"
FT   gene            11065..11829
FT                   /locus_tag="Syncc9902_0009"
FT   CDS_pept        11065..11829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24984"
FT                   /db_xref="GOA:Q3B0Z4"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24984.1"
FT                   /translation="MNSLTLGAEALVQSNPRPDLPLGERLQQDLKNDLIAGLLVVIPLA
FT                   TTIWLSTIVSRFVLAFLTSIPKQFNPFITLNPLLQDLINLALGLTVPLMGILLIGLMAR
FT                   NIVGRWLLEFGEGTLTRIPLAGSVYKTLKQLLETVLGGNSARFRRVVLVEYPREGLFSV
FT                   GFVTGEVGPSLQSDLETPLLSVFIPTAPNPTTGWYTLVPEGSVRELNISVEEAFRTIIS
FT                   AGIVNPDEQEAPVNRSFSSLIAQLRASASPSS"
FT   gene            11833..12468
FT                   /locus_tag="Syncc9902_0010"
FT   CDS_pept        11833..12468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0010"
FT                   /product="NusB antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24985"
FT                   /db_xref="GOA:Q3B0Z3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24985.1"
FT                   /translation="MASRSLSRELALLVLGQVSEQNKLSTADLGIESLLEKALESLTQH
FT                   WREALDSSASELDHAQQRLLDSELQQGQASTLDVVRDHLRSSLGTAEQVLNGLSATLEL
FT                   PRLLLLSDQEKVRSAAMERIAQVIRQRESIDARLDQVMEGWRLGRLPRIDRDILRLAVV
FT                   DLQTMGTPAPVAFNEAVELANRYSDEQGRRMINGVLRRFHDAQSTAAD"
FT   gene            12468..14036
FT                   /locus_tag="Syncc9902_0011"
FT   CDS_pept        12468..14036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0011"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24986"
FT                   /db_xref="GOA:Q3B0Z2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24986.1"
FT                   /translation="MVFNWFEREASSSGETPSTPDSPAVEQQPPEDAVQVIPEPDLSAL
FT                   QDAGDQNGEGQDDEVQEEDEALVWAREAYARLKAQQQAAATAPKTPVSTTPEPEPEATP
FT                   EPTSAVDPEIAAEPSPLVSLTPEVSPEPTPAPTVGGSLLEQAAAQRQQRQQEQEVRALE
FT                   VAPEPTISTPPPPAADAVEPTLGEFDEDFTWSAQVLAAQGRRADQMSLEEIDWLGRLRR
FT                   GLEKTRQGFVTGLLENLGDDPLTPEVLDELETLLLRADAGVQATDQVLEALRQRMNEEV
FT                   VDPVEGIRFLKDQLRGLLDAPIKASGVPLLAPERGRLNIWLMVGVNGVGKTTTLGKLAN
FT                   LAVRSGYSALIAAADTFRAAAVQQVEVWGERSDVPVISNPSSNADPAAVVFDAIGAARS
FT                   RETDLLLVDTAGRLQTKHNLMEELQKVRKIIDRLAPEANVESLLVLDASQGQNGLRQAM
FT                   AFAKAAGLTGVVVTKLDGTARGGVALAVSSEAGLPIRFIGAGEGIRDLRPFNSFEFVEA
FT                   LLAGR"
FT   gene            14074..15483
FT                   /locus_tag="Syncc9902_0012"
FT   CDS_pept        14074..15483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0012"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24987"
FT                   /db_xref="GOA:Q3B0Z1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Z1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24987.1"
FT                   /translation="MSSKPPRRHSTPVQRAVAPSPQAMASLRQLFDSLSNEQRRNQDLL
FT                   VSLAFALRSFTNLHRFLELVPVVVSRLVGVDGALIVPFQSDGRLWRDQLQAVPVEQSQD
FT                   LFRRLASFQPGESAGFGTDDAQMLALDRLVQRCLPKAGLFATSVVVRGRCRGRLYVFDP
FT                   SSELVWTEVHRRHAQLVADLAGVAIENDLMLQDARRHERVDRQLSIGAEIQAQLLPDHC
FT                   PVIEGVELAARCRPAFQVGGDYYDFIPTRPELIGRRRERGRWALVMGDVMGKGVPAGLL
FT                   MTMLRGMLRAEVLSGLSPDRILHDLNQLAQEDLAQSHRFVTLFYSDFDPRTRRLRYANA
FT                   AHNPPLLWRSEQRSISRLDAAGLLIGLQPEADYGLGEVRLDPGDVLLYYTDGVTEAPGI
FT                   TGDRFDEARLIRALESACRSGQGSQGILDTLFERLDRFVGANRQLEDDASMVVLKVPEA
FT                   VTLPNMVVPLP"
FT   gene            15521..16951
FT                   /locus_tag="Syncc9902_0013"
FT   CDS_pept        15521..16951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0013"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24988"
FT                   /db_xref="GOA:Q3B0Z0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0Z0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24988.1"
FT                   /translation="MNKSMAGGVTGGADGTWSDRFEQGLHPFIEVFNASIGFDLTLLQE
FT                   DLDGSIAHARMLGSCGVISVEEAEQLVQGLETIRSEAHAGTFQPGLADEDVHFAVERRL
FT                   IALLGPVGKKLHTGRSRNDQVGTDLRLWLRRRLDELEGDLQRLQRALVAQADLHRRTMI
FT                   PGYTHLQRAQPLCLAHHLLAYVEMLERDRLRLHDVRSRVNICPLGAAALAGTPVPIDRQ
FT                   QTAKALGFDAIYANSLDAVSDRDFCVEFSAAASLVMAHLSRLAEEVIAWASEEFRFVRL
FT                   SDRCATGSSLMPQKKNPDVPELVRGKCGRVFGHLQGLLTMIKGLPLAYNKDFQEDKEAL
FT                   FDAFRTTRDCIEAMAILFEEGLEFRTERLNTAVEQDFSNATDVADYLVAKGVPFREAYQ
FT                   LVGAVVRRCLDEGCLLRDLSLAAWQELHPAFEADLHDALAPQAVVAARRSEGGTGFDRV
FT                   DEQLGRWLQHLNGTQPVG"
FT   gene            17078..17668
FT                   /locus_tag="Syncc9902_0014"
FT   CDS_pept        17078..17668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0014"
FT                   /product="RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24989"
FT                   /db_xref="GOA:Q3B0Y9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24989.1"
FT                   /translation="MSIFVGNLPFRAEQEDVTELFAQFGEVVNCALPLERDTGRKRGFA
FT                   FVEMSDDAAEEAAIEGLQGAELMGRPLRINKAEPRGSAPRRGGGGGGYGGGGGGGGYGG
FT                   GGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGDRPSGARGWEDRSYGARDSAAPQGGNA
FT                   YDEGRSRRRRSSGGGGTGASGGDDFSGYGGAEG"
FT   gene            complement(17690..18694)
FT                   /locus_tag="Syncc9902_0015"
FT   CDS_pept        complement(17690..18694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0015"
FT                   /product="uncharacterized protein family UPF0034"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24990"
FT                   /db_xref="GOA:Q3B0Y8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24990.1"
FT                   /translation="MTEVGSPATVAAHSFSVAPMLDCTDRHFRVLMRQISRRALLYSEM
FT                   VVAQALHYTNRRDRLLDFDPIEHPIALQVGGDDPNLLADAARLALDWGYDEINLNVGCP
FT                   SQRVQAGNFGACLMADPDLVARCVEAMGQATALPVTVKHRIGIDDLDNDELLTAFVDRV
FT                   AAAGAQRFSVHARKAWLEGLDPKQNRTIPPLQHERVVALKQRRPDLLIELNGGLETPED
FT                   CLAALHECDGAMVGRAAYAHPLRWADIDHLIYGEPPRQLLASDVVEGLIPHAALHLHRG
FT                   GRLWDLCRHLVQLVEGVPGARHWRRELGERSQRKGADLNILEEAGRQLKDAGL"
FT   gene            18735..19241
FT                   /locus_tag="Syncc9902_0016"
FT   CDS_pept        18735..19241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0016"
FT                   /product="Methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24991"
FT                   /db_xref="GOA:Q3B0Y7"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24991.1"
FT                   /translation="MTNSSAVLSRRSLMFAALAGVFGSLWRPKTVLAASKANDPQWDLS
FT                   PEVWRERLSPQAFDVLRNEGTERPFTSPLNDEKRSGNYHCAGCDLALFSSEGKFDSGTG
FT                   WPSFWQPLSEAIETKVDFKLIVPRTEYHCSRCGGHQGHVFNDGPRPTGKRYCNNGVALV
FT                   FRPAT"
FT   gene            19264..20481
FT                   /locus_tag="Syncc9902_0017"
FT   CDS_pept        19264..20481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0017"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24992"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24992.1"
FT                   /translation="MVIGGGAAGFMAAITAAEQGVQSVLVLEGTPELLNKVRISGGGRC
FT                   NVTHACWDPAELVGHYPRGQRALRGMFSRFAAGDAIAWFADRGLVLIEEADGRMFPQQN
FT                   RSEAVIQCLKQAALTAGVQVQTRVMVQRLSAQLEGGFVVGGRGLDQPLLAQKVMLATGG
FT                   HPSGRKMAENLGHQLVPPVPSLFSLSLNASVLAACSGIAVDDVGLDLKLNDQRFRHVGR
FT                   VLITHRGLSGPATLRLSAFAARALHGSRYRGELRVDWSAGLGRSGVEQRLQQWRQVEAR
FT                   RSVGAAKPFDHLPRRLWQAFLNLAGVDGEGRWADFSAKAQRKLIEILCAQCLPIVGRGP
FT                   FGEEFVTAGGVALGDVNLATMESRRCPGLFIAGELLDVDGVTGGFNFQACWSGGWLAGQ
FT                   AIAKAD"
FT   gene            complement(20544..20711)
FT                   /locus_tag="Syncc9902_0018"
FT   CDS_pept        complement(20544..20711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0018"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24993"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24993.1"
FT                   /translation="MTLTQPSSDANNGARQRFELELLLQRTVPNPDQLSRSKDLLQGAI
FT                   PEISPDDWSC"
FT   gene            20801..21475
FT                   /locus_tag="Syncc9902_0019"
FT   CDS_pept        20801..21475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0019"
FT                   /product="putative heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24994"
FT                   /db_xref="GOA:Q3B0Y4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0Y4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24994.1"
FT                   /translation="MSGDASTSAQDQNVESNDVPAIPDVDAGTPIDPVVEETPTLDTEI
FT                   DPANRLQQLEQELNSLKQEHEAVQSQYMRIAADFDNFRKRQARDQDDLRQQLVCSTLTE
FT                   ILPVVDNFERARQQLNPEGEEAQALHRSYQGLYKQLVDVLKQQGVARMEVVGQEFDPTL
FT                   HEAVLREENQEHAEDIVCEELQRGYHRDGRVLRHAMVKVSMGPGPESSSDAASEQPQEG
FT                   DA"
FT   gene            21475..22605
FT                   /locus_tag="Syncc9902_0020"
FT   CDS_pept        21475..22605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0020"
FT                   /product="Heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24995"
FT                   /db_xref="GOA:Q3B0Y3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24995.1"
FT                   /translation="MADYYDLLGVSRDADADSLKRAYRKMARQYHPDINKEAGAEDKFK
FT                   EIGRAYEVLNDPQTRARYDQFGEAGVGGAAGGPDMGDMGGFSDLFETFFQGFGGPGASG
FT                   GRPRRRGPQQGDDLRYDLTIDFEQAVFGQEQEIKIPHLETCDTCGGSGAKPGSSPTTCG
FT                   TCGGAGQVRRATRTPFGSFTQVAECPNCEGTGQVIADPCGACGGQGVHQVRKKLRINIP
FT                   AGVDTGTRLRVSGEGNAGPRGGPSGDLYVFLTVKSHPRLRRDGLNLLSEVKVSYLQAIL
FT                   GDTIEVETVEGKQELDIPAGTQPGTVLTLANQGIPKLGNPVARGDQRITVTVELPKRIS
FT                   DPERELLERLAGHHSARGKQHHHHNSGLFARLFGQK"
FT   gene            22602..22832
FT                   /locus_tag="Syncc9902_0021"
FT   CDS_pept        22602..22832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24996"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24996.1"
FT                   /translation="MTDSRSLDLRGTPCPVNFVRCKLTLETMHPGDQLDVDLDRGEPEE
FT                   MVVPGLRDAGHQVVVSGDDPAWVHLQVTCGG"
FT   gene            22650..22731
FT                   /gene="tRNA-Leu1"
FT                   /locus_tag="Syncc9902_R0001"
FT   tRNA            22650..22731
FT                   /gene="tRNA-Leu1"
FT                   /locus_tag="Syncc9902_R0001"
FT                   /product="tRNA-Leu"
FT   gene            22825..23727
FT                   /locus_tag="Syncc9902_0022"
FT   CDS_pept        22825..23727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0022"
FT                   /product="GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24997"
FT                   /db_xref="GOA:Q3B0Y1"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Y1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24997.1"
FT                   /translation="MADGRDGIVVALQANYLEVELDAAPEGCPARLLCTRRSRLTHRGQ
FT                   EVNVGDRVRVDAIDANAARAVVSEVSPRQSWLTRPPVANVSLVVVALAVDQPAFDPDQA
FT                   SRFLLTAERTGLDVQLVLTKVDLVSAEALTQLCERLRGWGYDPLPLSSESGSGIKVLQK
FT                   RLQSTTLAVLCGPSGVGKSSVLNSLLPHLSLRVGAVSGRLQRGRHTTRHVELFPIGDEA
FT                   RVADTPGFNRPELPDDPHELGVLFPELRRQLDPWPCRFRDCLHRGEPGCGVSKSWERYG
FT                   LYIKALDEVVSLSRPSRGG"
FT   gene            complement(23702..24043)
FT                   /locus_tag="Syncc9902_0023"
FT   CDS_pept        complement(23702..24043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24998"
FT                   /db_xref="GOA:Q3B0Y0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0Y0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24998.1"
FT                   /translation="MAGFGLPNFGQLTEAFRKAQQIQQDAQALQEELDGMEIEGKNSDG
FT                   RASVWLSGNQQPLRVRLDPALVQDGAEACETATLEALQAAYEQSTATMKGRMEELTGGL
FT                   NLNLPGMGG"
FT   gene            complement(24068..24964)
FT                   /locus_tag="Syncc9902_0024"
FT   CDS_pept        complement(24068..24964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0024"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABB24999"
FT                   /db_xref="GOA:Q3B0X9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB24999.1"
FT                   /translation="MTQLSPPHANAKLADYTTWRVGGPAQWLAEPTTIAETIAWVEWAE
FT                   HKGVPCQVIGAGSNLLIHDDGLPGLSLCLRKLQDHSIDVEAGVVEALAGEPIPSLARRA
FT                   ARAGLHGLEWAVGIPGTVGGAAVMNAGAQGGCTADSLISVRVMPKQGGESFDLHCDELD
FT                   FAYRHSRLQADNFVVLSARFQLEPGHDPKELSRVTKENLNHRTTTQPYQQPSCGSVFRN
FT                   PEPQKAGKLIENLGLKGTRIGGAEVSTMHANFIVNIGDAQANDIDALIHLVQDRVEAEH
FT                   GLRLHPEVKRLGFAATA"
FT   gene            complement(24961..26367)
FT                   /locus_tag="Syncc9902_0025"
FT   CDS_pept        complement(24961..26367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0025"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25000"
FT                   /db_xref="GOA:Q3B0X8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25000.1"
FT                   /translation="MPRLLTPQTPVHFIGVGGIGMSALAKILVDRGHPVSGSDPRDNPT
FT                   VQHLESRGVTVFKEQTAECIQSVLATNQQPPVVVISTAIPDTNPELENARAHQLAIWHR
FT                   SDLLAALIDQQASIAVAGSHGKTTTSTLITTLLIEAGEDPTAVIGGVVPCLGSNGHSGQ
FT                   GRLLVAEADESDGSLVKFRPSLGVITNLELDHTDHYDGLDDLISTLQRFGGGCERLIAN
FT                   YDDPILQEHFEPTAWWSNKQSENIAFAALPLQLDGDRCTARFYENGSAVGDFTLPMAGL
FT                   HNLSNATAALAACRMEGIPFEALVEGLAQLQAPGRRFDLRGTWEGRHIVDDYAHHPSEV
FT                   RATLTMAQLMVSSGRSPLPSPPQRLVAVFQPHRFSRTQQFFEAFAEALQNCDALLLAPV
FT                   YAAGEQTIPGVCSNALAQRIRSLRPDLEIEVAENLNQLTDLVKQRSRPDDLVLAMGAGT
FT                   VNSLWGRLTE"
FT   gene            26528..27553
FT                   /locus_tag="Syncc9902_0026"
FT   CDS_pept        26528..27553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0026"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25001"
FT                   /db_xref="GOA:Q3B0X7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25001.1"
FT                   /translation="MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPKTSA
FT                   HLLTYDSILGRLDPSVDIQTTDDTMIINGKEIKFFADRNPLNCPWKDWGVDLVIESTGV
FT                   FNTDEKASMHIQAGAKKVILTAPGKGAGVGTFVVGVNDDQYRHEDWNILSNASCTTNCL
FT                   APIVKVLDQNFGMEWGLMTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAV
FT                   ALVYPEVKGKLTGFAMRVPTPNVSAVDLTFGTSKGATVEQVQAVMKEAAENGMKGIIKY
FT                   SDLPLVSTDYAGTNESTIFDADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKNW
FT                   K"
FT   gene            complement(27609..28604)
FT                   /locus_tag="Syncc9902_0027"
FT   CDS_pept        complement(27609..28604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0027"
FT                   /product="Thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25002"
FT                   /db_xref="GOA:Q3B0X6"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25002.1"
FT                   /translation="MKETLGELGESELLRRLSRFAPPGQLSDDSAALESDPRPIVVNTD
FT                   VLVDGIHFSDVSTKPSDVGWRAVAANLSDLAASGAISVDGITVALVAPGETPWSWVEGV
FT                   YTGLRAALDAYGGVILGGDCSKGSQRLLSITALGRLGPLRLHRGDAKPGDILVTSGPHG
FT                   LSRLGLAILQNDKALHGIDLPDALRTAAVNQHQRPIPRLAALQELLNCKPESLPWRAGG
FT                   TDSSDGLLAAIQGLCSSSECGAVLDEKLLPQSNDWPSGELWDRWCLAGGEDFELVLSLP
FT                   EAWAQRWFDRQPQSRQIGWITAEKNMIRWRHSRRLIDTGGFDHFRTTPIL"
FT   gene            complement(28601..29710)
FT                   /locus_tag="Syncc9902_0028"
FT   CDS_pept        complement(28601..29710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0028"
FT                   /product="putative cyclophilin-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25003"
FT                   /db_xref="GOA:Q3B0X5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25003.1"
FT                   /translation="MPKSHQHWASPLTHQRFKAVLVALISVALFNLAAPAWAGLPQGNA
FT                   VKDPTAILRDALPFEQDDIRQLQHRLELTSDDLRAKRWSALGKTVSRSQALLKTRRNTI
FT                   LDAVPEPLRDQATALLSDVDTGLEQMAAQVKAVDKPAFIVDRRTTLTRIGDVERLLVED
FT                   GFERAIPSEFDALPRLQGRAVVNISTTKGDLTTVVDGYNAPLTSGAFVDLALKGFYDGL
FT                   PFNRAEDFYVLQTGDPEGPEIGYIDPSTKQERHVPLEIRIPSEADTLYNETFEDVGLFK
FT                   ATPTLPFATLGTLGWAHSANELDDGSSQFFMFLYEAELTPAGLNLVDGRNTAFGYVVDG
FT                   FDVLEELGVDDAIKTVTVVDGANQLKAHA"
FT   gene            29743..30303
FT                   /locus_tag="Syncc9902_0029"
FT   CDS_pept        29743..30303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0029"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25004"
FT                   /db_xref="GOA:Q3B0X4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0X4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25004.1"
FT                   /translation="MISSNDFRTGTSIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKSVK
FT                   NGSVVEKTFRAGEMLPQALLEKSSLQHTYMEGDDYVFMDMSSYEETRLTAAQIGDSRKY
FT                   LKEGMEVNVVSWNDTPLEVELPNSVVLEIKETDPGVKGDTATGGTKPAILETGAQVMVP
FT                   LFLSIGEKIKVDTRNDSYLGREN"
FT   gene            30303..30776
FT                   /locus_tag="Syncc9902_0030"
FT   CDS_pept        30303..30776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0030"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25005"
FT                   /db_xref="GOA:Q3B0X3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25005.1"
FT                   /translation="MAMQLDHEQLHRLLEALGESDIQEFRLEGDDFRLEIRRNLPGQTV
FT                   MAPVMQAPVAAAAPVKPLDSASPPPAATSTRSDLLEITAPMVGTFYRAPAPGEPSFVEV
FT                   GTRINVGQAVCILEAMKLMNELESEVAGEVVEILVDNGTPVEFGQVLMRVKPA"
FT   gene            complement(30779..31795)
FT                   /locus_tag="Syncc9902_0031"
FT   CDS_pept        complement(30779..31795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0031"
FT                   /product="Pyridoxal phosphate biosynthetic protein PdxA"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25006"
FT                   /db_xref="GOA:Q3B0X2"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25006.1"
FT                   /translation="MGFPDLISPKQTIVIALGDPAGIGMEVVLKALGSKALPHSIEPVL
FT                   VGCRSSLEAVYQRLKNTTSAALADPAQLTIDDQPLQSAVPSGAPSVEGGAAGFRWLTRA
FT                   VGLLQHSQARALVTAPIAKHLWHAAGHRYPGQTERLAELAGSERSSMLFTAVSPYSAWR
FT                   LNTLLATTHIPLGTVAQTLTPELVNHKLDVLLDFCRRFNPHPHLVVSGLNPHAGEAGQL
FT                   GSEEMTWLTPLIERWRAQHPRIRLDGPLPPDTCWLSAARAWHQPNQPGPDGFLALYHDQ
FT                   GLIPVKLMAFDAAVNTTLELPFLRTSPDHGTGFDIATRGIARPDSMIAAIQAAWELS"
FT   gene            complement(31873..32796)
FT                   /locus_tag="Syncc9902_0032"
FT   CDS_pept        complement(31873..32796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25007"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25007.1"
FT                   /translation="MLSALVKRCRPLPAHARLLVLGGGYSGRCVAKLARQLGTPVLCTR
FT                   RVAGQPDADLIFDSNNGQLPDVSALQGITHLLSTIPPQRQGGDPVISALLPLLKTLSLE
FT                   WAGYLSTTGVYGNRNGEWVQENDPPAPGLDRSRRRLECEQAWLNSGLPVQILRLPGIYG
FT                   PGRSVLDSLRQGKARLINKPGQVFCRIHVEDIAGACWHLIDHSSSNPNDRPSIVNVVDN
FT                   EPTAPADLVRHGVSLLGCELPQEENYDAICSEMSPMGRSFWSENRRVSNKLLCGDLNYS
FT                   LLYPTFREGLQDCLEQDRLNSSSSDP"
FT   gene            complement(33001..33411)
FT                   /locus_tag="Syncc9902_0033"
FT   CDS_pept        complement(33001..33411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0033"
FT                   /product="HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25008"
FT                   /db_xref="GOA:Q3B0X0"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0X0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25008.1"
FT                   /translation="MHNRDAVFLDELCPKLRVRRWRQSLHNHTGKSCIYCGKPSESIDH
FT                   LVPRAKGGLSVTENCVPACLSCNGQKSDSDVFEWYRQQRFYDPRRAMAIRAWLDGDIRL
FT                   ALRLLQWAQPDQPHAPKTHPPKGDPTIGFQAA"
FT   gene            33579..35174
FT                   /locus_tag="Syncc9902_0034"
FT   CDS_pept        33579..35174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0034"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25009"
FT                   /db_xref="GOA:Q3B0W9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25009.1"
FT                   /translation="MITFRCCFDLSPAGLIRVVSPFDAVTQAQLRRIRPRGHWHGPTRG
FT                   WEFPLAAAGILQQQFGRRFTVTAALEEWLAWSRLPLPPLPQHRQLVAAADLKQSLPDGR
FT                   TPLLHQRSGARWLLARRGAVLADEMGLGKTLTVLLAARAMVRCAEVRVLVVAPVGLHPH
FT                   WRREGDAVGLQLQLVSWARLPDALPAAGTLLVVDEAHYAQSMKAQRTAGLLRLARHPRL
FT                   RAIWMLTGTPMKNGRPSQLFPLLAAIDHPIARDQRTFEERYCQGHWREGKAGKRWEAAG
FT                   VSQLEELRRLTRPLILHRRKRQVVDLPPKQRQHHPIVLPDDTSTGFDHRVDLVVEDYRR
FT                   RVQLGEVRSDAEPLAVLTAMRQIAAEFKLSAAEQLLYQLHQQGHAVVLFSAFVAPLQLL
FT                   HQRIGGELMTGRQRPLERQQSVDRFQQGKSNCLLATYGTGSLGFTLHRARHVVLLERPW
FT                   TPGDLEQAEDRCHRLGMGDGLTCHWLQLGPADQLVDGLLASKAERIEVLLGPRRQSLER
FT                   QSLPAMVRACLQVA"
FT   gene            complement(35514..35867)
FT                   /locus_tag="Syncc9902_0035"
FT   CDS_pept        complement(35514..35867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25010.1"
FT                   /translation="MGGTQPVQAGQQSEDKGAKIYCFMRSSGNDHSVSWNAAYAVIKRQ
FT                   GGQLFKTSPEHASVMITEAVVQDPGNFPDCGRFLGDLFGGSPNKASITSLGTSTTDTTN
FT                   SESNSVDDERYSY"
FT   gene            complement(35984..36517)
FT                   /locus_tag="Syncc9902_0036"
FT   CDS_pept        complement(35984..36517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25011"
FT                   /db_xref="GOA:Q3B0W7"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25011.1"
FT                   /translation="MAAEISMSPLATLMLYLVAGTSLGLLALLSGIPAAPLAGALLGAG
FT                   IVSMSGRLDQAVWPTGTRTILEIGIGTVIGTGLTRASLEQLQILWRPALLITVTLVLTG
FT                   IVVGLWSSRLLGIDPVVALLGAAPGGISGMSLVGAEFGVGAAVAALHAVRLITVLLVLP
FT                   LVVRLILPSSLGQP"
FT   gene            36581..36877
FT                   /locus_tag="Syncc9902_0037"
FT   CDS_pept        36581..36877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25012"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25012.1"
FT                   /translation="MTSSVSFRITRTAEDLAQTMTALSQRLVKIEQRQEVMELQLRQQL
FT                   KDVNNVPDEELATLDGIETLLRETRELLESTDLNGCDAISHDQNDEVELAEAA"
FT   gene            36898..37146
FT                   /locus_tag="Syncc9902_0038"
FT   CDS_pept        36898..37146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25013.1"
FT                   /translation="MKRKATMASTIPASHACNSLKPARTLHGMTIWSKSGFLEGGHQLE
FT                   KLEFALAHAEAKGDATRCSELQDRIADLGGNAEEPGT"
FT   gene            37279..37476
FT                   /locus_tag="Syncc9902_0039"
FT   CDS_pept        37279..37476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25014"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25014.1"
FT                   /translation="MRSESTSDKRQDHELAARDLFERARQCAEAGQTSDAGSLILKALS
FT                   HERRAGAVGPQVMQIIKPRS"
FT   gene            complement(37604..38797)
FT                   /locus_tag="Syncc9902_0040"
FT   CDS_pept        complement(37604..38797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0040"
FT                   /product="soluble hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25015"
FT                   /db_xref="GOA:Q3B0W3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25015.1"
FT                   /translation="MRCCFLESRIGIPHAMQDKLTLMIPGPTPVPETVLKAMGRHPIGH
FT                   RSGEFQTIVRRTTEQLKWLHQTSSDVLVITGSGTAAMEAGMINTLSRGDKVLCGDNGKF
FT                   GERWVKVARAYGLEVDVVTAEWGQPLDTEAFRAALEADTEKQIKAVILTHSETSTGVIN
FT                   DLETIARYVKAHGTALTIADCVTSLGACNVPMDAWGLDVVASGSQKGYMLPPGLSFVAM
FT                   SDRAWAAYATSDLPKFYLDLGPYRKTAAKDSNPFTPAVNLYFGLEAALEMMQKEGLEAI
FT                   FARHARHRAAAQAGMEAIGLPLFAAQGHGSPAITAVAPEGLDAELLRKTVKEKFDILLA
FT                   GGQDHLKGKVFRIGHLGYVCDRDVLTAVSAIEATLQSLGLHKGTMGSGVAATSAALS"
FT   gene            38827..39915
FT                   /locus_tag="Syncc9902_0041"
FT   CDS_pept        38827..39915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0041"
FT                   /product="Cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25016"
FT                   /db_xref="GOA:Q3B0W2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0W2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25016.1"
FT                   /translation="MSSGLTLPVWVAAAAKASLHALLGQPFAAQASVSLPDRPAPLLVP
FT                   VISAARLDGGEQALAISRCDPGPGLDLTRDLEIWVRVSWTPDKQAGLTLLAGAGVGTRG
FT                   AGGDLCVSAYARDLLERNLLPLDRGLTVEVVLPKGRELALRTSNAAFGVVDGLALIGTQ
FT                   AEVQRSAAPDQLKQVLLDLAQLTGDPEFRGDLILVIGENGLDLARQAQLAPLLKVGNWL
FT                   GPVLVAAAEAGVQNLLLLGYHGKLIKLAGGIFHTHHHLADGRLEVLTALGFDAGLSLQQ
FT                   LRLLRHAQSVEQAFKALAAVNPAMAEQLGQQLALAVEQRSQAYVARYGDWPMRIGAVLF
FT                   DRNRHLRWRGPVAGERFFTLMD"
FT   gene            39948..41534
FT                   /locus_tag="Syncc9902_0042"
FT   CDS_pept        39948..41534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0042"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25017"
FT                   /db_xref="GOA:Q3B0W1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0W1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25017.1"
FT                   /translation="MSQPSSDGQRQPAIVILDFGSQYSELIARRVRETEVFSVVIGYST
FT                   TADELRRMAPKGIILSGGPSSVYAEHAPVCDPAIWDLGIPVLGVCYGMQLMVQQLGGAV
FT                   EAATGKAEYGKAPLEVDDPTDLLNNVENGSTMWMSHGDSVKALPEGFVRLAHTANTPEA
FT                   AVANLERKFYGVQFHPEVVHSTCGMALIRNFVNHICGCEQDWTTNAFIDEAVALVREQV
FT                   GQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMEFFDQKFNIN
FT                   VEYINARKRFIDKLKGITDPEDKRKIIGTEFIRVFEEESKRLGPFDYLAQGTLYPDVIE
FT                   SAGTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRNLGLPEE
FT                   IVRRHPFPGPGLAIRILGEVTDEKLNCLRDADLIVREEIRDAGLYHDIWQAFAVLLPVR
FT                   SVGVMGDQRTYAWPIVLRCVSSEDGMTADWSRLPYDLMERISNRIVNEVKGVNRVVMDI
FT                   TSKPPGTIEWE"
FT   gene            41718..42437
FT                   /locus_tag="Syncc9902_0043"
FT   CDS_pept        41718..42437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0043"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25018"
FT                   /db_xref="GOA:Q3B0W0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25018.1"
FT                   /translation="MSPPSSSVGFQGDEFLRGEADAWFERNHSHGKVSSAMRLLGEWCA
FT                   PHKSEVGRILEIGAGTGLPLAFLSDFLEADGVGIEPSKQAVENWETLRHEVGGGARVSM
FT                   SVGLASDLPFEDKSFDLVLFGFCLYLVDRSLLYRAVAEADRVLRDGGFLAIHEFDSQSA
FT                   YANEYSHRQGILSYKNDYSNIFTSSGHYYLVSKHSHAHLAEHFAPDIDERVSLSLLYKQ
FT                   ESAVYAFGRRFPRSSGS"
FT   gene            42577..43260
FT                   /locus_tag="Syncc9902_0044"
FT   CDS_pept        42577..43260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25019.1"
FT                   /translation="MGMMPALAWPWTIGRTLRQQGNPIRANASRRIFLIGHNKCGTRSF
FT                   NKLLNKNGYSSIHYDKGRLAKRIQANFIFSRPLLDGVDQYCGYTDMELCGEFYAYRLFP
FT                   LLDLQYPGSCFIYNTRDVSRWVDSRLNHRSGKYARTYLKRMQRAFEDSSLTMDDLRQHW
FT                   HEAWQRHDADLRSYFAGRNNFFAFDITVPQEQAALCRFLRRRGYRIRGNALPHSGARPS
FT                   PVENR"
FT   gene            43319..43930
FT                   /locus_tag="Syncc9902_0045"
FT   CDS_pept        43319..43930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25020"
FT                   /db_xref="GOA:Q3B0V8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25020.1"
FT                   /translation="MTATQQQDLQLQRRLQQDSIQLGGRTIYLNPFLYWRRFDSNTDRW
FT                   LREPGQLTDDQTRVNRSRFYPELDWTGLDEHQTAVYDGAVEMFLKSLDLISTFHPELGA
FT                   GQMLEVERKMTITKKRAFERWVDKAIRRRQRDEYRETRRFERSRVWREWREWIAMDTTQ
FT                   KALVPLVMLMVLGGVAGWSFGAAQSACPTLSLPSGQTGVR"
FT   gene            43940..44311
FT                   /locus_tag="Syncc9902_0046"
FT   CDS_pept        43940..44311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25021.1"
FT                   /translation="MATDSGSDNPLDQLRLSLMQDVLPVGLAVFERARQGGAGRVAEVF
FT                   TGGSTDPIAELRQEGEPVARDVREQLDSVSPGLGNPVMPVSVSVEEPNTTSDERDDLNL
FT                   ALQRIENRLDALRRLLPAD"
FT   gene            44315..46162
FT                   /locus_tag="Syncc9902_0047"
FT   CDS_pept        44315..46162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0047"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25022"
FT                   /db_xref="GOA:Q3B0V6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25022.1"
FT                   /translation="MASAQQRQTGLRQQPLVLLMVVLVFCSAMVSRLVWMQLLEGPRFK
FT                   ELADENRIRLVPRSPIRGRLLDRKGRVLATSKLTYSLYLEPRLVSDVDWPELRNRLTSL
FT                   LNLDPLLLDQRRDRGTDRDGYRTTLMLDLKPEQVLRFREQALALRGAQVDVDILRFYPH
FT                   GSLAAHALGYTQPITESEYDALVEKGYKIRDRIGRTGVEAAYETHLRGKWGGQMLEVNA
FT                   MGEVQRNLGDRPSESGQDLTLTVDLDLQRAAEQALANKPGGAVVALEAKTGAVLALASK
FT                   PGFDPNFFSKLITTQKEYDALFLNPKKPLLSRAMNPYDPGSTWKPVTAMAGMESGKFPP
FT                   TTKLHTQACITYGGHCFPDHNGAGFGHIGYADALRFSSNTFFYQVGVGVGSRALKKAAN
FT                   QLGFQQKTGIEIDWEESVGLVGDEDWAEKGRGWADPGSTPWIPEDMASASIGQSVVQIT
FT                   PLQLARAYAVFANGGWLVTPHLAKGEIDWMAPQYRRAVLIKPSTLNTIRKGLRKVVEDG
FT                   TGYGLNGPGIPLAAGKTGTAEDSTGGPDHAWFGCYAPYPDGKIVVVAFAQNTPGGGSVH
FT                   ALPMAKKVLAAWEQSRKKADSSGSSVQRPLAEDVAVIAP"
FT   gene            complement(46106..47254)
FT                   /locus_tag="Syncc9902_0048"
FT   CDS_pept        complement(46106..47254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0048"
FT                   /product="SqdX"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25023"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25023.1"
FT                   /translation="MKIAFFTETFLPKVDGIVTRLTKTVKHLVDAGDEVVVFCPEGCPD
FT                   EYMGARLIGVPAMPLPLYPELKLALPRPAVSEAIDTFEPDLIHVVNPAVLGLGGIWLAK
FT                   TKNIPLIASYHTHLPKYLEHYGMGMLEPLLWELLKAAHNQALLNLCTSTAMVQELSDKG
FT                   IQHTALWQRGVDTELFRPALRSNAMRHRLLGGHDDRGALLLYVGRLSAEKQIERIRPVL
FT                   EALPDTRLALVGDGPHRQQLEKHFAGTATTFVGYLAGEDLASAYACGDAFLFPSSTETL
FT                   GLVLLEAMAAGCPVVGANRGGIPDIITDGVNGCLYEPDGEDGGAASLIEATQRLLGNDL
FT                   ERQSLRSAARSEAERWGWAGATEQLRGYYRDVLSQGTLDAAA"
FT   gene            complement(47269..48465)
FT                   /locus_tag="Syncc9902_0049"
FT   CDS_pept        complement(47269..48465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0049"
FT                   /product="UDP-sulfoquinovose synthase"
FT                   /EC_number="3.13.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25024"
FT                   /db_xref="GOA:Q3B0V4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25024.1"
FT                   /translation="MKVLVLGGDGFCGWPCAVNLADQGHEVLIVDNLSRRKIDVDLEVD
FT                   SLTPITSIGERLQAWEEIGGKPMRFIHMDVAHEYQRLLDLLRDEKPNSVVHFAEQRAAP
FT                   YSMKSSATKRYTVDNNVNGTHNLLAAIVESGLDIHVVHLGTMGVYGYGSHRGATIPEGY
FT                   LKVEVPQPDGSRFEEEILHPASPGSVYHMTKTLDQLLFLYYNKNDKVRITDLHQGIVWG
FT                   TNTEATDRDPRLTNRFDYDGDYGTVLNRFLMQAAIGYPLTVHGTGGQTRAFIHIRDSVK
FT                   CVQIALDNPPEQGERVKIFNQMTESHQVGELANKVAALTGAKVNNLPNPRNEAVENDLI
FT                   VDNRCFIELGLNPTTLDDGLLKEVVEIATRYSDRCDRNRILCTSAWTKDQAKAIGNAS"
FT   gene            complement(48541..48714)
FT                   /locus_tag="Syncc9902_0050"
FT   CDS_pept        complement(48541..48714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0050"
FT                   /product="high light-inducible protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25025"
FT                   /db_xref="GOA:Q3B0V3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25025.1"
FT                   /translation="MQVTTEDGGLLNAFAKEPRMEVMDQNASRDRNRSSLMMLIGGSIL
FT                   VTGLIAITVVIS"
FT   gene            complement(48792..49613)
FT                   /locus_tag="Syncc9902_0051"
FT   CDS_pept        complement(48792..49613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0051"
FT                   /product="thiamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25026"
FT                   /db_xref="GOA:Q3B0V2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0V2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25026.1"
FT                   /translation="MVSTSNGSDPLTIGGRLFSCRLLTGTGKYPSINSMQSSIERSACE
FT                   MVTVAVRRVQTGAAGHTGLMEAIDWSRIWMLPNTAGCTNAEEAIRVARLGRELAKLAGQ
FT                   EDNNFIKLEVIPDSRHLLPDPIGTLQAAEALVKEGFTVLPYINADPLLAQRLEEVGCAT
FT                   VMPLGSPIGSGQGLNNAANIALIIENATVPVVVDAGIGVPSEAAQAMEMGADAVLVNSA
FT                   IALAGDPPSMAEAMGKAVIAGRMAYSSGRLPRRGQASASSPTTGLISGKDK"
FT   gene            49665..50210
FT                   /locus_tag="Syncc9902_0052"
FT   CDS_pept        49665..50210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25027.1"
FT                   /translation="MPFLLAMDLPVGSQVPFQTNPQLPLDPIQLAIPLEVDQNQVESFD
FT                   PVARAADLVTTLPRQWCGTFQPFDGSPTVDVTLDLSDLKAIGQIVDLRGTMTLGSVTTP
FT                   VQGNFHAKSDQLDLIPLGDELIAGVEPGGVFLGLQGFSPTGWQSPRLINDVDPSAGLGG
FT                   RLALTSTCQAELPIQPLW"
FT   gene            complement(50232..50747)
FT                   /locus_tag="Syncc9902_0053"
FT   CDS_pept        complement(50232..50747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0053"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25028"
FT                   /db_xref="GOA:Q3B0V0"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0V0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25028.1"
FT                   /translation="MNLLPQTYLLGLVGLLTVVAVIVGRQLLRVRRDEARFVQLEQAGT
FT                   AASRQSADLYELGSVQLRKRLYPQAAATLKQALKRLSDEPNEARALIENALGFALAAQK
FT                   DYDTAIKHYKLALRAKDDYPVAINNLAFAQEKLLKYEEAIALYKKTLELEPNNSTAKKG
FT                   IKKLEKRS"
FT   gene            complement(50757..51104)
FT                   /locus_tag="Syncc9902_0054"
FT   CDS_pept        complement(50757..51104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0054"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25029"
FT                   /db_xref="GOA:Q3B0U9"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0U9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25029.1"
FT                   /translation="MARVKRGNVARKRRNKILRLARGFRGGNGTQFRTANQRVMKALCN
FT                   AYRDRRRRKRDFRRLWIARINAAARINGVSYSRLMGGLKKADVRINRKMLAQLAVADPA
FT                   SFTTVVTAAKS"
FT   gene            complement(51158..51355)
FT                   /locus_tag="Syncc9902_0055"
FT   CDS_pept        complement(51158..51355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0055"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25030"
FT                   /db_xref="GOA:Q3B0U8"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0U8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25030.1"
FT                   /translation="MPKLKTRKAAAKRFKATGTGKFLRRRAFRNHLLDHKTPKQKRHLG
FT                   TKAVVDRTDVERVTLMMPYA"
FT   gene            51413..52960
FT                   /locus_tag="Syncc9902_0056"
FT   CDS_pept        51413..52960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0056"
FT                   /product="possible amidase enhancer"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25031"
FT                   /db_xref="GOA:Q3B0U7"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25031.1"
FT                   /translation="MIRLLSLSMLLGLASGCGARELAAPSPSDEVPVVVVPATHRSVPR
FT                   PPQLSRAEPVLWVALQDHLGSHPAAMPLQLSSAGAPLTLEDGAGRSWTAASFTVRWRAM
FT                   ALPEPVTLARRIAGPFASFESAERFAQRWRALGVTVSVAHPKDWEVWAPQGSIVPEGAQ
FT                   VRDWTRRVHATVEPTLETPEGIQPMKGPLQIAAPDGLLWKRGVFRGPFRLQPDAYGSWT
FT                   LIEQVAVERYLEGVVPHEIGASSPVAALQAQTVLARTWALANSHRFNIDGYHLCSDTQC
FT                   QVYSDPRSAGAEVRQAITATKGRLLSRAGRPISAVYHATNGGVMAAGPEAWAMKPQPYL
FT                   VSKVDGDEGWRERHAIPLQRSQKVSSLLMDRSGAYGAQHPLFRWSRVITADQIRQAIGA
FT                   PAQALQSPLRLNALQRGTSGRVLALQVAGSGESEPVVLRLDQIRRTLRRLPSTLFVIEP
FT                   QGWDRWLIRGGGFGHGAGLSQAGAIDLAWRGWSTERILSHYYPGTVYGPLPARVQSP"
FT   gene            52985..54316
FT                   /locus_tag="Syncc9902_0057"
FT   CDS_pept        52985..54316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0057"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25032"
FT                   /db_xref="GOA:Q3B0U6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25032.1"
FT                   /translation="MTSTAATGDHRRAKSAAFLFACGCAGAAPHWLDSARSLWPAISLA
FT                   LMLGGYALRTVLRAELLRGPSTQGPPTSALFPVEEFPTLDVVVAARDEEAVVARLVERL
FT                   TALRYPTDRLSTWVIDDGSLDQTPALLDALAENHPTLNVIHRPRDAGGGKSGALNTALA
FT                   QLKGEWLLVLDADAQLQDDLLERLVPYAVEGGWSAVQLRKAVIDADRNWLTRSQAMEMA
FT                   LDAVIQTGRLTGGGVVELRGNGQLIKRSMLEASGGFNEDTVTDDLDLSFRLLTHGALVG
FT                   ILWDPPVQEEAVPGLSALLKQRQRWAEGGLQRFFDYWPTLTSSQLSVRQRWDLACFFLL
FT                   QYGLPVVSFADLSTSLVTRTPPTYWPLSIVAFSVSALAYLRGCRGVNQGPSIPAPGLWN
FT                   LLVAITYLGHWFVVIPWVTLKMALLPKRLVWAKTSHGDLSEQLG"
FT   gene            complement(54450..56327)
FT                   /locus_tag="Syncc9902_0058"
FT   CDS_pept        complement(54450..56327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0058"
FT                   /product="DNA polymerase III, tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25033"
FT                   /db_xref="GOA:Q3B0U5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25033.1"
FT                   /translation="MSSTYQPLHHKYRPQRFDQLVGQEAITATLGNALTSNRIAPAYLF
FT                   SGPRGTGKTSSARILARSLNCQNSDGPTPEPCGTCDLCRTIASGTALDVIEIDAASNTG
FT                   VDNIRELIERSRFAPVQARWKVYVVDECHMLSTAAFNALLKTLEEPPPQVVFVLATTDP
FT                   QRVLPTILSRCQRFDFRRIPLDALEQHLTWIAEQESIAIQPEAIHVVAQRSQGGLRDAE
FT                   SLLDQLSLLPPPIEANAVWDLLGAVPEQELLALAQAMTSSEPVALLEATRNLLDRGRDP
FT                   GAVLQGLAGVLRDLVLMAAAPNRPELTGVSPQFRDQLPELAKSIGRTRLLQWQAQLRGA
FT                   EQQLRQSVQPRLWLEVLLLGLLAEPMSPALATAPRTPQATPAPAAVPVLVTADAPTPTA
FT                   TTPAATTPATPSPSPAQAKTPELPTVAAVAPTPATSGTNLPELWQQILGSLELPSTRML
FT                   LSQQAQLVRLDANRAVVQVAGNWMGMVQSRASLLEQAVAKALGGSRQLIIEASTSAIAA
FT                   TSAPTAPLVQPPPQTAPAPVETETPQLPKTEVVPAVVDASTPITRLTTQEPAKPPATPS
FT                   PVAISQPVQAEPAQNPANPSPALGLDRQAKNLADFFNGQVLDVDTDGIG"
FT   gene            complement(56351..56986)
FT                   /locus_tag="Syncc9902_0059"
FT   CDS_pept        complement(56351..56986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25034"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25034.1"
FT                   /translation="MSTADHLQVPRRHGLFNHHGIDLGDGTVAHYLEGREILRSPVSEF
FT                   SQGEVVSVMEHTNASPTGVTLRRAMSRLGEQNYNLLFNNCEHFATWCKTGRHRSEQVDS
FT                   VIDRARQWSRQMPSALLSGLDLLVRRGVLDDNTRQIASQGLTKLEQLRQTLLQKLEGLL
FT                   QQMGSDGNKQLLLTGQSLADELAAVEDLQRKIDALLNQPRKLPGSKAE"
FT   gene            complement(57130..58395)
FT                   /locus_tag="Syncc9902_0060"
FT   CDS_pept        complement(57130..58395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0060"
FT                   /product="Peptidase, metallopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25035"
FT                   /db_xref="GOA:Q3B0U3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25035.1"
FT                   /translation="MRIIEPIFLISEDLANITKEILKEDDILDIYIHNDAGPVTISGGS
FT                   FGSQDINTVKWDPQDEQFLRDVVEGIDESIDLDFNFTSNQSTADVAIFLDTEISLDDGG
FT                   DTLGLAVSNRNNSNGYFWEIFLNEPKFDGDQDYFRYALIHEIGHTLGLEHPFEDNDGDV
FT                   VDGITDPWKSLYPEDTVMAYRNPANGRWPNDYTSNDKAALIELWGQETNPTPSVTPEKP
FT                   NGLSAQVMDSNSTRFKGTSKADWIIGNDGNNTIKAKGGNDYLQGGLGNDRLNGNNGNDT
FT                   LRGGDGDDIIHGGKGSDIIRGGRGADVLYGNSGQNTFSSTADGSTDIINIQCEQHSSKK
FT                   RRKKAMNKKQGTNTFDIIEELDANDQINLIGAKNKSISVQETIALGETGVGIFAKGSLE
FT                   ALYIGDELSSAQVLNMTTGLNK"
FT   gene            complement(58475..59827)
FT                   /locus_tag="Syncc9902_0061"
FT   CDS_pept        complement(58475..59827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0061"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25036"
FT                   /db_xref="GOA:Q3B0U2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25036.1"
FT                   /translation="MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDE
FT                   ELVDSQGNPRAGAEPSRKATPAAHKSNKPAPTLASIPKPLEIKSFLDQQVVGQNAAKKV
FT                   MSVAVYNHYKRLAWQGDGKGETEETATRLHKSNILLIGPTGCGKTLLAQTLAEMLDVPF
FT                   AVADATTLTEAGYVGEDVENILLRLLQKADMDVDQAQRGIIYIDEIDKIARKSENPSIT
FT                   RDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVV
FT                   QKRMGRNAIGFMPPADSRGRSRANRDLQAAQVLRNLEPDDLVKYGLIPEFIGRIPVSAV
FT                   LEPLDEKTLESILTEPRDALVKQFRTLLSMDNVQLQFADDAITAIAQEAHRRKTGARAL
FT                   RGIIEEIMLDLMYDLPSQSSVKDFTVTRSMVEEHTGGKVLPLPGTDQQKTA"
FT   gene            complement(59916..60539)
FT                   /locus_tag="Syncc9902_0062"
FT   CDS_pept        complement(59916..60539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0062"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25037"
FT                   /db_xref="GOA:Q3B0U1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25037.1"
FT                   /translation="MPISAPGPLPTVVEQSGRGDRAFDIYSRLLRERIIFLGTGVDDAV
FT                   ADALVAQMLFLEAEDPEKDIQIYVNSPGGSVTAGLAIYDTMQQVAPDVVTICYGLAASM
FT                   GAFLLSGGTKGKRLALPNARIMIHQPLGGAQGQAVDIEIQAKEILFLKETLNGLLAEHT
FT                   GQPLDKISEDTDRDYFLSPAEAVEYGLIDRVVDSSGDEGIVTDG"
FT   gene            complement(60634..61977)
FT                   /locus_tag="Syncc9902_0063"
FT   CDS_pept        complement(60634..61977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0063"
FT                   /product="Trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25038"
FT                   /db_xref="GOA:Q3B0U0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0U0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25038.1"
FT                   /translation="MSAATLKVSTESRPSSRLAVTVTVPGERCTASYEEAIKSLSRSIN
FT                   LPGFRKGKVPRSVLVQQLGGVRIKATALEKLIDSAWRDAIKQESLEPISQPDLSSGFDG
FT                   LLESFNPGDELTFTLEADVAPTPKLKSTKGLKAEYEAVVYDASRVDSMIEDSRKQLATV
FT                   VPVEGRAAEKGDIAVLGFKGTYSDDGSEIEGGSADSMDVDLDNGRMIPGFIEGVIGMKV
FT                   GESKSVDCQFPDDYPKEDARGRKAAFAIELKDLKTRELPELDDAFAKQASEQDTMADLR
FT                   KDLEQRLKDDAERRQTSNRNDGLVKALVEQLEVDLPEALIQQESRNLVEQTAAQFAQQG
FT                   MDVKSLFTPDLIRNLMQNSRPEAEERLRRSFALTALAEAEDIKLDDSAIDTKLKEVKKD
FT                   LSADAKVDPERLRQAVMDDLMQEQLMSWLETNSTLTEKAPEPESDTKS"
FT   gene            62146..63168
FT                   /locus_tag="Syncc9902_0064"
FT   CDS_pept        62146..63168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0064"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25039"
FT                   /db_xref="GOA:Q3B0T9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25039.1"
FT                   /translation="MKATLPNRPLNVAVLGASGAVGQELLLLLEERQFPVGELKLLASA
FT                   RSAGQQQTWNGRHLVVEEVTAEAFQGVDLVLASAGGSVSRQWREAITSAGALMVDNSSA
FT                   FRMEAEVPLVVPEVNPQAAHGHQGVIANPNCTTILLTLALAPLAAKRALRRVLVSTYQS
FT                   ASGAGARAMDELKDLSRVVLDGGVPNSKVLPYSLAFNLFLHNSPLQDNSYCEEEMKMVN
FT                   ETRKIMDLPDLRFSATCVRVPVLRAHSEAVNIEFEQPFPVDEARQLLAAAPGVELIEDQ
FT                   AVNRFPMPTDVTGRDPVAIGRIRQDISDPNALELWLCGDQIRKGAALNAIQIAELLIQN
FT                   "
FT   gene            63168..64076
FT                   /locus_tag="Syncc9902_0065"
FT   CDS_pept        63168..64076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0065"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25040"
FT                   /db_xref="GOA:Q3B0T8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0T8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25040.1"
FT                   /translation="MTLSASLSPQPFGRIVTAMVTPFDSSGAVDFQLAARLARHLVEQG
FT                   SDGLLVCGTTGESPTLSWDEQLKLLEAVREAVGSSAQVLAGTGSNSTSEAVKATREAAA
FT                   VGADGALVVVPYYNKPPQEGLEVHFRAIAEAAPTLPLMLYNIPGRTGCHIEAETVACLM
FT                   DCPNIVSFKAASGTTEEVTALRLACGSRLAIYSGDDGLTLPMLSVGAVGVVSVASHVAG
FT                   PQIRAMIDAYVEGEVGAALAQHEQLIPLFKALFATTNPIPVKAALEINGWSVGAPRPPL
FT                   SSLPEAMRTTLSNTLSALRQT"
FT   gene            64129..66201
FT                   /locus_tag="Syncc9902_0066"
FT   CDS_pept        64129..66201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25041"
FT                   /db_xref="GOA:Q3B0T7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25041.1"
FT                   /translation="MAYNARSGKEQEPCLRVIPLGGLHEIGKNTCVFEYGDDLMLVDAG
FT                   LAFPSDGMHGVNVVLPDTSFLRENQKRIRGMIVTHGHEDHIGGIAHHLKHFNIPVIHGP
FT                   RLALSMLTGKMDEAGVTDRTTLKTVAPRDVVKVGQHFSVEFIRNTHSMADSFSLAITTP
FT                   VGTVIFTGDFKFDHTPVDGEHFDMARLAHYGEKGVLCLFSDSTNAEVPGFCPPERSVFP
FT                   NLDRHIANAQGRVIVTTFASSIHRVSMILELAMKNGRKVGLLGRSMLNVIAKARELGYM
FT                   RAPDELFVPIKQINDVPDRETLLLMTGSQGEPLAALSRISRGDHPQVKVKTTDTIIFSA
FT                   SPIPGNTISVVNTIDKLMMLGAKVVYGKGEGIHVSGHGFQEDQKLMLALTKPKFFVPVH
FT                   GEHRMLVQHSKTGHSMGVPVNNTLIIENGDVVELTPDSLRKGDPVKAGIELLDQSRNGI
FT                   VDARVLKERQQLAEDGVVTILSAISTDGAMVAPPRVNLRGVVTTADARKMSLWTEREIT
FT                   WVLENRWKQLSRNTGGNAPEVDWMGVQREVEVGLGRRMRRELQVEPLILCLVQPAPGGT
FT                   PTYKGRADAEPDDRPASRNRGGGAGRGVVRRNGAPPAPVRTNGSSVAAPSKTASVVISS
FT                   DVATSTAVATPAVAVAAPAATTAVATKVISKAEKTAEPEQDMPAGRTRRRRSAAV"
FT   gene            complement(66229..66963)
FT                   /locus_tag="Syncc9902_0067"
FT   CDS_pept        complement(66229..66963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25042.1"
FT                   /translation="MDADFQQTYQAAEHAYGGGDYKTAHHLASGLLKQLETEERADDDQ
FT                   LRDAVLGWRAFVALLLGHIELHGRQRPDQAANYYQLTLDCQPKDTLAELARQGLKRSKS
FT                   ARKETFNANVDEPTTPPSSDGESSTGSLPSMLQDPFLTNTPPVSTSAPSQSTAMPWLTK
FT                   VNSPPQVRETPAPEPKQTDPSVRSNPDTSEPVISAHEEPSHKEQPLPLLIPEESLERAW
FT                   LRVSITPNRTRSDSIPMDRAKP"
FT   gene            complement(67000..68805)
FT                   /locus_tag="Syncc9902_0068"
FT   CDS_pept        complement(67000..68805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0068"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25043"
FT                   /db_xref="GOA:Q3B0T5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25043.1"
FT                   /translation="MALLVQKFGGTSVGSVERIQAVAQRIARCRENGDDVVVVVSAMGH
FT                   TTDELTGLANALNDSPAQREMDMLLASGEQVSSALLAMALHSEGVAAVSMTGPQVGIAT
FT                   ESTHGRARILEIRTDRIRTRLSEGKVIVVAGFQGTSTSSDGIHEITTLGRGGSDTSAVA
FT                   LAAALGADACEIFTDVPGVLSTDPRKVADAQLMDSISCDEMLELASLGASVLHPRAVEI
FT                   ARNYGVNLVVRSSWSDAAGTKLTSRTARPIGHGGLELGSPVDGVEQVDGQAILALSRIP
FT                   DQPGIAARLFETLSDAGINVDLIIQATHEGTSNDITFTVNEPDLDQAREVTQRVLNSLG
FT                   GELSSEGGLTKLSISGAGIMGRPGIAASLFNCLCQQGINLRLIATSEVKVSCVIAASSG
FT                   RKALQAVREAFEVADSQVAINPPLSGENEPEVRGVALDRDQVQLSVRHVPDRPGTAAAL
FT                   CSSLADNSISIDAIVQSERQHADDSRDISFILRKEDRARADVALAPLLAQWPGAALEDG
FT                   DAIARVSAVGAGMRATAGTAGRMFRALADAQINIGLIATSEIRTSCVVAEENGVQALQV
FT                   VHACFGLGGDERHQAQGSASPLEKT"
FT   gene            68949..69236
FT                   /locus_tag="Syncc9902_0069"
FT   CDS_pept        68949..69236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25044.1"
FT                   /translation="MVGGFELHVVAQHRRELQGFSWLWWAQAGSSLLGSVSLAAGDSLV
FT                   VSLGAAGTGGVGPRHRLPYLAFGVAPCLSGAAPSTAGDSHLGNAVAGNGR"
FT   gene            complement(69543..70748)
FT                   /locus_tag="Syncc9902_0070"
FT   CDS_pept        complement(69543..70748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25045.1"
FT                   /translation="MLFQRESKIAASIYKDWAKQAINSNNMEYGEFWGRYWNNNKEIFC
FT                   DPEFYLSFFDHERWNVKEFCDHNNPFYIKYSKGNYQAQINLFRTISILTQTILSGFFKN
FT                   NFEACPMLLDLFSALNSNFPLIFPGDPQYPVYYDDTRIKMHQRFKDKRIVTTMFGNRDV
FT                   HNFYSFALCHFTLNKTLEYNDKKRSIVEIGGGYGGLCCLNLLHNKEIEYVLVDLPEASC
FT                   IQLFVLLSIQDILGCDIEVLLEEEKWIKFPLNEKSEPTLKRVRIVPSNLFHSTEIQNIH
FT                   TEVDAVLNFKSMMEMPPSELNKYFNFINQMPINSYFIATNRYTKISNLVDYPLSDFWQF
FT                   EYSYPHVIMAWHHDFVLKKINSDTERFQDFYKQRINMYHEIWKKYNGIPPAEGFMINNL
FT                   FS"
FT   gene            complement(71064..71258)
FT                   /locus_tag="Syncc9902_0071"
FT   CDS_pept        complement(71064..71258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0071"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25046"
FT                   /db_xref="GOA:Q3B0T2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25046.1"
FT                   /translation="MALLVQKFGGTSVGSVERIQAVAQRIARCRENGDDVVVVVSAMGH
FT                   TTDELTGLAIASCYGRWAT"
FT   gene            complement(71301..72266)
FT                   /locus_tag="Syncc9902_0072"
FT   CDS_pept        complement(71301..72266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0072"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25047"
FT                   /db_xref="GOA:Q3B0T1"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25047.1"
FT                   /translation="MPIHLIWGDDAAARDRAIDGLIQSCVDPSWSSLNLSRLDGAETGQ
FT                   AIQALEEARTPPFATGERLVLLQRSPFCNGCPSELADRFEAALELIPNSSHLVLVNPSK
FT                   PDGRLRTTKTLQKRIKQGLDLEQSFPLPTAWDGAGQRQLVQRTADALSLTVEPDAIDAL
FT                   VEAIGTDSARLESELRKLSLRTTTITAALVKELVGGRATNALAVGDALLDGNAGEAIAR
FT                   WDALIDAGEPALRIVATLTGQLRGWLWVSLLEQQGERDVAVIAKAAGIGNPKRIYVMRK
FT                   QLQGRQPKRLLSLLGRLLEVEALLKRGALPGNAFRDGLLG"
FT   gene            72276..72923
FT                   /locus_tag="Syncc9902_0073"
FT   CDS_pept        72276..72923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0073"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25048"
FT                   /db_xref="GOA:Q3B0T0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25048.1"
FT                   /translation="MAGMAQDHPIFTESIRRIRALLGDTGLQPLEQEVLERLVHSSGDP
FT                   SIAELLRFSQGACEAGLSALQSGAVILTDTEMAAAAIRPMAQRTLGVPVRTVLEWAPTL
FT                   APSGSTRTAAGLLLAWQELAAERPAPLVLIGSAPTALEVLLTQVEADAPKPSLVIGMPV
FT                   GFVGVPESKRHLEHSGLAQIRLEGTRGGAGLVAAAVNALLRAAARSDQSPAS"
FT   gene            complement(72871..73884)
FT                   /locus_tag="Syncc9902_0074"
FT   CDS_pept        complement(72871..73884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0074"
FT                   /product="possible MesJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25049"
FT                   /db_xref="GOA:Q3B0S9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25049.1"
FT                   /translation="MEESHLQSLSWTPWHHRLHQQLLTTPDLLPQGKTLVVAVSGGQDS
FT                   MALLGLLRDLMPVHQWRLVLWHGDHHWHPHSSQIASELNQWCDGQTLPLQIDTAPEDVP
FT                   QTEADARSWRYRCLTQLTHTHRADAVTGHTASDRAETLLMQMSRGSDLAGLGSLRAVRP
FT                   LQAHAPEGPQLRRPLLGFRRKETAQICSDLQLPIWNDPGNQSPDFARNRIRHEVMPVLE
FT                   ELNPGCSRRLADFAERMSQLRDTQHNLAALALTTLQNKAGLDRKALGRLPQPTRRQLLA
FT                   QWLNQQGVPGLDAPTLEQLGHRLRQAAPAGEAHLPQGWIVSWQGSDLILQPPAAER"
FT   gene            73918..74676
FT                   /locus_tag="Syncc9902_0075"
FT   CDS_pept        73918..74676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25050"
FT                   /db_xref="GOA:Q3B0S8"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25050.1"
FT                   /translation="MSRLQQLPVALQRSLEQRSTLKVIAGLMNFDPASVGRVARAAGHG
FT                   GADLIDVACDPALVALAIEASGGVPVCVSSVEPELFPAAVAAGAAMVEIGNFDAFYPEG
FT                   RIFGAAEVIELTRRTRSLLPEVVLSVTVPHVLPMDQQEQLAIDLVAAGADLIQTEGGTS
FT                   AKPFSAGSLGLIEKAAPTLAAAHSISRVSTVPVLCASGLSAITVPMAIAAGAAGVGVGS
FT                   AVNRLNDELAMVAVVRGLREALRSSVRVSV"
FT   gene            74715..75125
FT                   /locus_tag="Syncc9902_0076"
FT   CDS_pept        74715..75125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25051"
FT                   /db_xref="GOA:Q3B0S7"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25051.1"
FT                   /translation="MGPIGWLFQWPVRALVLLLVAAMPLGVEFSGFSTALGSAALIGLL
FT                   GTLLIVPLKLLLALPWAVASLGGLLAPVSWLFNWLITVILFSLAAVLIDGFRLKNGLSS
FT                   AVLGAVAYSVLSTVFIRLLGLGDVNLIRAALA"
FT   gene            75197..77236
FT                   /locus_tag="Syncc9902_0077"
FT   CDS_pept        75197..77236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0077"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25052"
FT                   /db_xref="GOA:Q3B0S6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25052.1"
FT                   /translation="MPAFDLTAPYSPKGDQPTAITQLVDGVNGGERYQTLLGATGTGKT
FT                   FTMANVIAQTGRPALVLAHNKTLAAQLCNELREFFPENAVEYFISYYDYYQPEAYVPVS
FT                   DTYIAKTASINEEIDMLRHSATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVKFEVG
FT                   ATLNIRGQLRELVNNQYSRNDTEIARGRFRMKGDVLEIGPAYDDRLVRIELFGDEVEAI
FT                   RYVDPTTGEILQSLEDINIYPAKHFVTPKDRLDDAIKAIRMELRDRLEFLNGEGKLLEA
FT                   QRLEQRTKYDLEMLDQVGYCNGVENYARHLAGREAGTPPECLIDYFPDDWLLIVDESHV
FT                   TCSQLQAMYNGDQARKKVLVDHGFRLPSAADNRPLKGSEFWEKARQTVFVSATPGNWEL
FT                   EVSTGQVAQQVIRPTGVLDPLIEVRPTTGQVDDLLGEIRDRAAKNQRVLVTTLTKRMAE
FT                   DLTDYLAENGTRVRYLHSEIHSIERIEIIQDLRLGEYDVLVGVNLLREGLDLPEVSLVA
FT                   ILDADKEGFLRAERSLIQTIGRAARHVEGKALLYAENMTDSMLKAIDVTEKRRKIQHTY
FT                   NEEHGIVPTAAGKKASNSILSFLELSRKLKQDGPDADLVEVAGKAVRALEKDADAGLAL
FT                   EALPELIDQLESKMKDAAKKLDFEEAANLRDRVKQLRQKMAGSR"
FT   gene            77370..77918
FT                   /locus_tag="Syncc9902_0078"
FT   CDS_pept        77370..77918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25053.1"
FT                   /translation="MIRSFWPLLIPFSVALIGSWRLSAESTIPTGGQQQVFSRRDKQSF
FT                   PNYTFPPSGNLTTCQQDPSLDEALLRQGKRLGVRVLAGQPELVSKDATYRAEHGRLGTI
FT                   TLKQRSMSAAVRCMLISHEFIHVLQHLHGNLKGVDSLEWQIAPEDIQRFGSIQEAEAYR
FT                   YQNRAGHVIHLLRQTPIPQ"
FT   gene            complement(78049..78504)
FT                   /locus_tag="Syncc9902_0079"
FT   CDS_pept        complement(78049..78504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25054"
FT                   /db_xref="GOA:Q3B0S4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25054.1"
FT                   /translation="MAPIRLVHHAPGAPGLRFFGLGPNFIPSRALLKLQRLLDRHAFWA
FT                   RGRSFEQLRRLLSGSDAVVSVWRGKRLVGFGRATSDGFSRAVLWDIVVAGDLQGHGLGR
FT                   RVLEELLHAPAVIGVERVYLMTTNSAGFYSQLGFQTAEPQQLMVLRR"
FT   gene            complement(78547..79449)
FT                   /locus_tag="Syncc9902_0080"
FT   CDS_pept        complement(78547..79449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25055.1"
FT                   /translation="MKHPITTVLFHYGTFQPLWQQASLLQAGPRIPDGPESLHLNEPTV
FT                   PRLLEALARRRWDSRGVLLHYSDPFLMRSAPLRDVRAWPGPTLLACGDLHHGPAPIETL
FT                   EGYLRKEPHDAVLLTFNPSSVDGVQQRLKVPVRCLAPTFFRYPTATPTPISQRRLELLH
FT                   VGSLGPHHPHRRELVEALIDRKSVPFRHATTRSAEEAATLYAQHALVLNVPLNNDLNHR
FT                   FFEVMAAGVAQVIVGDRNLMGDLHQLADRPDVFWANSLDELEALVQHLFANPEALLSIP
FT                   VASPSNLPLTNLLKQALAP"
FT   gene            complement(79456..82173)
FT                   /locus_tag="Syncc9902_0081"
FT   CDS_pept        complement(79456..82173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0081"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25056"
FT                   /db_xref="GOA:Q3B0S2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0S2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25056.1"
FT                   /translation="MELSLQGSLFGAPEPTVNAPNTRPSTGDLPNPFNSDHNLSDADLS
FT                   KDALARPRRRNETSGSTPTAGVDPDDRADETRDDTTSTDEPAWGHHSQLKPEQLTPVLR
FT                   HYVELKMAHPERVLLYRLGDFFECFFEDAITLSRELELTLTGKDAGKAIGRVPMAGIPH
FT                   HAAERHCSDLIRLGYSVALCDQLETTPTKGALLKRDITRVLTPGTVLEEGMLTARRNNW
FT                   LAAVVVEPATQHQPFRWGLAQADVSTGDVQVLQREGSDGLHQHLARLQASELLWSGDDP
FT                   APAWCPDRVGLTPMSSTPFSRPEAEAVLLEHYNLASLDGIGLPEVPLALQAIGGLLQYV
FT                   GDTQPLEDNARVPLDVPAIVHNGDSLVLDAQTRRNLELTATQRDGLLQGSLLWAIDRTL
FT                   TAMGGRCLRRWIEAPLMDRSAIQQRQTVVSRLVEKRPLRQTLRRLLRPMGDLERLAGRA
FT                   GAGHAGARDLVAIADGLERLPQLAAQLNGQLTDGPAWLQALFDPQPQLQELATTVSNTL
FT                   KEAPPLSLSEGGFIHDGVDPLLDGLRNQLDDQDAWLAQQERQERQGSGISTLRLQHHRT
FT                   FGYFLAVSKAKTSSVPDHWIRRQTLANEERFITPELKEREGHIFQLRARACQREYELFV
FT                   QLREQVGLMATSIREAARAVAGLDALTGLADVAATSNFCAPELTNNRELTLSAARHPVV
FT                   EQLLVETPFTPNDVALGNGRDLVVLTGPNASGKSCYLRQIGLIQLLAQVGSWVPAKEAK
FT                   IGIADRIFTRVGAVDDLAAGQSTFMVEMAETANILHHATSRSLVLLDEIGRGTATFDGL
FT                   SIAWAVSEHLAGDLKARTVFATHYHELNALAGERDNVANFQVMVEETGDNLLFLHQVRP
FT                   GGASRSYGIEAARLAGVPMAVVQRAQQVLDQLGD"
FT   gene            82312..82500
FT                   /locus_tag="Syncc9902_0082"
FT   CDS_pept        82312..82500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0082"
FT                   /product="possible photosystem II protein PsbZ (ycf9)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25057"
FT                   /db_xref="GOA:Q3B0S1"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25057.1"
FT                   /translation="MQFLNTLTVLALVVTSFALIVAVPVLYASTEDSGRSNRLILLGGG
FT                   VWVALVLLNWGMSFFVV"
FT   gene            complement(82945..83631)
FT                   /locus_tag="Syncc9902_0083"
FT   CDS_pept        complement(82945..83631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0083"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25058"
FT                   /db_xref="GOA:Q3B0S0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0S0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25058.1"
FT                   /translation="MKVAVIPAFNEAKTIYSVVSQALCHVDHVIVVDDFSEDKTAFISE
FT                   TAGAVVISNSKNIGYHYSIMKGIRYAFDIYSADLVITLDADGQHIVDFIPILASRLKDN
FT                   NFDMVIGCRKSFPRNSELFFSFLSHYLLGINDLTSGMKCYSKDIEQLLRLSPNFDSLGT
FT                   SISILASLMQYKISNVNIVVRPRLVGTSHFGSSFHSEVKLCLILSRVFFYFFFTRFTLI
FT                   NFCKVK"
FT   gene            complement(83635..84684)
FT                   /locus_tag="Syncc9902_0084"
FT   CDS_pept        complement(83635..84684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0084"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25059"
FT                   /db_xref="GOA:Q3B0R9"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25059.1"
FT                   /translation="MYLFDSDNPLYFIADIGANHDSSLKRAKALIKTAAESGADAAKFQ
FT                   NFFAHSIVSDLGFKQLPNSILSHQAEWTESVFDVYDKASLSLEWTEELHSYCKECGISY
FT                   MTTPYDISILEFLNQYVACWKIGSGDITWLDLISKVSQLGKPIAIATGASNFTEVCQAV
FT                   NTVLQHTKKIILMQCNTNYTGCLSNFDYLNLSVLTTYKNSFPGITLGISDHTPGHISVL
FT                   GAITLGAQVIEKHFTDDNNRKGPDHSFSMSPSAWESMVEASYLLHRSIGDGVKRIEDNE
FT                   INPSIVQRRAIRANCDIEANSIIQESMVEFLRPCPKDALAPSSSSLVVGHRTSIFIPKG
FT                   ETIKLEYIF"
FT   gene            complement(84690..85556)
FT                   /locus_tag="Syncc9902_0085"
FT   CDS_pept        complement(84690..85556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0085"
FT                   /product="dTDP-4-dehydrorhamnose reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25060"
FT                   /db_xref="GOA:Q3B0R8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25060.1"
FT                   /translation="MILVIGSTGMLGSSYVRHLSLNNIPYHTISRNIGSSYCIDLLHSF
FT                   AEIEKLIIDNKYSAVINCAAIVSLDYCERFPSLAMRVNSDLVLCLASICEKVGSILMHI
FT                   STDHFFSGDGNYLHPEDHPIVINNNYAYSKHLGELNALKFPNTIVLRTNVTGYRNGSSS
FT                   TFIEWLLFSLMNNEPIILFDDFFTSTIDADCFVHNSLLLLECEFRGLLNLSSNQCISKY
FT                   EFGLELSNFLNLDFTNVSIGSVVKLLPRRSNSLGLDCSFIESILKKNMPDTIDVLKSLT
FT                   FSNISPD"
FT   gene            85623..86480
FT                   /locus_tag="Syncc9902_0086"
FT   CDS_pept        85623..86480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25061"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25061.1"
FT                   /translation="MRVLHIGAGTIDDEIRDYQRCGVTDITYVECEEELINKCLVQFQL
FT                   LRDECLNIEGRVIPYACSEYSWEKKIFYTNGFGQSSCKKPTDLTKSWAKSKDFQIKEVY
FT                   TINIAKLKSKDPYDFLSIDIQGGELDLLRGLKDFELKTLSQIVDIEIQTTNMQYDVTEK
FT                   ASKEIETILENQGFIPLIHGCGLTESFIFVHKSLLLNNYIKFRNIVKHAISENNLLVLH
FT                   PNIGRLGSIHEDNAENILKNRENFLISNFTPGLIKGSHYPRIRDKLIQLILKDISRSQN
FT                   ENKK"
FT   gene            86464..87384
FT                   /locus_tag="Syncc9902_0087"
FT   CDS_pept        86464..87384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25062.1"
FT                   /translation="MKIKNNSMQRITSPLMHENVQLITDINLANRQKTQKINIVGNGPS
FT                   LLSSFDLLDQSNDTLGFSALIYSKIKLRYFIFEPLFALNNDDKESSEFKRVNNLLDTIF
FT                   CSQIGSIIDKHEATDVTYFVNNQVITNQYGYISFPKKKKLYLPTYFYINESTDSAMLYC
FT                   LKKYIESKTSDPLNFRGSMNRAISIAYLMNYQCINIFGLDPSTPLSWYHEDERDKILQK
FT                   EIVVTDYFNAWRDMRIKNLKEFDVRKSEFSLIKSLFYTIYVMNKLFKAKGLNIPKINIV
FT                   TSDPIVINCCSFFCGDISNVSINRL"
FT   gene            87350..88222
FT                   /locus_tag="Syncc9902_0088"
FT   CDS_pept        87350..88222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25063"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25063.1"
FT                   /translation="MILVMCRLTVCRKMLNPILDDMFLGIVHYTKLLSRKKNISILAES
FT                   LLYKDYMISIEQEVDNKSALNLDNLKKQTLSQTNDIRDLLYKNLATINFFECTYIEQLY
FT                   QQDWKLELIKKHLNGIDWGKIALNSLSHKNIDLTHQHYAIFEAFLRSNCNYCLVLEDDS
FT                   YINTGISHINESLYQVVEHAENNLYNEPFFIDLSQSLGIKPLNKPPDTYIWQATPGFSQ
FT                   CTSAYMINRNCSQKFLKESKTKVLPIDWHISRIMKKNNILCYSVWESLFLQGSMTEVYR
FT                   SNSQYRAND"
FT   gene            88215..89054
FT                   /locus_tag="Syncc9902_0089"
FT   CDS_pept        88215..89054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25064.1"
FT                   /translation="MIRSNIIKPGVDPSGRLGHQFFNILPAIILAEITNSHFNASFLGV
FT                   CTHWNNIFSFQRLKNFSEIDKKYNTVSLQKFDPFDIKKLKTLLDNFIFLPPQKIYELQL
FT                   NQDPGKLLALVPSFHDEIKKCLKIRIPNSQDVVVHMRRGDVTLDYANSLYLDDKFYLKI
FT                   ITTLINQGEKVTVFSQGERIRFNFLDKLIETGKVKLELTESLIIDNRDIDTFIRFLGAK
FT                   TFIGSYSCFSILAMILRDQSKRSIFLEDERSLSSHHFIEMRRMLRLIGVSFLKYDFA"
FT   gene            89041..89652
FT                   /locus_tag="Syncc9902_0090"
FT   CDS_pept        89041..89652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25065"
FT                   /db_xref="GOA:Q3B0R3"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25065.1"
FT                   /translation="MISHKYKCIFLHIPGTAGTLIERLIVGQDWYNIDPNSKHLNYKQS
FT                   KQLYRDYWDHYFKFTWIRNPSDRLLSLTRFPNAYFNIQKFDADYLSEENIYQYYNYCRS
FT                   HMNISSEYPLRELREISVYEDFLGEDFDFVGRFDKLNLDIKVLLNLLNISTCGISQIIH
FT                   SISISTPKSRNKRLLRYNKSSLQLFRSLFLPDYLLFESFK"
FT   gene            89656..90540
FT                   /locus_tag="Syncc9902_0091"
FT   CDS_pept        89656..90540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25066"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25066.1"
FT                   /translation="MKLSIGTAQFGMDYGITSTIGPVNIKEIKEVFSFALEHKIISLDT
FT                   AYSYGDSEYKIGQCIGKDKRIRITTKLPSLPAIDPVHSATIYFQESLDRLATSSVDTLL
FT                   VHNPSNLKGKHPSSILDWMKNLRSNGIINNIGISIYDHSDLSGINLDDIDIIQLPLSLY
FT                   DQRNYKDMLISNLKSEGKYIVTRSSFLQGLILTEAEKWPTFLSRSFITHHHNFLNLIQK
FT                   MTIQNPLFYALDFISRINEVDQIVVGIHSLDHLREIYNYYSMIEKSCASRIDYSTLAWD
FT                   NMYDIDPRFWRST"
FT   gene            90537..92585
FT                   /locus_tag="Syncc9902_0092"
FT   CDS_pept        90537..92585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0092"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25067"
FT                   /db_xref="GOA:Q3B0R1"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25067.1"
FT                   /translation="MSSASYKLTVCAIVQARSKSTRFPNKVLKNIGNGNNVIEFLVHRL
FT                   KLAQLVDEIIIAIPDSEEETFLTQIQSIMGISIVLGSEDDVLERYYQCLDATNADIIVR
FT                   ITADCPLIDPEILDNCINQHITTHSEFTCNTHPPTYPDGMDVEVFNRSLLSDAYKNAEG
FT                   RHEREHVTPWMKANAKILNVTHSTDLSDFRLTIDEKEDLLLINKLLEHLQYNIHADLIS
FT                   IIDIFDKYPELKSINSMHSRNEGSILPKSLKLWRRALKVIGKGNSLLSKNPDMFLPQGW
FT                   PTYFSKTEGKYVWGIDNHKYKDMALMGVGTNLLGYSDPYVDESVYEIISEGNMSSLNCP
FT                   EEVYLAEKMVNLHSWSDKVKFARSGAEANAIAVRLARACTGKEKILFCGYHGWHDWYLA
FT                   TNLTSTDNLAGHLLPGLNPTGVPKSLLGSIDSFQYNDIEEFRKLVSLNSYAAVIMEVER
FT                   NFKPTNNFLETIAFECKKFGIILIFDECSSGFRETFGGLHKKYQVEPDMAMFGKALGNG
FT                   YAITCVIGRDYVMEYCQESFISSTFWTERIGFTAALACLERMEMLRSWEVVTQLGEYFR
FT                   SRLNDISTNSNLHITSSGISALSSYSIISDDWLKYKTYITQEFLKQDILATNSIYFCTK
FT                   HSMSDIDQYIEILDNLFSVISECEYDQRDISCLLEFPICSAGFQRTN"
FT   gene            92586..93320
FT                   /locus_tag="Syncc9902_0093"
FT   CDS_pept        92586..93320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25068"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25068.1"
FT                   /translation="MKIGAIIEARMASTRLPGKVLIPIEKKLVIEHLFDRLRHVSLLDD
FT                   IIVATTTNKLDDQIEDVCRCNDVNFYRGSEEDVMSRVYEASKHFHVDIIVSITADCPLL
FT                   DPEIVSQCISLFVNNICDYASNTDVRSFPDGMDVQVYYRTTLENSLRLTDDILDHEHVT
FT                   LHIRKHPELFSIIHFVAPPSLTWPELAVTLDEIPDLQLIEILIKRLGTCNSIFGCREII
FT                   ELIRSDMQLYELNSDVKRKGDT"
FT   gene            93320..94198
FT                   /locus_tag="Syncc9902_0094"
FT   CDS_pept        93320..94198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25069.1"
FT                   /translation="MRTVGIVCHDAGGANVINSWLIRQLNAIYPVFFLSGPAKDIFFTD
FT                   SYPSVDTIEELIASTDFILTGTGWQTKFEIEAISRCIQCDHYVISFLDHWIDYQSRFMI
FT                   NGRMVLPDELWVVDDYAFKLCQLNFSHDVKIKQIENYYLLDCTKNLIIVDSCPEQKNDI
FT                   DLLFLLENLQSYLSSRSISNSMSEIDVLLCWISHLESSGYHISNILVRPHPSSPCFLLS
FT                   KQDSDKLANYSVSVSKATSLVNDINSCDFIGGINTIALIIAAESNKPVYSILPSELNSL
FT                   LPRDKLKMLYL"
FT   gene            94207..95187
FT                   /locus_tag="Syncc9902_0095"
FT   CDS_pept        94207..95187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0095"
FT                   /product="dehydrogenases and related proteins-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25070"
FT                   /db_xref="GOA:Q3B0Q8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25070.1"
FT                   /translation="MSRKIGIVVIGLGSIGMSYDYDNHSKHIILSHSKAIFNSSSFELL
FT                   GGVDPSELLRNKFEAAYGSRAFACTEDLLNSMHPDVVTIATPSNVRSEIFKIIVNIKSV
FT                   KIILCEKPISLSLEEGQEILDICHSHNILLFINYMRRADPAIFSIKNLLDFHTTKFAFA
FT                   NCYFTGGLLNNGSHLIDLNSYLFGPIEKITSIQPSSSMQGSSHFICQHKSASISYCELK
FT                   QEHYSHFTLEIHSDLGMIYYGSEGHDVSHYIPIVDSLYPKYYVLSPTKTEIPNQMTSVL
FT                   LLVYDDIYKSFCNRYYESPLCTGKEAFATLKAVKIIQSKISSIRE"
FT   gene            95180..96463
FT                   /locus_tag="Syncc9902_0096"
FT   CDS_pept        95180..96463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0096"
FT                   /product="spore coat polysaccharide biosynthesis protein
FT                   spsC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25071"
FT                   /db_xref="GOA:Q3B0Q7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25071.1"
FT                   /translation="MNNSSELAINGGSPIITPSHSFLPYNTIGHEEKCAVNDVLKSGNL
FT                   SGFVASSGKQFFGGPQVQLFENDLRTFFNVKHAITVNSWTSGLIVMLGALGLEPGDEVI
FT                   TTPWTMCATATAILHWNAIPIFADINSKTFLLDLDLVESLISTRTKAILAVDIFGQSCD
FT                   MDKLKYLQDKYNVFIVSDSAQAPYAQQNQRFAGTLGDCGGFSFNYHKHIHTGEGGAIVT
FT                   NNSEIALRCQLIRNHAEAAVESMNIHNLSNMIGYNFRLGEMESAIGIQQLKKLPSLVKN
FT                   RQLIASRLIDGLRNLKGLILPELLDSNTHVFYILPLSLELSMLSCTRSDLVEALRFEGV
FT                   PGLEEGYCNIHLLPLFQQRIAYGSKGFPWSSPDICSHVPNYEKGLCPVAEYLHDSSFFM
FT                   IELCLYSFTDYDVDLIIEAFHKVWSNLT"
FT   gene            96504..97061
FT                   /locus_tag="Syncc9902_0097"
FT   CDS_pept        96504..97061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25072"
FT                   /db_xref="GOA:Q3B0Q6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25072.1"
FT                   /translation="MAFIPSSLNLKLTSNRVCITPFRLYNINLKYLSWLNDPKLMCYSN
FT                   QQFTTHNIFTTLKYFFRMRMERNLFLSIYDIDSTTMIGTATIYFDFNHRISDIGILIGH
FT                   SRFLARGYGTEAWNLLIQYLLSDSFTRKITAGCVESNLAMVRIIEQSGLLFEARRHDHF
FT                   LISNKPASICYYGLLTHQSHLH"
FT   gene            complement(97058..98605)
FT                   /locus_tag="Syncc9902_0098"
FT   CDS_pept        complement(97058..98605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25073"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25073.1"
FT                   /translation="MKTHLIIGSQYEHINKGCAELIIENTDIANDRFVYAICSGQLEYC
FT                   FVYNRLYENIYGERPLTGKGLHHSKEVASANISKFIDPCKICNKNQIALYYLLKEIKVN
FT                   IVIANVTSKIMQSHVWIDKLVELIVNEKWNRNNHKKNNFGEINSNEVEYCIAASKSSII
FT                   TTYYDVFSPAKHKRELAIILKDAINLLLKYKELIKIENISSGFIFNGRMHNVHIPMNIL
FT                   LQNNSKVYTYECSEEWGLESQSYSFAVNTMIQDLDERSAIYRDEFNSFTDDKKKFAREW
FT                   ASKWLDNRVYSLKQVGSYPQFSGRFEKSDNTKAKVNEKYDFLILPTSEFEYAGFDKISK
FT                   GPLGTQLDAYMEIAEKFPNASYAVRLHPNSSNRDEEYIQKLCSKLTELIPSIKIYEPAS
FT                   TTNTYNLIRDSKIVVSGFSLALIEAIHIGKKVITTTPSLYSAFIPDFCLTKNHELSSQI
FT                   RKGNKEIFETTPSKNHQQLAAEYAFMLNNHIRVKYLNRIKLSSNYRYMLRKELYWYN"
FT   gene            complement(98602..99657)
FT                   /locus_tag="Syncc9902_0099"
FT   CDS_pept        complement(98602..99657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0099"
FT                   /product="Capsular polysaccharide biosynthesis
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25074"
FT                   /db_xref="GOA:Q3B0Q4"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25074.1"
FT                   /translation="MSNRNFSDLQIHINGRARDFKFYLERYILDKNIIQSKPDELIYEP
FT                   TSLYSCYIHEVIVDKDTHGYFNKDGSLNRFSYPNRGIRIKNQKINKHKKCIREITNKEI
FT                   MEIDDDCHNIILMNHVDHFNYWHWTFDCLTKLIIAKKLGIVKISKLRLYVIGYTELKNF
FT                   QWDGLDLIGIKRSQVIFSNRKVKFKKLLNISLPSPISNSKEVIKLVKSALDQQLGLSGL
FT                   SNIEKVQNGKVGEKLFIKRGNAKNNRTIDNIEEVKLLCIDKGYSVIDPGEMSLLEQIEV
FT                   FRKSTKVVGVHGSAFVNMLYMKSGSVIELFTKEYCPLHEFALAKHCSLDYKIIESDVNN
FT                   RIDLKKLENLL"
FT   gene            complement(99650..101056)
FT                   /locus_tag="Syncc9902_0100"
FT   CDS_pept        complement(99650..101056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0100"
FT                   /product="HAD-superfamily hydrolase subfamily IA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25075"
FT                   /db_xref="GOA:Q3B0Q3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25075.1"
FT                   /translation="MIMISHQYKNTDKEIMYKKISAIVPIKFNSRRLPNKNFLNLNGRP
FT                   LCSYIFQTLTQVEGIHNIYCYASSSLPLNFLPKSVKYLQRPSYLDGDNIEATELFRYAI
FT                   ESIDTDIVIITHATSPLIHSESIERGLQAVISGEYRSAYSVHKIQKYSWCDGKPVNFTP
FT                   SKLEQTQKISPVLYETSGFYVFRKRDFLESNTRTTEPAFKVEIPISEAVDIDNPEDFEL
FT                   ATKLQYDNNITENELTSKYFVDLIKRISPESNLKESISHICFDLDGVLIDSKIVMKIAW
FT                   EECMRIFELEQTFEEYFTHLGIEFFEILKKIEIKKNLHDDIYKLYNEVSLNNSYKIKVY
FT                   NNTREVLKRLKNAGFGLSICTSKSRKRTIEVLRRNNLIQYFDYISATEKENKLRPKPAP
FT                   DFLLECCTNLKVDPSQTIYIGDTDYDHECAKRAHTAFIHAEWGYGRDNIREKSIWLESI
FT                   KDLDTLLIDE"
FT   gene            complement(101031..102050)
FT                   /locus_tag="Syncc9902_0101"
FT   CDS_pept        complement(101031..102050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0101"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25076"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25076.1"
FT                   /translation="MNIGMKKILLTGGTGSFGKAFIKETITKYQDVERLVIYSRDELKQ
FT                   WELQQIYPEKQYPQIRFFLGDVRDENRLRRALEGIDTVVHAAALKQVPAAEYNPFEFVK
FT                   TNIIGANNLIQACLDTEVSNIVALSTDKAAAPINLYGATKLCSDKLFIAANNVRGGKNT
FT                   KFSVVRYGNVMGSRGSVIPYFLKEAKNSGKLNITDTRMTRFNIVLKEGVEMVHWAIKQS
FT                   MGGEIFVPKIPSYRIVDVAEAIAPSLNHEVIGIRPGEKIHEEMITTSDSTTTLDLGKYY
FT                   AITPAGGGVIEKYKKEDRPYERVKEGFTYNSLDNKQYLNISEIRALIRSNIDHDFTPI"
FT   gene            complement(102108..102827)
FT                   /locus_tag="Syncc9902_0102"
FT   CDS_pept        complement(102108..102827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25077"
FT                   /db_xref="GOA:Q3B0Q1"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0Q1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25077.1"
FT                   /translation="MKETQLKGLTIAGKEDGFGAQYQSCLSGFSYARNIGIKYIHTPFS
FT                   KIQHGLCPNKMNAFTGLKSDEWHKEANNIELSSYNMIKEVQWSKRPSIYYTEAVIKEIR
FT                   KMYYSTEKPGVKNYDVAIHIRRGDVNENMTEEKFRYVPNEFYKKILDNISKGCEKLNIC
FT                   IVSEGNKEDFKQFQGYNNIDYLLNEDVLKSFHTLVESNILVLSRSSFSYCTGILSRGLV
FT                   LYPDFWHSKLDHWRRIK"
FT   gene            complement(102873..103361)
FT                   /locus_tag="Syncc9902_0103"
FT   CDS_pept        complement(102873..103361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0103"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25078"
FT                   /db_xref="GOA:Q3B0Q0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0Q0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25078.1"
FT                   /translation="MTVFEGNFENSKDLNIGIVVSRFNDLITNKLLSGCIDCLKRHGVN
FT                   VETNENKVDIAWVPGAYELPLITQLMARTKKYDVIITLGAVIRGDTPHFDVVISEASKG
FT                   IASVTRDTSIPIIFGVLTTDTMQQALERAGIKNNLGWGYALQALEMGSLVNAMKISKV"
FT   gene            complement(103562..104782)
FT                   /locus_tag="Syncc9902_0104"
FT   CDS_pept        complement(103562..104782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0104"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25079"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25079.1"
FT                   /translation="MIAGITIRQMIKDSQKRNLLNKGSEEIEKNPDVAETIIKEAIKYI
FT                   PEEKIAWFNLGIALHQQRKIRSAIKAYRKAIELSKEPFDDAINNLGQDLLLAGEWKEGF
FT                   EIYEERLRRSQKMSQQYNKLYGERWRGEKDTRICEKLIIVAEQGYGDTLQFCRFVQDLK
FT                   DKGYSTTLFCQEELKHLLRESNSIGEVTSSIASSSKNMRWCPLMSLPHMLAIEEKRKLK
FT                   RKRYININGKDVEKWKKILKRKTGHKLVAIHWQGNPNFEKKLYTKERSMKFKLLNNLAE
FT                   IDNVEYISIQKGYGSEQLEQNNKLKMVEGQKEFDQTYNFMDTGAVLKNCDLLISADSSV
FT                   VHLAGAIGTKVWLALNYVPEWRWGLENEKTEWYEDMKLYRQNRRGNWEDVIQTMKEDLK
FT                   RLVDNHS"
FT   gene            105024..106232
FT                   /locus_tag="Syncc9902_0105"
FT   CDS_pept        105024..106232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0105"
FT                   /product="Glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25080"
FT                   /db_xref="GOA:Q3B0P8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25080.1"
FT                   /translation="MSLKILVITNLYPPQELGGYGRCISDFVSGLLKLGHFVQILSADA
FT                   PYLHNHTCSTFGLHGEPISRILELKGSYKSGVSLIKNRSTCSHIDFFNIDSLRNHLNCG
FT                   WDAVLLGNIDLIGTEILPFLLKYQIPILHHIGFIDPPYPVTEFPFSPFYQILPASCAVR
FT                   KSLVSAGFPVSSAPVIYPGARCDLFRPAYGNVSPSLLSAISTHNSGFSLGSFENPLKVG
FT                   FAGLLMGSKGVHTIVLALLLLFKNGIYFNVSFAGSEYQDSYRSRLENLFVNAGLSDSYS
FT                   FVGQLDRHQLSTFWSHHHVGIFPSIYPEAFGISAVEIMASGVVLVSSCVGGSAELFQPG
FT                   LNGLPFTPDDPVSLANALMGLVRNPSFMFSLASSGSDRAFSSFSVDSSSARIASLIYNF
FT                   NIN"
FT   gene            106240..107097
FT                   /locus_tag="Syncc9902_0106"
FT   CDS_pept        106240..107097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25081"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25081.1"
FT                   /translation="MNILIAIVHYWNPDGGGRHQSLRSDPQPRIDALQHQLMNILRIGS
FT                   NQSVLHLADRAVYRANDSYRNNVDIKIITDGTHHVLDYLDPSFMHAFEEIPTTPSNPKF
FT                   LGFEVHKVLADHLNSNYDLYCYLEDDLLIHDPTFFSKIAWFSGFMGYHSILLPQRFEFS
FT                   PLPHAVDRFYIDGPLPEDELRKLVSSSPVRLVQSLGFNIPFAPPDNPHAGCFFLSHQQL
FT                   SYWVSQDYWLDHDVSFISPLESAATLGIAKCFSIFKPCFSHASWLEIQHHGTVFHELIG
FT                   DSFA"
FT   gene            107081..108031
FT                   /locus_tag="Syncc9902_0107"
FT   CDS_pept        107081..108031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25082.1"
FT                   /translation="MIVLPNSSLQLLWGCNPALQFEKAWLLHLLRHNVSSQLECWSQPS
FT                   QILLRNKSLFPVLVESGLLRLHRTPSASALAAEQSSRIFRISALKEYGEFGVIHLSDEE
FT                   GLDALTWYHLCPHGTSIWRNFTHHYFSASSYIHSFPIGPRDIFLSSESPLLNSSLSSTR
FT                   PYPWTFMGTLWSSGSRCLAASLFLRALPNGFFFSASSFSCGLPLDKYRDYLSHSVFSLC
FT                   PDGDRHFDTFRLWESLSTGTIPLVIDNRHSLSLIFPDGHPIPTFSSWKDALFFASSYLA
FT                   RPTALNALQFSISSWWTSSQHTLSRSLSSSFSFKS"
FT   gene            complement(108021..109079)
FT                   /locus_tag="Syncc9902_0108"
FT   CDS_pept        complement(108021..109079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25083.1"
FT                   /translation="MKNQKMIASLFTYDLEMARVMVREIVKKEKTYLHWSMSLGDYTRV
FT                   SEALNSSELTNLEGELINGLRFRMARKMRNINPYEKILKLSEIKKERYKKDALSKGVYI
FT                   TGGIGDCLEIISTIKPWFSREGHNGVYIVERERYAQLRRFAEENELNIKSIMKIRHNER
FT                   SVPSHLLLGALGQELPYAKSIIKKREMKDRKKYNLMCCWTAKGEGDKLSGWCRSIEFSY
FT                   AIEIYKKCLRNGIKGEEILDISAWKDWEKEYLSKQGIKTYNPMIGDIKDMYDLITKSQN
FT                   IITIDTALAHLSATMDVQTNLMLNKYHDERWEVLLTTNSSYRKNCRVIKQVRYGDWKEP
FT                   IDKLSEILKINS"
FT   gene            109092..110297
FT                   /locus_tag="Syncc9902_0109"
FT   CDS_pept        109092..110297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0109"
FT                   /product="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25084"
FT                   /db_xref="GOA:Q3B0P4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25084.1"
FT                   /translation="MRILLIHQNFPGQFKHLVPYLSSFGHDIMCICSHDRPFAHWIQGW
FT                   RYKPPEPPKEPMPLSQHLWFESLQRAASVADICHKLNTQGWVPDRILAHSGWGETLGIA
FT                   ETWPNIPQIVWPELWTLPQHGGYGFDPTLPEVSFSQTIEQLGRNLMTRLALNQAAAWVM
FT                   PTHHQADSLPACFQDSRLNIIHEGINTSIASPNKNVSFYVRGRHVDASVPSITFVNRNL
FT                   ERLRGFDLFMQSLPELQRNWPDLCVFIVGDNGPGYGNGHPSGKTLREVMINELASELDF
FT                   NRIFFLGRVPYNQLITLFQISWVHVYLSYPFVLSWSLLEAMSCGCSIVASEGMPVEEVI
FT                   TDNVNGLLTSMDNPKLLSARISQLLSDPESRTRLSKAARISALSYDTSITLPKLYKLII
FT                   DL"
FT   gene            110648..111478
FT                   /locus_tag="Syncc9902_0110"
FT   CDS_pept        110648..111478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25085"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25085.1"
FT                   /translation="MFAPEDQLETLWNSGYGEATSQLVRDLSTDFVFTSHQIEVRTSIG
FT                   NFFNIHGLSHSLSPQLMIANFLLSPPGLLEINNVDSFFDTWLVSVYHKLYSSTSAASST
FT                   NDDSIGVMSPPSLDTLDFGPFPNSLHDLVNNRIHLNRLLGLANLYYIDPDDREIFSELS
FT                   EIRSALSQLILNTNESDLQQLWASDFGERYWALVRSGIQAESLSESDQHLKSSVVEHLS
FT                   PTNGGFGSPRSTNAFLVAMLFFLPGSMKVDDAQSKIPSWLYSNYSQIFASTQPG"
FT   gene            111478..112683
FT                   /locus_tag="Syncc9902_0111"
FT   CDS_pept        111478..112683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0111"
FT                   /product="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25086"
FT                   /db_xref="GOA:Q3B0P2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25086.1"
FT                   /translation="MRILVSHVNYPAQFRRLIFHWSQSGHDVVFIARQSEWHSPSPKGF
FT                   RVYFYENTRSSNTISLHPYLNRFESAILEGQSVFRIARQLRDSNWIPDIVISHLGFGNG
FT                   LFLSDCFPHARRIGYAEWFYNSYNSDVDFLSSEVVSDDHRLKLRCWNSEILLEMSTLDY
FT                   LIVPTCWQKSQFPSIYHNQISVINDGLNLPLLSNIKHANSVDFNFLPNDPNLEVLTFVS
FT                   RCFEEYRGFPQAIRTISALQKLRPNLHVIIVGEDGAAYGHPRSDGVPWSVWAIKTLNLD
FT                   PLRTHWLGLVQENVYLQVLSVSDVHFYLTVPFILSWSLLESMAVGCSIVASSTPPVMEF
FT                   LEDGLSALLVDFFDVDAQVQAINTLLSNRKLASRYADAAMNRAEALSFDKATESWDTLL
FT                   NA"
FT   gene            112841..114874
FT                   /locus_tag="Syncc9902_0112"
FT   CDS_pept        112841..114874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25087"
FT                   /db_xref="GOA:Q3B0P1"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25087.1"
FT                   /translation="MADYNVILGTSTADSVLVGNTTGNDSLALLAGNDIVTGSGLNDVI
FT                   DFGAGNDLLTKPGDYTAATVLGGTGNDSIFTGSKVSTSLLDGGGNNDSITLAKSATYTS
FT                   VTISGGLSNDTISLNGSSSLVSSSVYGGSSSVSSTDSQDSIALGSLSASYIQGNAGSDT
FT                   ISVAGTVSDSSDVKGGRGSDSISITKSVSASNVTGGLNSDTINLVATAASGTSVYGGSL
FT                   RDTSSDSADNIRLAGGTAGAFVQGNGGNDTLDLVLTTANESTVKGGKGNDYITAGGIVS
FT                   QSIISGDLGNDTITVLSASSQSSIYGGNLRDTSTDGSDSILFSGGATQGYIQANAGADT
FT                   IVVSVASKQSTILGGGGADSIVVTGGTQYTVNSNKGADTLNWAAATDNSSFNTGEDNDY
FT                   IIGTAALTSGSVFGGAGNDSLGITTNAGKYYGDAGNDSFTVVMSSTSSTVYGGSSAGDT
FT                   AAGNDTLSLTSMAAGRVDMGGGANRMIAAGAISAGTIVSGAGTDTFSTTSDISAARLNT
FT                   GAGNDSLNFGGMVSATTIISAGAGNDTLTFSNVVSSASIVGGAGNDSLAFTMGASMQGF
FT                   VGAGSQMLANQYFYEGGSDTLFFKGTTTHTGLLLNINVATGSFDSLSATAVSGGQNIIG
FT                   STTSGGTTTSTTLAYVLGATNTANITSGFVNQSVIDGVTAIG"
FT   gene            114902..117082
FT                   /locus_tag="Syncc9902_0113"
FT   CDS_pept        114902..117082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0113"
FT                   /product="O-linked N-acetylglucosamine transferase SPINDLY
FT                   family-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25088"
FT                   /db_xref="GOA:Q3B0P0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25088.1"
FT                   /translation="MGEKLSFSPFFMYEILFDWPDRLINYEYKDSLYIAARHLRLQQFL
FT                   EAESILLARLSLDFDNQDIHFLLSYLYLRLSRYESFLYSLSELKRLDKPDGAYYCFMYS
FT                   QYLLQIGDISKLGENLSWLILRSSQFWPLQLIEISYYLKINDLSNAYKLVCSLSQHPAT
FT                   VLESVRLKSSILVLNGQFNDALALLSNASLRFPSHLPLRIQLLDCAVLGRSQLHTLPIL
FT                   NQLLQDFSLTKESLASVSQVRLIQNRSAESRQLILKNRVWNTITPNTEYYSTNLYNCYD
FT                   RLGLGDWLLHSPFFTDPSSFTQILAVKENLCMSAASLEHYDYSSSVSSVMQEYSNRIEA
FT                   SPINKSPDFVKVKSVCRIQEPLTILWLSSDFSYHPVGRFLYGYFSALSSPIHKHIIVDL
FT                   NDHGVESTRYLFEPLTSVESICIPRLDLPDRVSDIRNLNADIAVDLSGWTSGHFMPGFL
FT                   SNLSPIQVTYLGYFASTFNPSIDYWLGDSQLFPDTMQESHTESIWRLGRCFLAWQPPSA
FT                   LVESSLDVPSSPFTSSTGIRFGSFNHHRKLSNETLQLWGKIINSVPGSSLVLKMGESDD
FT                   PGTFTLLSKRMRRAGLDPERITWIPRPRDTVQHLNQYSLVDVALDCFPNGGCTTTCEAL
FT                   WMGVPVITSTGNSYVSRMSSAVLHGANLPNWCLSSKSQYFDFAVLQAENLSWLRANRHY
FT                   WRQKLINSPLGNASDLMTHIELAFSKMVKASR"
FT   gene            complement(117037..119211)
FT                   /locus_tag="Syncc9902_0114"
FT   CDS_pept        complement(117037..119211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0114"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25089"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25089.1"
FT                   /translation="MEDRIQKRERGWTHHRKNELIKAEKIYLELIEERAQEEDIANLGA
FT                   LLRSQGRIKEAMKLYKTWWGRVEITPNICLNAVNAAIEINSLKEANKWLIETSEIYSND
FT                   IRLTEAKARLYQAMEKKVEAIELLKELTSQKDAKANTWIELGRAYNSNGEIDEALVSFR
FT                   TAKEINNKDPRPTANIITILSEKGRFKEANKEVEKTECNLKEELAIKGAIAYLKLKEEK
FT                   IYEAAIDYAELCRIDPLQPIYWLNWCACKRKLKRNIEALQISKKGLSINPSNDNLRHAM
FT                   SQCLAETGNPELAIKVMREEIEGEKKISEQNLYNLQFIGEGYQIIDSEKLKCMAEDWES
FT                   IKIKKRIGPLWGDRIEDKDKERINVGYMSADFCDHPVGRFIKPIIKEHDRKRVKVIGID
FT                   CGSRKDANNREIKEMCNGWIDVNNLSDQEAARKIANHGIDVLIELGGYTAENRLGILIE
FT                   KPGKIQLSYLGYFAPTYLKSIDGWIGDDILFESLNKTQRDVHKLYKIRDGYMAMELKTE
FT                   AVIKNTPLNRKFRFGCFNHSRKLTYETIRLFAKVMKENPESEIALKSISFSETEEQERI
FT                   INLLNKNGISKKRVILMPYITDKIKHQEKYNEIDVALDPIPYGGATTTCEALEMGVPVI
FT                   TLKGEGMVGRLSSSILKYGRCEEWIGNNETEYINISVKLRKEGKRDEKKRIQLKAKLSK
FT                   TDLTNQKRLSKQLEEAYLEALTIFEKANSI"
FT   gene            119210..120949
FT                   /locus_tag="Syncc9902_0115"
FT   CDS_pept        119210..120949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0115"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25090"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25090.1"
FT                   /translation="MTFSNFQNSKTNVRPLIFEAEKTTDPERLVSLLSQVSLKSEPVYR
FT                   FVEALLLWKLNYLDELCNLLSTLPTSFHSDPQYWIFLGMYENAQSKGSSRSLFAYQKAL
FT                   LLSPGRADIHFNLANSYSSFESSKALHHYLVSLSIDSLQSNVWHNLGNLLRDAKFFSCS
FT                   LTAFKNAHFLSPYDVDILCNFALSLILNGSYKSAELTLVHCLTLNPNHFQSHLNLGFLF
FT                   IKLRRINEAIINLQEALRLEGCSLCADLKFNLSLCHLLLCNYVIGWDLYENRLYTSMVP
FT                   LSLHPSHGPLIESLDQLSTNSSPPLLIWSEQGLGDCIQFCRYLLLLDALFIDYDFLCPL
FT                   PLIALIKNWLNPKGNVLELETFMFSSDRLHCPLLSLPSLFSTTLDSIPSTLPYFSTPKN
FT                   IPGHLIAGDSLGGLSVGIVWSTSPSNPIMYKNKSIPLKLLMPHLVKLMDLDLVNLHTLQ
FT                   VGPDASQVNPWLHHPRLIDWSSKLSNFSDTAFVISQFDLVISVDTAVAHLSAALNIPTW
FT                   CLLSHDADFRWLIDRSDSPWYPGVMRLFRQDTLDDWSSVVKSVNTVFDDLFLLDISSVS
FT                   SSI"
FT   gene            120971..121711
FT                   /locus_tag="Syncc9902_0116"
FT   CDS_pept        120971..121711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25091"
FT                   /db_xref="GOA:Q3B0N7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25091.1"
FT                   /translation="MHSNQVHLFSDGIDSAIECQNLVRRMQIFPKLVRFQQEELIASQM
FT                   NIGRDFLDQERQKRLNNLSLDDFLRSSHLKEDDLDICFAREEALLRFAEKQFGPGLEEV
FT                   FLSSKGAHDQVIYSILRVRDAGLAQELWIRLEENEGPFTELAASFGEGPEASHKGLMGP
FT                   TAMGSIYPQELAQLLRSLRPGEIHPPRQLGEWLILIRLEVLTPARFDKQMRTFLLHKQL
FT                   DTFLDARVKRIMSGETVDELNFDF"
FT   gene            121714..124734
FT                   /locus_tag="Syncc9902_0117"
FT   CDS_pept        121714..124734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0117"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25092"
FT                   /db_xref="GOA:Q3B0N6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25092.1"
FT                   /translation="MSSTSETLSALLSRFSAFQDIDDADLQWLATHSKPFHCSVGQALL
FT                   FSDRLPEYCYCILEGRGRVLHHDPALRRPVTLAYAQPGDLIGWAGLVRRSPCEWITAAM
FT                   PLKLVGFPADIFYQLELRSEPFRNWLDTNNSPAELMTVLSHSLRSRPLAEPNEREVLRR
FT                   LLPSMKLHPARSLRSIADFSAEDTLLLWNSKPPGFTVPVGQPIDSEILDSIPSGFPLRL
FT                   ISVDKSCWSRELYPPLKAPPDSDISPASDLWGNDRYSELLVPDPQGSKESLPEINATPL
FT                   SNKSSKFFWRGRQIPVVTGVGPIEQTMACLEMLSLFHNVPFRRDVIERACKGSLKGDKP
FT                   SLELTGDLSTVMGFVGTISDIPTAQLPRLSFPCFALLDKQLIMIHDISRDIVQAVIPEY
FT                   GRVVFPLIELLENNPGVRVLSLSPGRDSQQKKLTFKWFVPQLKKYRRSLLEVLAASLVL
FT                   QLLNLAQPLVMQQIFDKVIVQQNLDTLYTLGFVLLGVSLFQGLIGAVRTYLFADTTNRI
FT                   DIALGAQVIQHLLRLPLRYFDKRPVGELQTRIAELGNIRGFLTGSLLTLALDSVFSVIY
FT                   IAVMIVYSGVLTAVTLGVVPLFLGLTIVASPIIRGQLRKAAEKNAVTQSYLIESLNGVQ
FT                   TIKAQNAENNVRWQWQRRYSGYMSESFRTLMIGVSTGTIGSFLNQLTGLLTLWVGAYLV
FT                   IKGQLTIGQLIAFRIISGYVVGPLLNLATSWQSFQGVALSMERLSDVIDTESEGGEVDL
FT                   DLLPLPPVAGEVVFQDVDFRFNDLAPLVINRVSFSVTAGSFVGIVGRSGSGKSTIMKLL
FT                   PRLYETVSGRILIDGYDISKLQLGSIRRQIGIVPQESLLFEGSIRDNIALTTPEATPEE
FT                   IVAAAKIACAHDFIMEQPDGYASRVGERGAGLSGGQRQRIAIARAVLQAPSLLILDEAT
FT                   SALDYLTERQVCVNLKRHFEGSTVFFITHRLSTIRSSDVIIMLESGRLVERGTHDELIK
FT                   MEGRYFALYSQQESDLD"
FT   gene            complement(123414..123485)
FT                   /gene="tRNA-Val3"
FT                   /locus_tag="Syncc9902_R0045"
FT   tRNA            complement(123414..123485)
FT                   /gene="tRNA-Val3"
FT                   /locus_tag="Syncc9902_R0045"
FT                   /product="tRNA-Val"
FT   gene            124727..125980
FT                   /locus_tag="Syncc9902_0118"
FT   CDS_pept        124727..125980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0118"
FT                   /product="hemolysin secretion protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25093"
FT                   /db_xref="GOA:Q3B0N5"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25093.1"
FT                   /translation="MTDKKLPSADSNKFKVWEGSSVFVSQGRHWSSAFIWLSAGLLGVT
FT                   VIFAFSSKIDQTVSVRGKLSPSGSVQDIESPSSGVVLDVFASDGDFVEAGDILLTVESK
FT                   SLSSRLSEINEKIQLLSLEISGLKDIIESGGKPSLFKPLPPLPTGIDDAQLVSRMLTAR
FT                   NQVNQIRSELIKVDIRLQSKSSSLNYQTQITNDLKPLYDNGAMARNAYLDQINRLQENK
FT                   AEFSTLVTERSRIVGSVSSRVNSLNQQLLSLRTQLTSVNEQIGYRNVKAPVSGRVFNLM
FT                   ASPYSVVSSSEKLLTIVPSNNLQALVEIPNSDIGFIKVGQAVSVSVDSFPSGEFGYIRG
FT                   SLISIGSDALPPDQDSPQRYFPGTVKLVQQSVVSGDTSLNLQSGMSITANIKLRSRPTI
FT                   SILTDIFTRQLDGVKRFR"
FT   gene            complement(125964..127106)
FT                   /locus_tag="Syncc9902_0119"
FT   CDS_pept        complement(125964..127106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0119"
FT                   /product="Glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25094"
FT                   /db_xref="GOA:Q3B0N4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25094.1"
FT                   /translation="MKVVLVNHGTASEWGGGDSIQIQETGRVLAARGWEVSIQNSDRPD
FT                   IRGADVVHIFNCRVFNSFKQQISVCQQSGIPAIVSPIWISIGRALWGSRATTMLLQEAI
FT                   NNGENSISEKLKLLSNRELKVHLPEGTIDSMGNGSMNLEWIKEAGKLLQTCNGILPNSW
FT                   LELKAIQSDLNWRGKNYGVAHYGVNPQKFMDADPGIFRKYTGIKGDFIIQAGRVEPGKN
FT                   QAMLCWALKDCDIPIVLVGKDEHWPSYAKLCKQIAGDKLTLIKHMPQEVLASGYAAARV
FT                   HCLPSWMDTCGLVSLEAGINGTPIVGSTFGHELEYLKDDAWLADPGNPESIKEAVLDAW
FT                   AAGRNNKRSQNLKKRILSDFNWEKTADQTEKIYIKAIENA"
FT   gene            complement(127157..128824)
FT                   /locus_tag="Syncc9902_0120"
FT   CDS_pept        complement(127157..128824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0120"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25095.1"
FT                   /translation="MNYGRIMNSNKVSIYNRIKEGQEEEVLKPENYLDMGFDYHVKAEY
FT                   EKAIRAYEIGTRIDKLNDKIYCKMGLTYHNLGKHNIAIKYYKKATKINKENSEAQYYLG
FT                   FIYLQENQDEKAIKYLKDALNLNPEISRAYYYLCEALTRNNRKEEAVNIIKKRIELNCP
FT                   LITPDDIFTFGEVMRKRAIEKHESNDKIKIILDLLLKSINKRGIVCFGDSHRSVFNNIQ
FT                   KINCYNTGSGTAYNLNNDKSTSGSGKRIKKVLENINKDEYAILLVYGEIDCMEHIMKNS
FT                   YREDKNIDEITTKLAVKYTEYIRNLKNEGYTVLVYGPALSGFSFNSHGTQEERNRIMRN
FT                   FNEQIEKNLSTEKRVYFGSINKIVTNDMYEPEMKLSKDGRHLDNFPQGSKIVQGMIIGE
FT                   FIKDIYSKRKKIKNYAKRERNYAEGKPYAIVFDKSDTGIYINEELCFVKSKSIKLKEKE
FT                   KMTIVIDMLNHYKIKNIIIAIERIDEGYIDAKKIVMAEKVMLFNEKKITCHSAEMDESR
FT                   HNSCCIIKGNIIARGVLIEIKNHMPRETTFMLRNIEII"
FT   gene            complement(128793..129467)
FT                   /locus_tag="Syncc9902_0121"
FT   CDS_pept        complement(128793..129467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25096"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25096.1"
FT                   /translation="MVNRKSEVKDAFEIKIQLYTNSNASLCNKIEENERLEIININTED
FT                   YMQVPAIASRRLIEQRKGYDILGYIEDDILIEDGEFFNKIRFFLKSLDKEYVVLPHRCE
FT                   YIKNKGDVILSGDPDGGRPDLFWDTKEKININWPTGQKTIYRATNPHSGCFFIGSEQAE
FT                   ILYEYWSRKNWKSKYQLSGPLEHAASGRIIMNFKIFKTVPEDYRFFMVRHQDELWKNHE
FT                   FE"
FT   gene            129758..131050
FT                   /locus_tag="Syncc9902_0122"
FT   CDS_pept        129758..131050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0122"
FT                   /product="Glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25097"
FT                   /db_xref="GOA:Q3B0N1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0N1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25097.1"
FT                   /translation="MFRSTNFQDDAPAARVLFSLRKYGLSSAIRQLDIEISNNNSGLLL
FT                   AELNFRLRGHSSPRLIIDTIWLKSQYGGISRVWFNLLNSLSLPGLVTDQSPVALISRSP
FT                   NSAKFVGFDIFHGSSINPLDFASLDMASSENHTFASHWKADVFCSTWITRSSSASPYCP
FT                   EMVLFHDCIPELFSSTCPSMLETRRRWILFAKSFLTVSLDSSLAIQSFYDVPASNIRWC
FT                   HPSYFFDYLPLSTSVPSFTSLQQKLLLRLPFIVLPGSGSVGSYKNPELLARALCSPSLL
FT                   HCQLLVTGVNARNVCNSILEHFPSLHGRVFAAGFTDSELSSVFRHATAVVIPSLVEGFG
FT                   LPVLEVLASNGFPIISDVPGLREAGSECVLRFNPYDVDELISLLNLILDKSSRQMISQY
FT                   LLPRKIRRLSRLNPDLFCLCFLAQVRSASDF"
FT   gene            131155..133968
FT                   /locus_tag="Syncc9902_0123"
FT   CDS_pept        131155..133968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0123"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25098"
FT                   /db_xref="GOA:Q3B0N0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0N0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25098.1"
FT                   /translation="MLKLLLGDPNARKLKRYSPIVSDINLLEEDISPLSDDELRSRTSD
FT                   LRQRLFNAGDLHNQIPILDELLPEAFSIVREASKRVLGMRHFDVQLIGGMVLHEGQIAE
FT                   MKTGEGKTLVATLPSYLNALTGRGVHVVTVNDYLARRDAEWMGQVHRFLGLSVGLIQQD
FT                   MRPEERRRNYACDITYATNSELGFDYLRDNMAADISEVVQREFQFCVIDEVDSILIDEA
FT                   RTPLIISGQVEREQEKYQQAAQLAASLERSAEMGKDGIDPEGDYEVDEKQRSCTLTDEG
FT                   FAKAEQTLGVQDLFDPQDPWAHYITNALKAKELFVKDVNYIVRDDEAVIVDEFTGRVMP
FT                   GRRWSDGQHQAIEAKESLQIQPETQTLASITYQNFFLLYPRLAGMTGTAKTEEVEFEKT
FT                   YKLQTTIVPTNRIRARQDWADQVYKTEVAKWRAVANETADIHKKARPVLVGTTSVEKSE
FT                   LLSSLLTEQDIPHNLLNAKPENVERESEIVAQAGRAGAVTIATNMAGRGTDIILGGNSD
FT                   YMARLKLREVLLSRLVKPEDGPLPSLPVQDSATASGFSEASATVAPRVSASLYPCELSG
FT                   PTDQLLAQLARDLVKAWGDRALSVLDLEERIATAAEKAPTDDAQIQSLREAIAFVRGEY
FT                   DAVVKEEEARVRDAGGLHVIGTERHESRRVDNQLRGRAGRQGDPGSTRFFLSLGDNLLR
FT                   IFGGERVAGLMNAFRVEEDMPIESGMLTRSLEGAQKKVETYYYDIRKQVFEYDEVMNNQ
FT                   RRAVYSERRRVLDGRALKKQVIGYGERTMNEIVEAYVNPDLPPEEWDLDQLVGKVKEFI
FT                   YLLEDLTPAQVNGLGMDELKAFLQEQLRNAYDLKEGQIDQQRPGLMREAERFFILQQID
FT                   TLWREHLQAMDALRESVGLRGYGQKDPLIEYKNEGYDMFLEMMTNMRRNVIYSMFMFQP
FT                   AAPQNQN"
FT   gene            133965..134873
FT                   /locus_tag="Syncc9902_0124"
FT   CDS_pept        133965..134873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25099"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25099.1"
FT                   /translation="MIPLIRRILNSRLKLSVVVIAYNMDREMLRTIYSLSPAYQRGVTG
FT                   SEYEVIVVDNGSESPLKTDHWISRPGWKIRFFRLPPGDVSPCSAINAGVENARASHVCV
FT                   MVDGARMLSPGVIDGILQQIRISSDSFVFTLGWHLGPQPQNVSITQGYSQKLEDKMLRQ
FT                   ARWREDGYRLFDIASLAASSRGGWFSSINESNCFAISRAQFKVMGGFDQRFVSPGGGLV
FT                   NLDFFKRAVESALLKPCVLLGEGSFHQVHGGVATNVPMEDHPGSVFAEEYQNIRGLAYQ
FT                   SPIYEPLYVGRLSQSARRFLS"
FT   gene            134912..135781
FT                   /locus_tag="Syncc9902_0125"
FT   CDS_pept        134912..135781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25100.1"
FT                   /translation="MLFRSFLRRCLSSSQQLWTFPQKVMLRLCRLASNRVLNGGPAVFI
FT                   SGPIPKADWRRSQVVVILGMHRSGTSLLTGTLQEAGLVLGDVVTSAPHNRKGNREALPI
FT                   RALHDDLLHSSGGSWDHPPSQVIWKPSHRALRDDIVVGYQHECFWGFKDPRSLFCLEGW
FT                   LEVLPELQPVAIFRHPEAVARSLRAREGMALADGLVLWTLYNQQLLYWMDQLDVPLLHF
FT                   SSDLNAFCTDAVALIDRLNLPHRMSANSLQFPDAKLHHQSSSKLPLPRDVQDLYDQLLD
FT                   RKFSTLSI"
FT   gene            136233..136709
FT                   /locus_tag="Syncc9902_0126"
FT   CDS_pept        136233..136709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25101.1"
FT                   /translation="MASLHPASIYYFVEDDHLHLPDQKKFLIEGLKHFDFVSLYDHPDK
FT                   YFDPGYQQLRRRIVWTSMGHFAESPSTVMTFACSAETLKRASPILLDERLTGSDLKIPL
FT                   DHSMFIALGEAGFSLGTALPGRSTHCEQNFLSPGIDWLTYAKQIALDCFTSSNA"
FT   gene            136706..137383
FT                   /locus_tag="Syncc9902_0127"
FT   CDS_pept        136706..137383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25102"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25102.1"
FT                   /translation="MTDVICIPTLKRYDLLCRLCLALTQGKDPVDSSNIIIIDNGGSLL
FT                   ESLCWRQISSFFTLKKPEVIIPSENLGVAGSWNYFVKNFGRCVIANDDVVFSRQVLQCF
FT                   RWASMAYPNTVIFENDDPVGGFSTFLVNRPELWLEMGGFDELLNPAYFEDNDCRRRLLL
FT                   AGNPSRTIPLTGWRHDNSSTLLASDESYKRMHWCLYKRNRAYYHLKWGGYPGHEIYQTP
FT                   FGI"
FT   gene            complement(137528..138343)
FT                   /locus_tag="Syncc9902_0128"
FT   CDS_pept        complement(137528..138343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25103"
FT                   /db_xref="GOA:Q3B0M5"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25103.1"
FT                   /translation="MGRRLSFLICGAQKSGTSALHQYLRNHPEINLPQTKELHIFDNEL
FT                   SDWSDQEIEKIDRRIEKHYERQSKTKHCGEATPNSMWWEPSMKRIWRYNPEIRLIAVLR
FT                   NPITRAYANWRMEQLRGRDNKEIPLTLEEEEINCRKSLPLQDRTCSYLSRGFYTEQIRR
FT                   VWRYFPREQFLAIKQDDLLYHPVQTLQIVYHHLQLEPRGFEKEILVDSWESHPSKDQGN
FT                   FLPNPTDIPKAIPENIFSALFKIYDGEIKKLEKLLGWDCKNWINHDKAY"
FT   gene            complement(138577..139320)
FT                   /locus_tag="Syncc9902_0129"
FT   CDS_pept        complement(138577..139320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0129"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25104"
FT                   /db_xref="GOA:Q3B0M4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25104.1"
FT                   /translation="MLDQIRADLAIIRERDPAARGWVEMLCCYPGLHAISLHRFSHRLW
FT                   RSRLPLKLLARCISQVGRALTGIEIHPGARIGTSVFIDHGMGVVIGETAEIGHRCLLYQ
FT                   GVTLGGTGKDHGKRHPTLGENVVVGAGAKVLGAITIGPNTRIGAGSVVVRDVEEDSTVV
FT                   GIPGRVIHQSGVRINPLAHSALPDAEANVIRNLMERIDELENTVNALRSCLDDVATDCA
FT                   LQDDRGGEAQSLKDREILEFLGESS"
FT   gene            complement(139330..140331)
FT                   /locus_tag="Syncc9902_0130"
FT   CDS_pept        complement(139330..140331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0130"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25105"
FT                   /db_xref="GOA:Q3B0M3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25105.1"
FT                   /translation="MRFHIQQESDIPASTQLYNQICFAIAARHYPPGHRLPSTRQLAMQ
FT                   TGLHRNTISKVYRQLETDGVVEAMAGSGIYVRDQQKPREIKTPPHIRNRGVTDLDREVR
FT                   KCVDGLLNAGCTLQQTRELLTREIDWRLRCGARVLVSTPREDIGASMLIAEELEPCLDV
FT                   PVEVVPMEELENVLETSSNGTVVTSRYFLQPIEELAKKHSVRAVAVDLNDFRNELAMLK
FT                   ELRPGSCVGLVSISPGILRAAEVILHSMRGNDLLLMTATPDVGSRLLALLRASSHVLCD
FT                   RPSLPLVEQSLRQNRSQLMRMPQLHCAESYLSTDTIDLLRKEIGLQTPATAS"
FT   gene            complement(140846..141499)
FT                   /locus_tag="Syncc9902_0131"
FT   CDS_pept        complement(140846..141499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0131"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25106"
FT                   /db_xref="GOA:Q3B0M2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0M2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25106.1"
FT                   /translation="MAPRPRFDRRAPVRELPNINDRISYPQLRVVDSDGSQLGVISREE
FT                   ALEVSKERELDLVLVSEKADPPVCRIMDYGKFKFEQEKKAKEAKKKSHQTEVKEVKMRY
FT                   KIDSHDYDVRIGQAQRFLKAGDKVKCTVIFRGREIQHTALAEVLLRRMAKDLEEKAEIQ
FT                   QSPKREGRNMIMFLTPRKTPLLKKDDKDSSVHQAIRTIPAPPRSTAAKVAAPQA"
FT   gene            complement(141556..142452)
FT                   /locus_tag="Syncc9902_0132"
FT   CDS_pept        complement(141556..142452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0132"
FT                   /product="tRNA isopentenyltransferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25107"
FT                   /db_xref="GOA:Q3B0M1"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0M1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25107.1"
FT                   /translation="MSTQPLVITLLGPTASGKTALALELAERLGLPVINVDSRQLYREM
FT                   DVGTAKPTAEQQARVTHHLLDLRDPNQPITLQEFQAEATPCIERELSERGIALLVGGSG
FT                   LYLKALTSGLKPPAVGPQPELRKQFSAMGQAVCHPLLAAADPIAAAKISPADVVRTQRA
FT                   LEVLYASGQPMSGQASVEPPPWRILELGLNPTNLRQRINQRTEQLYQDGLVEETQRLAD
FT                   RYGADLPLLQTIGYGEALQINDGSITRQAAIATTCQRTRQFAKRQRTWFRRQHTPQWLS
FT                   EQDLLTEAMTLIEQHLG"
FT   gene            142611..144578
FT                   /locus_tag="Syncc9902_0133"
FT   CDS_pept        142611..144578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0133"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25108"
FT                   /db_xref="GOA:Q3B0M0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25108.1"
FT                   /translation="MSDASKVQNEYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLV
FT                   YEVVDNAVDEALAGHCDRITVILGADGSASVTDNGRGIPTDVHPRTGKSALETVLTVLH
FT                   AGGKFGAGGYKVSGGLHGVGVSVVNALSEWVQVTVRRQGQVHRQRFERGAAIGTLLSES
FT                   QPEAEQGETGTTVCFLPDTQIFTGGIVFDYATLSARLRELAYLNGGVQIVFRDERESSL
FT                   SDAGDPHEEIYFYEGGIKEYVAYMNKAKDALHPDIIYVNSEKDGVQVEAALQWCADAYS
FT                   DSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKEADSNLAGENIREGLTAV
FT                   LSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGESLSQFLEFNPSVISLILEKAIQAFNA
FT                   AEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRF
FT                   QAILPLRGKILNIEKTDDSKIYKNTEIQALITALGLGIKGEEFDQKSLRYHRVVIMTDA
FT                   DVDGAHIRTLILTFFYRYKRELVEGGYIYIACPPLYKVERGKNHTYCYNESDLQKTLKG
FT                   FGENAKYTIQRFKGLGEMMPKQLWETTMDPSTRMMKRIEIEDALEADRIFTILMGDKVA
FT                   PRREFIETHSKELDMAALDI"
FT   gene            144578..144886
FT                   /locus_tag="Syncc9902_0134"
FT   CDS_pept        144578..144886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25109.1"
FT                   /translation="MGPMLRWSWLLGVALMAPAAMPAGGADFRQPQVRRRVGIGGHLHV
FT                   ASDAPLRLSPMAVAPRLSTLRAGTSLRLLRRWSAADGNDWLHVQPIGEDQPRGWLRA"
FT   gene            144867..145247
FT                   /locus_tag="Syncc9902_0135"
FT   CDS_pept        144867..145247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0135"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25110"
FT                   /db_xref="GOA:Q3B0L8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25110.1"
FT                   /translation="MAGSALEALLVGIGAIPGAWLRLKAVNHFEPMVPKKHWGTFAVNV
FT                   IACFGLGLVLALYQSCSAKTGLALLIGVGFFGSLSTFSTFAVELLNELRAGRPFVSLVL
FT                   ALASIAAGLCAAGVGYGLGAYG"
FT   gene            145225..145644
FT                   /locus_tag="Syncc9902_0136"
FT   CDS_pept        145225..145644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0136"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25111"
FT                   /db_xref="GOA:Q3B0L7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0L7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25111.1"
FT                   /translation="MAWGLMAEQQQQRSLSAELQELVLVALGAVPGALLRWQVALHWAD
FT                   RHLLVNVLGAALLGLLAGLPAAPRRQLLVGIGFCGSLTTFSSWMVDAMQLISAGQIAEA
FT                   FGLIGLTLGLGVGAAALGFWLGQRLRLLKLPRSEP"
FT   gene            complement(145610..146119)
FT                   /locus_tag="Syncc9902_0137"
FT   CDS_pept        complement(145610..146119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0137"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25112"
FT                   /db_xref="GOA:Q3B0L6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25112.1"
FT                   /translation="MPVNLSKYPALGMTINISGVSVTAPDGTTKSLGDYAGKVLLIVNV
FT                   ASKCGFTKQYAGLQALNETYASKGLAVLGFPCNDFGGQEPGSLDEIKSFCSTTYGADFE
FT                   LFDKVNAKGSTTEPYTTLNKAEPAGDVAWNFEKFLVGKDGTVIARYKSDATPEALKAPI
FT                   EAALAA"
FT   gene            146154..147614
FT                   /locus_tag="Syncc9902_0138"
FT   CDS_pept        146154..147614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0138"
FT                   /product="Divalent cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25113"
FT                   /db_xref="GOA:Q3B0L5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25113.1"
FT                   /translation="MKEAAGSEAGNVTVELELVAEVVSQQLESMLSVGNYDAVKLLLKP
FT                   VQPVDIAEAIGNLPTNLQALAFRFLGKDEAISVYEYLDSATQQSLLRLLRSGEMRDVVE
FT                   EMSPDDRARLLEELPAKVVRQLLSELSPEERRVTAQLLGYEAETAGRLMTTEYIALKEN
FT                   QTAAMALEIVRRRARDTETIYSLYVTDAERCLTGILSLRDLVTADLKARIGDVMTGDVL
FT                   SVATDTDQEKVARTIQRYDFLAVPVVDSEQRLVGIVTVDDVIDVIEQEATRDLYAAGAV
FT                   QAGDEDDYFSSNLFTVARRRIVWLSVLVVASFFTSEVIAANEAVLKQVVLLAAFIPLLG
FT                   GTGGNVGAQSSTVVIRGLSTQSISVLKPLQAVLREAMAGALLGVLMMIVVLPFAWWRGG
FT                   GALVGVSVGISLLAITTLAATAGAAFPLLFDRMGLDPALMSTPFITTCTDVAGTLIYLK
FT                   TAEWLLINLPQLGQVAGISTQFLAASAF"
FT   gene            147667..148665
FT                   /locus_tag="Syncc9902_0139"
FT   CDS_pept        147667..148665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0139"
FT                   /product="type II alternative RNA polymerase sigma factor,
FT                   sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25114"
FT                   /db_xref="GOA:Q3B0L4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25114.1"
FT                   /translation="MAPVATAASKPATSTRSVSVDVDLVRSYLRDIGRVPLLTHEQEIT
FT                   LGRQVQQLMEIETLEAELESRDGAKPARDQLAKAAELSTVQLKRKLQQGHRAKERMVAA
FT                   NLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPTRGYKFSTYAYWWIRQGITR
FT                   AIAEKSRTIRLPIHITEMLNKLKKGQRELSQELGRTPTVTELAQFVDLPEDEVKDLMCR
FT                   ARQPVSLEMKVGDGDDTELLELLSGDNELPSDQVEEDCLKGDLRSLLGQLPHLQEQVLR
FT                   MRFGMDGEDPMSLTGIGRILGMSRDRVRNLERDGLAGLRRVSDQVEAYVAC"
FT   gene            complement(148666..149511)
FT                   /locus_tag="Syncc9902_0140"
FT   CDS_pept        complement(148666..149511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25115"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25115.1"
FT                   /translation="MAPKAVLLIHGFGANTNHWRFNQPVLAELTPTYAIDLLGFGRSDQ
FT                   PRARLKQEPPNDMAVHYGFDLWGEQVADFCREVIDKPVILVGNSIGGVVALRAAQLLGP
FT                   DLCKRVVLIDCAQRLMDDKQLATQPAWMGWIRPLLKTMVSQRWLSTALFRNAARPGVIR
FT                   SVLKQAYPSGQNIDNELVDLLYQPTKRKGATEAFRGFINLFDDHLAPQLMENLKVPVDL
FT                   IWGEKDPWEPIAEAKNWKSTIACIESMNVIEQAGHCAHDEAPNEVNSVLTKLIEESIGE
FT                   "
FT   gene            complement(149723..150724)
FT                   /locus_tag="Syncc9902_0141"
FT   CDS_pept        complement(149723..150724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0141"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25116"
FT                   /db_xref="GOA:Q3B0L2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25116.1"
FT                   /translation="MTTPSYQEFTLKPFSKRSNTRALLQIANTLIPYGFLWWLMLQAAA
FT                   VSLWLTPPFLIVLSLFSLRSFSLMHDCGHGSLFETARLNRIFGFLLGVVNAIPQLSWSI
FT                   DHAYHHKTNGDWERYRGVADFLSLDEFQKLSRKEQRIYETTHHPLMAIPGGFYYLAIKP
FT                   RLDLLVGLISPKNRMWGSREELNDLCLSNLFSLITVVCLGWWIGFGLFLSLYSIVLCLT
FT                   ASSLIYVFYVQHIFENSYANPSEGWSPIRGALEGSSLLVLPPLLQWFTASIGFHNIHHL
FT                   CERIPNYNLEACHQQNQHLLQNVPTLTLGTMLQCSKFLLWDPAKLSLAKIPA"
FT   gene            complement(150730..150981)
FT                   /locus_tag="Syncc9902_0142"
FT   CDS_pept        complement(150730..150981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25117"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25117.1"
FT                   /translation="MEQRNGSTKTVLSLLKLHSGTSSERLIFKHRNHLIQAYQPDDTLL
FT                   ADALTSAIQGVALHSQATFPQDAIRLVEHRTLEFVSPI"
FT   gene            151069..152127
FT                   /locus_tag="Syncc9902_0143"
FT   CDS_pept        151069..152127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0143"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25118"
FT                   /db_xref="GOA:Q3B0L0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25118.1"
FT                   /translation="MFKFDGTWPLPDDSLSPYGIWVAEVMLQQTQLSVVLPFWQRWMET
FT                   FPTVNALATSSLEEVRLQWQGLGYYSRARRLHEAAQLLVELPWPRDLDGWMALPGVGRT
FT                   TAGGILSSAFNAPTPILDGNVKRVLARLHAHGRPPSRDQPRFWHWSEVLLDQSRPRDFN
FT                   QALMDLGATVCTPRRPGCHQCPWRDSCAAYASGDPSDWPVVEERKPLPFQVIGIGVVIN
FT                   EAGDVLIDQRLEEGLLGGMWEFPGGKQEPDEPIEACIVRELMEELGIKVSVGEGLITVD
FT                   HAYSHKKLQFVVHLCRWISGEPQPLASQQVRWVRPEQLKDYPFPAANGRIIEALLGRLN
FT                   KSNQLEGSGEGS"
FT   gene            152127..153086
FT                   /locus_tag="Syncc9902_0144"
FT   CDS_pept        152127..153086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0144"
FT                   /product="putative fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25119"
FT                   /db_xref="GOA:Q3B0K9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25119.1"
FT                   /translation="MADPNGVICLGEALIDRLGPLGGDSACDQPVDDRLGGAPANVACA
FT                   LARLGTAVAFVGRVGGDAIGAEFQRLFVQRGVDSSTLQLDPSRPTRIVLVRRSGDGERQ
FT                   FQGFAGDQGDGFADQALQPVALPSTACWLLVGTIPLASPQSAQALLDAVARARSHGIAL
FT                   ALDVNWRPTFWNATADPDAGPTQAARSAIRPLLEQAALIKLAREEALWFFAGDDPGVIS
FT                   SGLPQRPDVVLTDGPAPVRWCIGGESGTQPALSPPQVIDTTGAGDAFTAGLLHRWLAPV
FT                   TERLRFAAACGALVCAGAGGIDPQPTEAQVEAFLGGVS"
FT   gene            complement(153053..153553)
FT                   /locus_tag="Syncc9902_0145"
FT   CDS_pept        complement(153053..153553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0145"
FT                   /product="Protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25120"
FT                   /db_xref="GOA:Q3B0K8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25120.1"
FT                   /translation="MNWNLCRGPEASGSRWSQLTDGTIRLSDLEATQALGAELAQRLPA
FT                   EAILLLKGPLGAGKTSLVQGIALALGIGEPITSPTFALAQHYTDGNPPLIHLDLYRLEQ
FT                   STAADDLFLQEDEEAKAIGAFMAVEWPERLSLDLPEAWQLQLSLTNDGGRRAQLTPPKN
FT                   AST"
FT   gene            153579..155009
FT                   /locus_tag="Syncc9902_0146"
FT   CDS_pept        153579..155009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0146"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25121"
FT                   /db_xref="GOA:Q3B0K7"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0K7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25121.1"
FT                   /translation="MVAAPTTATELKLGTDCVIADINLAAFGRKELDIAETEMPGLMAL
FT                   RAKYGNEKPLKGARIAGSLHMTIQTAVLIETLEELGADVRWASCNIFSTQDHAAAAIAA
FT                   NGTPVFAVKGETLEEYWAYTHRILEWSDGGAPNMILDDGGDATGLVILGTKAEQDITVL
FT                   DNPSNEEETFLFASIKKKLAEDSSFYSRTKAAIQGVTEETTTGVARLYKMQKSGELPFP
FT                   AINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVVGYGDVGKGSAQSLRGL
FT                   GATVCIAEVDPICALQAAMEGYRVVRLDDVVDQMDIFVTATGNYQVIRNEHLVKMKDEA
FT                   IVCNIGHFDNEIDVASLKDYKWDNIKPQVDHITLPSGNKIILLAEGRLVNLGCATGHPS
FT                   FVMSNSFTNQVLAQIELFTKANEYGKEVYVLPKHLDEMVARLHLSKIGANLTELSKDQA
FT                   DYINVPVEGPYKPDHYRY"
FT   gene            155056..155715
FT                   /locus_tag="Syncc9902_0147"
FT   CDS_pept        155056..155715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0147"
FT                   /product="putative alkaline phosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25122"
FT                   /db_xref="GOA:Q3B0K6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25122.1"
FT                   /translation="MGFSDLVTQLPELIGQAVEANQWLGYTAIFAAMFLENLFPPIPSE
FT                   LIMPLGGFYVQQGQLQLVPVVLAGLLGTVLGALPWYGIGRLVNEERIELWLSRYGGWIG
FT                   IRPEELGRSRKWFSRYGTALVFWGRLVPGIRTLISVPAGIEMMPMTPFLLWTTAGSLIW
FT                   TALLTVAGMVMGEGYSNVELWIDPVSKAVKVILVIAVLGGATWLGLRIWRRRNSAD"
FT   gene            complement(155729..156106)
FT                   /locus_tag="Syncc9902_0148"
FT   CDS_pept        complement(155729..156106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0148"
FT                   /product="Single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25123"
FT                   /db_xref="GOA:Q3B0K5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25123.1"
FT                   /translation="MGVNSVTLVGRAGRDPEVRYFESGSMVANLTMAVNRRSRDDEPDW
FT                   FNLEIWGKQAQVAADYVKKGALLGIIGSFKLDRWTDRSSGEERSKPVIRVDRLELLGSK
FT                   RDNQESGGNFGGQASDEDIPF"
FT   gene            156250..157302
FT                   /locus_tag="Syncc9902_0149"
FT   CDS_pept        156250..157302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0149"
FT                   /product="Cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25124"
FT                   /db_xref="GOA:Q3B0K4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25124.1"
FT                   /translation="MLFRRFQLSRDIGIDLGTANTLIYVSGRGIVLQEPSVVALDLERG
FT                   TTLAVGDEAKLMLGRTPGNIRAVRPLRDGVIADFDAAEQMLKTFIAKGNEGRGILAPRL
FT                   VVGIPSGVTGVERRAVREAGMAGAREVHLIDEPVAAAIGAGLPVTEPVGTMIVDIGGGT
FT                   TEVAVLSLGGTVLSESVRVAGDEISDAIGVYLKKVHNMVVGERTAEDIKIRIGSAFPDD
FT                   EFDQQSMDVRGLHLLSGLPRTINLKAGDLREAIAEPLNVIVEAVKRTLERTPPELAADI
FT                   VDRGIMLAGGGALVRGISDLISHETGIFVHIAEDPLLCVVNGCGQVLEDWKRFQRVVDT
FT                   PEFVRSMASL"
FT   gene            157307..158053
FT                   /locus_tag="Syncc9902_0150"
FT   CDS_pept        157307..158053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0150"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25125"
FT                   /db_xref="GOA:Q3B0K3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25125.1"
FT                   /translation="MAPSLRPGKSRWRGLGQLSPWLLLVAGLLLIRFSKGAGFTDAYAL
FT                   ITRPFWPGSAQREWIVSARTVEDQSRMQLLEQDNLRLRDLLELQRNGSRQGDVGAPVIS
FT                   RSPRGWWQQLELGKGALQGFQAGDAVLGPGGLVGRIASVTPATARVRLLTAPGHEIGVW
FT                   LPRSRSHGLLVGRGSSRLTLRFIDKDPNVSPGDLVTTSPASTLLPPNVSVGVIQSVNEQ
FT                   AVPAPTAIVQLIAAPEAIDWVQVRTR"
FT   gene            158029..158565
FT                   /locus_tag="Syncc9902_0151"
FT   CDS_pept        158029..158565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25126"
FT                   /db_xref="GOA:Q3B0K2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25126.1"
FT                   /translation="MGSSAHPLKMARLHRQPICAASALLVPLLVLGSPEWLSMNGVGPA
FT                   WVLLWLLPWALTDGPISGAFAGLALGLVLDGLSLEGVTQVPALLALGWWWGRLGRRGSQ
FT                   IQRSLNLGLLAWLGSVGLGLSVFLQVLIREGGTLDSFTQAWGWQTLWSQALITGLLAPM
FT                   LVSLQLLFWRRRVPS"
FT   gene            158562..159872
FT                   /locus_tag="Syncc9902_0152"
FT   CDS_pept        158562..159872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0152"
FT                   /product="putative sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25127"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25127.1"
FT                   /translation="MTFQLTRRRLLLAAVAAGLAACGRRSPGPELNLWTLQLAPKFNRY
FT                   FADLIAAWTTVHPEDSVRWTDLPWGSVERKLLAAVYARTAPDLVNLNPPFAANLASKGG
FT                   LTDLTPLLPSDAAERYLPSVWQACRDPDAGQIAVPWYLTVRLSLVNRELLDQADIAAPP
FT                   TRWDEIPAFARQIRKRTGRYGLFLTTVPDDSAEMLETLVQMGVSLLDSERRAAFNSPAG
FT                   RRAFQFWTDLYQEGLLPREVVSQGQRRAIELFQSGDLAMAATGAEFLRSIQTNAPGVAA
FT                   VTESHPPVTGADGMANVALMTLAVPRQSSKQALALELALFLTDATNQARFATEARVLPS
FT                   SVEALAMVRSQLEREKTRTPQQDQIRQARLLSAITLERARVLVPALPGIKRLQKILYTQ
FT                   LQRAMLGQVDSAEALGAAAMEWDRYAASRWPLDGSNS"
FT   gene            159963..160724
FT                   /locus_tag="Syncc9902_0153"
FT   CDS_pept        159963..160724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0153"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25128"
FT                   /db_xref="GOA:Q3B0K0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25128.1"
FT                   /translation="MTGELPSQPKATVLVVDDEAAVRRVLVMRLQLSGYRVVCAEDGEQ
FT                   ALELFHSESPDLIVLDVMLPKLDGFAVCRRLRAESCVPIIFLSAVEAISERVAGLDLGA
FT                   DDYLPKPFSPKELEARIATILRRVGRGNAVVESRELPTGQGVLRLGELVVDTNRRQVTR
FT                   GSERINLTYTEFSLLELLFRDPGHVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGK
FT                   LEPDPRNPELILTVRGIGYSSQRVGEVSATA"
FT   gene            160782..162290
FT                   /locus_tag="Syncc9902_0154"
FT   CDS_pept        160782..162290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0154"
FT                   /product="Lysyl-tRNA synthetase, class-2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25129"
FT                   /db_xref="GOA:Q3B0J9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0J9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25129.1"
FT                   /translation="MSELRDTRLEKANTLEQLGQGPYALTFDPSHRMAELQADHADLPN
FT                   GEERELSVAVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAGLEAQQEGWFKQITSLV
FT                   DAGDWLGVSGTLRRTDRGELSVKVRDWRMLSKSLQPLPDKWHGLADVEKRYRQRYLDLI
FT                   VSPQSRETFRRRALLVSGIRRWLDERQFLEIETPVLQSEAGGADARPFITHHNTLDLPL
FT                   YLRIATELHLKRLVVGGFERVYELGRIFRNEGMSTRHNPEFTSVEVYQAYSDYIGMMEL
FT                   TEAMIAEVCQQVCGGTRIHYQGTDIDLTPPWRRATMHELVEEATGLNFEAFTTRAQAAE
FT                   AMEAAGLEVPGAADSVGRLLNEAFEQRVEASLIQPTFVTDYPIEISPLARKHRSKPGLV
FT                   ERFELFIVGRETANAFSELIDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVHALEVGMP
FT                   PTGGLGIGIDRLVMLLTDSPSIRDVIAFPLMRPESRPDEAPSVG"
FT   gene            162318..162581
FT                   /locus_tag="Syncc9902_0155"
FT   CDS_pept        162318..162581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25130"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25130.1"
FT                   /translation="MSGERVGFRFKHADAVVKRNPQGRSRRGWVMEPVEQTTSRGTKMP
FT                   AYRIRWRDSERPEIVLQHMLIADPDPTPPPEGVSLEPPAPKA"
FT   gene            complement(162587..163060)
FT                   /locus_tag="Syncc9902_0156"
FT   CDS_pept        complement(162587..163060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25131"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25131.1"
FT                   /translation="MSWLEQLERELDQRLSGFLRNNPLQDQLFEEQHSRDRAQSLQRQR
FT                   QQLQQEAELQRQQLLHLAEDVRAWRQRSDKARQANASDLANRADQHLHGLMDQGRQLWN
FT                   DLDDLGRRFNEVEQQLLELKIQQKTPSRSDLEKDWALFEAEQELRELRNKAGL"
FT   gene            complement(163057..163299)
FT                   /locus_tag="Syncc9902_0157"
FT   CDS_pept        complement(163057..163299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25132"
FT                   /db_xref="InterPro:IPR030810"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25132.1"
FT                   /translation="MKQDERRQAIKQERERLIQDLEALYLAAFDRLGTLEGEVGEVKAA
FT                   QLTQMILNSKLAALEPLLKEIEKPLITTPAAGDQA"
FT   gene            complement(163324..164277)
FT                   /locus_tag="Syncc9902_0158"
FT   CDS_pept        complement(163324..164277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25133"
FT                   /db_xref="GOA:Q3B0J5"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25133.1"
FT                   /translation="MSIAVIDLHPAPTDLKRVVLEGLQRQPRQLPAWLLYDAEGSQLFA
FT                   AICDQPEYSLTRTEIALLESHASDIASAVGSGVVVEFGIGNAKKVDPLLRALRPKTFVA
FT                   LDISRSALEDSLTGLASQHPAIQMLGICCDHSQLEGLPTHPWLIGERRIGFFPGSSLGN
FT                   FTPKDAVLLLQRFRHLLAGGPLLLGLDQPRDPALLEAAYNDAAGVSKAFAFNLLKRLNR
FT                   DLHGNAEAKNFRYEARWQADQQRIEMALVSRCAQTIQLAESAWSFDHNERWVTEHSVKY
FT                   SPDAAADLAAQAGWQIQQRWHDDHDQISLHLLVPSN"
FT   gene            complement(164274..165425)
FT                   /locus_tag="Syncc9902_0159"
FT   CDS_pept        complement(164274..165425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25134"
FT                   /db_xref="GOA:Q3B0J4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25134.1"
FT                   /translation="MLLDTLMEVRRRSEALIAGLEPEDLGLQGMANASPPKWHLAHTTW
FT                   FFDTFVLQPYLTGHRPCDPRWSYQFNSYYDSVGERHPRSERGLLSRPPIREILEWRADV
FT                   DAGLTQLLGQEPTPELRTLVELGLQHEQQHQELLLMDLLDGFSRQPLEPTYSGDADLKT
FT                   RTNPRQWLAFEGGILEIGAQNNSFHFDNETPRHRVWLDPFQISDELISNAEYQTFIDDG
FT                   GYQRPELWMSDGWGLVRQHGWTQPRYWRDAHDEFGLAGRQRRDPAAPVRHLSWFEADAF
FT                   ARWSACRLPTEAEWEHACALHGPAMHHAHGVLWQWTASPYRPYPGFRPPPGAIGEYNGK
FT                   FMSSQMVLRGSCWLTPPGHSRDTYRNFFPPFSRWMAAGVRLAR"
FT   gene            165513..167441
FT                   /locus_tag="Syncc9902_0160"
FT   CDS_pept        165513..167441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0160"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25135"
FT                   /db_xref="GOA:Q3B0J3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25135.1"
FT                   /translation="MSVTGTVLVERYRLEERLSGPDPVQGSLWRGVDLLAGEIPVVIRQ
FT                   LESPASKQRLQRHWPLLQAILHPQIPRCGEQLEVDGVLWTVRDWQEGVSYAQLLQQREQ
FT                   RQMLFGPGEVLLLLRQLLPVLAVVHGRGLVHGDVNPRNLLRRSADGLPVLLDFGLVQAE
FT                   GEEPLAGATPGYAPRAQGRGEACAAWMDLHGLGVSSLVLLTGRPPEQLISPSEDGWCWP
FT                   EQLQLKDVFKEVLQRLLSEDPQRRFADAASVLAALKSVPMPEQSGPMARADRTVPLAPS
FT                   SITATEPALPSLTPAATPSRRLSRLEERELGAEGRLWPVVAALALSALVGSAIGWFLLS
FT                   RQAAPGKAPSTATDVVGQPQTASLPPAEVDERQQLLSRLRALQVDRTWFLKLANTAVLD
FT                   RFPERGGRLPSDDLEDAPLRRVWNDLAEDWLARIEQLPPTLRSRLGSLKQADWSEQRAA
FT                   LVKQGVTPRAVEQLVSAGARDLLPGDARGRQPQEPYRQLWYAAAIESLRDVQIEQVKAR
FT                   PRIATNLSLRIPAGGARLISVVVPAGAGLVLGINGTPLMEMTVFGADGEVRAERGPLRV
FT                   STLQPDLGSPVQVLITNDGVSSGSFTLSCRADQPRSRQQKPVLERRRRVPLPEVEAEPI
FT                   PDPATGE"
FT   gene            complement(167514..168017)
FT                   /locus_tag="Syncc9902_0161"
FT   CDS_pept        complement(167514..168017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0161"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25136"
FT                   /db_xref="GOA:Q3B0J2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25136.1"
FT                   /translation="MAKGGVKKAAAAAARAAANRLMADNRQARHQYEILETLETGIELV
FT                   GTEVKSIRNGKANLRDGFCLIRNGELQLHNVHISPHSHASAYFNHDPLRTRKLLAHRRE
FT                   IDKLRGQLDKKGLALIPLNIHLKGSWIKITIGVGKGRKLHDKRAADKEKQSKKEVRSAM
FT                   AKYQ"
FT   gene            168068..169111
FT                   /locus_tag="Syncc9902_0162"
FT   CDS_pept        168068..169111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0162"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25137"
FT                   /db_xref="GOA:Q3B0J1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25137.1"
FT                   /translation="MAIVSSSSGRKSPCRETALVDPQPAPEEQVIRPEDSLRPKRLSEY
FT                   IGQSELKQVLGIAVEAALGRGEALDHVLLYGPPGLGKTTMALVLAEELGVNCRITSAPA
FT                   LERPRDIVGLLVNLQPRDLLFIDEIHRLSRVAEELLYPAMEDRRLDLTVGKGSTARTRT
FT                   LDLPPFTLVGATTRAGSLSSPLRDRFGLIQRLEFYGQTDLEAIVARTAELVSVDLTFDA
FT                   CARIAASCRGTPRIANRLLRRVRDVASVRQGKGTIDDAMVAEALSLHRVDHRGLDASDR
FT                   RLLAMLMDQHGGGPVGLETLAAALGEDPVTLETVVEPFLLQQGLLVRTPRGRMVTDAAR
FT                   SHIAEAA"
FT   gene            169108..169878
FT                   /locus_tag="Syncc9902_0163"
FT   CDS_pept        169108..169878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0163"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25138"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25138.1"
FT                   /translation="MKRWLVGFLAVSLIWPWSALALDLKGLYEQALNASRSGDFVQALP
FT                   LWDRVLEQSPQDAAALSNRGNVRLALGDLDGAIEDQTRSIELAPDEADPHLNRGTAEEA
FT                   LRDWSAAAADYLWILERQPDDASALYNLGNVRGSEGDWDGARDLYGQASLARPGFAMAR
FT                   SSEALAAWQQGDLAWAELELRKLIRRYPLFADARAALSGLLWRQGSAGEAESNWAAAAG
FT                   LDQRYRQADWLVDVRRWPPQPTQDLMAFLALEKS"
FT   gene            169581..169651
FT                   /gene="tRNA-Gly1"
FT                   /locus_tag="Syncc9902_R0002"
FT   tRNA            169581..169651
FT                   /gene="tRNA-Gly1"
FT                   /locus_tag="Syncc9902_R0002"
FT                   /product="tRNA-Gly"
FT   gene            169880..171058
FT                   /locus_tag="Syncc9902_0164"
FT   CDS_pept        169880..171058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0164"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25139"
FT                   /db_xref="GOA:Q3B0I9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25139.1"
FT                   /translation="MDVLSSPLDRLGQELPELLELRQHLHAHPELSGEEHQTAALVAGE
FT                   LRSLGWRVQEGVGRTGVVAELGPNQGPIVGLRVDMDALPVEERTGLPYASKSQGVMHAC
FT                   GHDLHTCTGLGVARLLAALPSLQARVRLLFQPAEEIAQGAIWMRDAGATKGLDALFGIH
FT                   VVPNLPAGIVGIRRGCLTAAAGELEILVRGEGGHGARPHQSVDAIWMAAKVVTELQQAI
FT                   SRRLDALQPVVVSFGKVEGGRAFNVIADQVRLLGTVRCLDLDQHAMLPGWIEDTVQAIC
FT                   AGCGGSAEVRYRCIAPPVDNDVALTNLLERCAIDRLGRDRVVPVEQPSLGAEDFAELLR
FT                   DVPGMMMRLGVAGPDGCAPLHNGAFALDDTALAVGIEVLAATLLAWMAEYGG"
FT   gene            171058..171285
FT                   /locus_tag="Syncc9902_0165"
FT   CDS_pept        171058..171285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25140"
FT                   /db_xref="GOA:Q3B0I8"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25140.1"
FT                   /translation="MKVERVVAWLSLGAPLLIVLAVVAAQQRDGNDRVQALPVAVVGSA
FT                   LIVSSGLGRRRRRARLFANLKRSRVQDGDG"
FT   gene            171282..171893
FT                   /locus_tag="Syncc9902_0166"
FT   CDS_pept        171282..171893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25141"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25141.1"
FT                   /translation="MTEASPQPDLGALRDAIASGDPVRAMPALTQLRFCEAEDAVPLLV
FT                   LGTEQKPFLVRSLSCSGLGYKRTEQGWDVLSRLLGSDEDPNVRAEAANALASYGVERSW
FT                   PLLQATFTADGAWLVRCSILSALAEQPEIKLIWLLELAQAAITDGDGTVRVSGAEILGR
FT                   IVRDGINKPIGAEARALLQPLQQDVDHRVVAAALNGLQVS"
FT   gene            172076..173476
FT                   /locus_tag="Syncc9902_0167"
FT   CDS_pept        172076..173476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0167"
FT                   /product="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25142"
FT                   /db_xref="GOA:Q3B0I6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0I6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25142.1"
FT                   /translation="MRTQWVSARKGQANVSQMHYARKGVVTEEMAYVAKRENLPESLIM
FT                   EEVARGRMIIPANINHTNLEPMAIGIASSCKVNANIGASPNASDAAEEVNKLKLAVKYG
FT                   ADTVMDLSTGGVNLDEVRTAIIGASPVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEK
FT                   HCQQGVDYQTIHAGLLIEHLPKVKGRITGIVSRGGGILAQWMLYHHRQNPLFTRFDDIC
FT                   EIFKRYDCTFSLGDSLRPGCQHDASDAAQLAELKTLGELTRRAWKHDVQVMVEGPGHVP
FT                   LDQIEFNVKKQMEECNEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTP
FT                   KEHLGLPNAEDVREGLIAYKIAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSL
FT                   DPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDEDLEGLQKVLESQGAAELA
FT                   SVKLDKAE"
FT   gene            complement(173653..175662)
FT                   /locus_tag="Syncc9902_0168"
FT   CDS_pept        complement(173653..175662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0168"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25143"
FT                   /db_xref="GOA:Q3B0I5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25143.1"
FT                   /translation="MVAAPASLDTLCINSIRMLAVDAINKSNSGHPGLPMGCAPMGYAL
FT                   WDKFLNHNPKNPKWFNRDRFVLSAGHGCMLLYALLHLTGYDSVSIDDIKQFRQWGSKTP
FT                   GHPETFETPGVEVTTGPLGAGIANAVGLAIAESHLAAKFNKPDATLVDHYTYVVMGDGC
FT                   NQEGISSEACSLAGHLKLGKLIALYDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVA
FT                   DGNTDVDAISKAIAAAKAVTDKPSIIKVTTTIGYGSPNKADTAGVHGAALGAEEAELTR
FT                   KQLGWSYGPFEVPQEAYDQFRSAIERGASKEAEWNQTLAAYRTKFPTEAAQFERMLRGE
FT                   LPEGWEKSLPTYTPDDGGLATRKHSQICLGALGPNIPELIGGSADLTHSNYTDIKGETG
FT                   SYQPESPEKRYLHFGVREHAMAAILNGIAYHDSGLIPYGGTFLVFADYMRGSMRLSALS
FT                   MLGVIYVLTHDSIGVGEDGPTHQPIETIPSLRAMPGMLVFRPGDGNETSGAYKLAIQNR
FT                   KRPSSLCLSRQGMANQANSSIDKVALGGYVLEDCAGTPDLILIGTGTELDLCVQAAKQL
FT                   TADGKKVRVVSMPCVELFDEQADAYKEEVLPNAVRKRIVVEAAESFGWHRFIGLDGDSI
FT                   TMNRFGASAPGGTCLKEFGFTVDNVVAKSKALLG"
FT   gene            complement(175715..176962)
FT                   /locus_tag="Syncc9902_0169"
FT   CDS_pept        complement(175715..176962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0169"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25144"
FT                   /db_xref="GOA:Q3B0I4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25144.1"
FT                   /translation="MVEGLHRVVITGLGAVTPIGNTVQDYWNGLTSGRNGVDGITLFDA
FT                   SNHACRFAAEVKAFDPAGLIEPKDAKRWDRFCKFGVVAAKQAIAHAGLEITDANAHRIG
FT                   MIIGSGVGGLLTMETQAHVLEGKGPGRVSPFTVPMMIPNMASGLAAIALGTKGPSSAVA
FT                   TACAAGSNAIGDAFRLLQLGKADAMVCGGAESAITPLGVAGFASAKALSFRNDDPTTAS
FT                   RPFDKERDGFVIGEGAGILVLETLEHAQTRGANVLGEVIGYGMTCDAHHITSPTPGGVG
FT                   GAEAMRLAMDDAGITADAVDYVNAHGTSTPANDKNETSAIKSALGSRALQIPVSSTKSM
FT                   TGHLLGGSGGIEAVACVLALQHGIVPPTINHRTPDPDCDLDVVPNTARDQTLATVLSNS
FT                   FGFGGHNVCLAFRRFS"
FT   gene            complement(176971..177213)
FT                   /locus_tag="Syncc9902_0170"
FT   CDS_pept        complement(176971..177213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0170"
FT                   /product="Acyl carrier protein (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25145"
FT                   /db_xref="GOA:Q3B0I3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0I3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25145.1"
FT                   /translation="MSQEAILEKVRSIVAEQLSVDAGEVKPESNFQNDLGADSLDTVEL
FT                   VMALEEAFDIEIPDESAEGILTVGDAVKYIEDKQA"
FT   gene            177317..177616
FT                   /locus_tag="Syncc9902_0171"
FT   CDS_pept        177317..177616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0171"
FT                   /product="photosystem I iron-sulfur center subunit VII"
FT                   /note="PsaC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25146"
FT                   /db_xref="GOA:Q3B0I2"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25146.1"
FT                   /translation="MGDEGQVRFAQVFVRTGHMSHAVKIYDTCIGCTQCVRACPLDVLE
FT                   MVPWDGCKAGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGDETTRSMGLAY"
FT   gene            177671..179560
FT                   /locus_tag="Syncc9902_0172"
FT   CDS_pept        177671..179560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0172"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25147"
FT                   /db_xref="GOA:Q3B0I1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25147.1"
FT                   /translation="MCGIVALIGSREAAPQLLDGLRQLEYRGYDSAGIATVDAKGRLTC
FT                   LKAKGKLVNLTARVEAQGAFGQCGIGHTRWATHGKPEERNAHPHCNGDGSVAVVQNGII
FT                   ENHRNLREALEADGAVFLSETDTEVIPHLIGVELSRRLAVGETPSGAVLLHAVQAVLPQ
FT                   LQGAYALAVIWDQTPGALVVARKAAPLLIGLGEGEFLCASDTPALAGFTRTILPMEDGE
FT                   VALLSPLGVELYDAQGERQQRMPTLLTGTDHVADKREFRHFMLKEIHEQPETAELWVAR
FT                   HLPQGLTEQMPVALPFEALFYEGIERIEILACGTSRHAAMVGAYLLEQFAGVPTAVYYA
FT                   SEFRYSPPPLAPNTLTIGVTQSGETADTLAALAMEAKRRVAHGDPAYAPRQLGITNRAE
FT                   SSLSRQVPHILDIGAGIEVGVAATKTFLGQLLAFYGLAMAFAANRGSRSASEIEALADE
FT                   LRALPEHLRTLVDLHDQRCAALAYRFATTQAVIFLGRGINYPIALEGALKLKEISYIHA
FT                   EGYPAGEMKHGPIALLDAQVPVVSIAVPGLVFDKVLSNAQEAKARDAQLIGVAPEGPDT
FT                   ALFDELLKVPAMSEWISPLLTVIPMQLLSYHIAAHRGLDVDQPRNLAKSVTVE"
FT   gene            complement(179561..180523)
FT                   /locus_tag="Syncc9902_0173"
FT   CDS_pept        complement(179561..180523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0173"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25148"
FT                   /db_xref="GOA:Q3B0I0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0I0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25148.1"
FT                   /translation="MAGGAIARALANAGYGKSARDGALLTPSRTDLNLLDARAVNNWFE
FT                   ANKPTIVVLAAATVGGIQANTTRPADFLLQNLQIETNVIETAWRHGVRRLLFLGSSCIY
FT                   PKFSEQPIREESLLNGSLEPTNEWYAIAKIAGIKLGEALRLQHGFDVISLMPTNLYGPG
FT                   DNYDPTGSHVLPAMIRRFQEATDQNLKSVTCWGSGTPLREFLHADDLGSACLFALENWD
FT                   PSHPSAPKDDQGKPLAFLNVGTGFDLSIKELAEQVARIVGYKGSIEWDASKPDGTPKKQ
FT                   LNVSRLTNLGWTPKIPLEQGLPLAIEDFRQRRSMGLLRS"
FT   gene            complement(180574..181695)
FT                   /locus_tag="Syncc9902_0174"
FT   CDS_pept        complement(180574..181695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0174"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25149"
FT                   /db_xref="GOA:Q3B0H9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25149.1"
FT                   /translation="MPKHTQRVALITGITGQDGSYLAELLLEKGYIVHGIKRRASSFNT
FT                   SRIDHLYQDPHAKNQNLVLHYGDLTDSSNLIKIIQDIQPDEIYNLGAQSHVAVSFEAPE
FT                   YTANSDALGTLRILEAVRLLGLDNKTRIYQASTSELYGMVQETPQSETTPFYPRSPYGV
FT                   AKLYAYWITVNYRESYGMYACNGILFNHESPRRGETFVTRKITRGLARIDAGLEECLFM
FT                   GNLDSLRDWGHARDYVEMQWRMLQQDSPEDYVIATGRQESVRRFIELAARELGWCIKPD
FT                   ESALLWEGEGLEEFGRRRDTGAVVVRIDPRYFRPAEVETLLGDPTKAREKLGWTPVTTL
FT                   EQLVAEMIGHDRNEARKEAYLLKKGFDVVGPRE"
FT   gene            complement(181698..183155)
FT                   /locus_tag="Syncc9902_0175"
FT   CDS_pept        complement(181698..183155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0175"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25150"
FT                   /db_xref="GOA:Q3B0H8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25150.1"
FT                   /translation="MAATPLIPVILCGGTGTRLWPLSRASYPKQYWPLSGDGDATLLQQ
FT                   TQQRLEGLEALAAPLLICNEDHRFIVAEQMRQLGIEPNAILLEPMGRNTAPAVTVAALQ
FT                   ATADGDDPLLLVLAADHLIRNAEQFRAAVAAGRPAAEAGRLVTFGIVPTAPETGYGYIE
FT                   AAKDFNAGELKDVPIARFVEKPDQATAEQFLATGRFTWNSGMFLFRASAMLAELDRLNP
FT                   EVVSCCRAALEQDTADLEFLRLEREAFAKCPNVAIDVAVMEKTELGSVLPLDAGWSDVG
FT                   SWSALWETSDRDGDGNVLQGRVISQGSRNCYLRSEHRLVVGLGVENLVVVETDDAVLIA
FT                   DRSQAQAIKTVVKQLEADGSPEGKAHRKIYRPWGHYTGVTEGDRWQVKRISVKPGASLS
FT                   LQMHHHRAEHWVVVKGTALVERDGSEQLVGENQSTYIPMGCRHRLSNPGRIPVELIEVQ
FT                   SGEYLGEDDILRFEDRYGRSDLSLLQN"
FT   gene            complement(182872..182944)
FT                   /gene="tRNA-Thr3"
FT                   /locus_tag="Syncc9902_R0044"
FT   tRNA            complement(182872..182944)
FT                   /gene="tRNA-Thr3"
FT                   /locus_tag="Syncc9902_R0044"
FT                   /product="tRNA-Thr"
FT   gene            complement(183218..183760)
FT                   /locus_tag="Syncc9902_0176"
FT   CDS_pept        complement(183218..183760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0176"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25151"
FT                   /db_xref="GOA:Q3B0H7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25151.1"
FT                   /translation="MADSEEWLEEWLTVGKIVGVQGLQGELRVNPASDFPERFTVPGPR
FT                   WVRSKGSPPREMQLKTGRQLPGKSLFVVRLDSVDNRDAAEALVGSDWMVPADDRPQLGE
FT                   GEFHLLDLVGLEARLSPDSDPIGTVTDLISGGNDLLEIKRTDGSKLLIPFVEAIVPEVH
FT                   LKDGWLLLTPPPGLMDL"
FT   gene            183815..184000
FT                   /locus_tag="Syncc9902_0177"
FT   CDS_pept        183815..184000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25152"
FT                   /db_xref="GOA:Q3B0H6"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25152.1"
FT                   /translation="MASAAAPILPGSTVTVQDVTSIYNGYTGFVQRISGDRAAVLFEGG
FT                   NWDKLVTLRLKDLQAA"
FT   gene            184006..184854
FT                   /locus_tag="Syncc9902_0178"
FT   CDS_pept        184006..184854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0178"
FT                   /product="possible potassium channel, VIC family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25153"
FT                   /db_xref="GOA:Q3B0H5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25153.1"
FT                   /translation="MASDRSFRQRLRATVLEANTPAGKIYNLVIFGAILLSVVVLLLEP
FT                   NPLGNSALQQTEVLWIDLVQDSCLAVFAADFVLHLAVVPSPRKYLFSFTGLIDLSAVLF
FT                   FFVPQVRSELLLWVFKFGRILRVFKLLKFIDEAKVLAQALRGSARTICVFLFFVFLLQV
FT                   VLGYAIFVIESAGPNSQFDTVSKGVYWAIVTMTTVGYGDVVPQTALGRLLASVVMMLGF
FT                   GIIAIPTGILTVSGVKHHQNQLAGVPCPQCGRQGHRRDAQHCDQCGVLLGDSELISEPT
FT                   S"
FT   gene            complement(184800..185549)
FT                   /locus_tag="Syncc9902_0179"
FT   CDS_pept        complement(184800..185549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0179"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25154"
FT                   /db_xref="GOA:Q3B0H4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25154.1"
FT                   /translation="MDSTRTNKLLELLQTIGLQELNSSKLLSLVDEALIHVSAGRSKNF
FT                   ERLEFLGDAVLRLAATEFIDQQYPNLPVGRCSSLRAQLVSDRWLAQLGEQLQLESFLVL
FT                   GPKALGDAAAQATLQADATEALIGAIYSGSGNNLEPIHHWLTPHWQQTTADVLARPHLF
FT                   NGKTMLQEWSQAEGLGLPNYTTTEQSSRHGDPERFKSRVEVGSRLSANGFGRSRKEAEQ
FT                   NAATEAVQRLQDVGSEINSESPNNTPH"
FT   gene            186161..186487
FT                   /locus_tag="Syncc9902_0180"
FT   CDS_pept        186161..186487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25155.1"
FT                   /translation="MTQLHDLRLRLLVQQESEQIADSQPADLDLSVVQARCLCWLALLA
FT                   EAHEDQASDAEGRGDTEQAMGWFADSMRLRDVIGVVSSIEIPLPGVLDADQSDAGDNRG
FT                   AEAA"
FT   gene            186525..186989
FT                   /locus_tag="Syncc9902_0181"
FT   CDS_pept        186525..186989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25156"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25156.1"
FT                   /translation="MPDEPCQCPDCQRFYREHDRLIRESPTLRQQQELNWAALQSFRTL
FT                   SGRVLEELQKQQVPRQAAESATPAPLSSSAAPDEATDTIQQAIADLENINAHLFSIEAL
FT                   MERVFDVRVPEDIEQKFRELAGELAPDPLNVDRLRLNRLLHQTPDFPDRG"
FT   gene            complement(187064..189586)
FT                   /locus_tag="Syncc9902_0182"
FT   CDS_pept        complement(187064..189586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0182"
FT                   /product="Glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25157"
FT                   /db_xref="GOA:Q3B0H1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25157.1"
FT                   /translation="MTASQPFDLRLPTPGCHNDPERVGLDAKGVFDGMTEHLFFTLGKL
FT                   ASTASRHDLYMALSYAVRDRLMVRYLATTEALRAKPQKSVAYLSAEFLIGPQLNSNLLN
FT                   LGIQQEAEEALRNFGIESLQQILDVEEEPGLGNGGLGRLAACYMDSLASLKIPATGYGI
FT                   RYEFGIFDQLIRDGWQVEITDKWLKGGWPWELPQPDESCFVGFGGRTESYVDEKGNYRS
FT                   RWIPAEHAIGIPHDVPVLGYKVNICDRLRLWRADAAESFDFYAFNIGDYSGAVEEKVGS
FT                   ETLSKVLYPNDGTDEGRRLRLKQQHFFVSCSLQDMLRSLDHRGLSAEDFPEYWTVQLND
FT                   THPAIAVAELMRLLIDDRHLEWDRAWDITSRSVAYTNHTLLPEALEKWDLNMFRSLLPR
FT                   HLELIYEINRRFLQQVRLRYPGNEAILSRLSIIDEEGNKAVRMAHLATIGAHHVNGVAA
FT                   LHSDLVKSDLLPQFAALWPDKFTNVTNGVTPRRWMALANPELSTLLDQHVGSDWMSNMD
FT                   NLRKLEERQNDHAFLEHWASTKLSVKRKLASYIHRNTGVLVDPSSLFDVQVKRIHEYKR
FT                   QHLNALQIITQYLRIKNGQAGDMAPRTVLFGGKAAPGYYMAKLIIRFINGIAETVNSDP
FT                   DMDGRLRVVFLPDYSVKLGEQVYPGSDLSEQISTAGKEASGTGNMKFAMNGALTIGTLD
FT                   GANVEIRDLVGADNFFLFGRTVEEISALQQSGYRPRDFIEAMPELQEAIRLVETGHFSN
FT                   GDGELFRPLLDNLMGHDPFYVMADFADYVRAQDAVSLAWSDQMHWQRMSVLNTARSGFF
FT                   SSDRSIREYCQNIWNVDPLNLEITCDAR"
FT   gene            189875..191251
FT                   /locus_tag="Syncc9902_0183"
FT   CDS_pept        189875..191251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0183"
FT                   /product="putative Na+/H+ antiporter, CPA2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25158"
FT                   /db_xref="GOA:Q3B0H0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25158.1"
FT                   /translation="MLLPSLLSEISSHDLEVAETLIGILRFVLIFVGARTLSEILVRLE
FT                   LPTILGELLAGVIIGASGLHLLVPPETQVQLSGAFADVIAGMAHIPAEEVPVLYNESFG
FT                   ALQSVATLGLYSLLFLTGLESELDELMAVGKQAFSVAVVGVVLPFALGTLGLMSLFHVD
FT                   AIPAIFAGASMTATSIGITASVFGELGYLRTREGQIVIGAAVLDDILGIVILAVVVSLG
FT                   AGGSLDIAPIIQLVVAAVLFVVVALVLSRKAAPAFDWVIDQLNAPGGKLVGSYLLLGAS
FT                   CFAATAIGLEAALGAFAAGLIASTSKHRHEIQAAVTPIVGLFATVFFVLVGAGMDLSVI
FT                   NPSDPEARSALVIAAFLFVVAVIGKVVAGWAVFGKEPTNHLVVGLGMMPRGEVGLIFLG
FT                   LGTASGLLSPGLEAAILLMVIGTTFLAPVLLRLVLKDKPPEDGNQVPEEFAADPLGGSS
FT                   "
FT   gene            complement(191272..191589)
FT                   /locus_tag="Syncc9902_0184"
FT   CDS_pept        complement(191272..191589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25159"
FT                   /db_xref="GOA:Q3B0G9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25159.1"
FT                   /translation="MQDYIAFGGPLADPSVWRGALLWAIALYVPLSGPLSAFEASLTDS
FT                   RLSEKWRQITLVISSLLLALGVGVVTQLIASWALGPGWASSLGFIAIGWSLLIIAASRA
FT                   E"
FT   gene            191602..192513
FT                   /locus_tag="Syncc9902_0185"
FT   CDS_pept        191602..192513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25160"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25160.1"
FT                   /translation="MGFLASRHLPFVVEISPWSHLGHAVHTVCQEPDQPIPSDRPALLL
FT                   VHGFGASTDHWRYNIPVLSRSHPVHAIDLLGFGRSAKPATLQYGGALWRDQLVAYVHER
FT                   IGRPTVIAGNSLGGFAALAAGAALGEDCAGVVLLNAAGPFSDEQRPPKGWGAIARQSIG
FT                   TALLKSPVVQRILFENLRRPATIRRTLNQVYVDKTNVDDWLVEAIRRPSMDPGAFGVFR
FT                   TVFDIPSGQPLDELFAELTAPLLLLWGIRDPWINAPGRRSTFQRHAPEATKEVVLDAGH
FT                   CPHDEVPEQVNAALQEWLAELN"
FT   gene            192587..193435
FT                   /locus_tag="Syncc9902_0186"
FT   CDS_pept        192587..193435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25161"
FT                   /db_xref="GOA:Q3B0G7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25161.1"
FT                   /translation="MTLTQQSSPYAHWEFVHPETGDRLRIIPERGGIVSEWRCKGREVV
FT                   YFDQERYANPANSIRGGIPVLFPICGNLPGDLLRVDGQDHTLQQHGFARNLPWQLQVLD
FT                   DQQGVRVSLSSTEDTLKAYPFAFEVAMDVRPTPAALEITTTIQNRSSAEMPFSFGLHPY
FT                   FNISDLSQTRLTGLADRCLNHLEMADAETAAQLTRLPEGVDFLCRPAGPVTLIDDATGA
FT                   QLQLQHQDPMDLTVVWTEPPRKMVCLEPWTGPRQSLVSGDRKLVLQPGAEQTLSCRYAL
FT                   V"
FT   gene            complement(193420..194619)
FT                   /locus_tag="Syncc9902_0187"
FT   CDS_pept        complement(193420..194619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0187"
FT                   /product="putative glycolate oxidase subunit GlcE"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25162"
FT                   /db_xref="GOA:Q3B0G6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25162.1"
FT                   /translation="MSHTPATRAELITLVRQWHQDSTPWIPSGQGTRLDWGPALDPDHA
FT                   VLSCQHLNQVIDHAVDDLTITVEAGLPLVDLQRLLAAQGQWLPVDWPRGGEPTTTDRSD
FT                   DESQSQAGTIGGLIARGLSGGLRQRHLGIRDQIIGIGLLRSDGTAAKAGGRVVKNVAGY
FT                   DLMRLLCGSWGSLALITEVTLRVQPIRPAHAGLLLTGALADLERFRAALLLSTLTPERC
FT                   DWQCSGNGSWALRLVLSSVSDQAVQDQLNRIQSLATEHGLQANPKPCASPLDVAMRCQK
FT                   PSQVLRLVLPAASMHQLITSEALASLKGWSWELAAGAGCGDGWCSDAAPTFQIEALRRQ
FT                   VESLGGQLMVLVQTRDQPLVAWRDTPARPVIEAVKRQFDPLQQLSRGRLPGVDQHQTRA
FT                   "
FT   gene            194634..195980
FT                   /locus_tag="Syncc9902_0188"
FT   CDS_pept        194634..195980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25163"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25163.1"
FT                   /translation="MKVVVIDDDPTGSQAVHSCPLLLRWDVQALRRGLRHGSPLLFVLA
FT                   DTRSLTPDAAAQRNREIVTNLEVALTEEGLDRSEIQLVSRGDSTLRGHGVLEPAVLERC
FT                   FGPFAATLHVPAFIEGGRTTVNGVHLLHGEPVHTTPFAKDRWYGFSTSDLSQWLEQKSA
FT                   GAICAADVVKVSLEDLDQASTGGMPHLIQRLAALQGNVAVVVDAEHQSQLSALAAAVLA
FT                   LKGERRFLFRSAASVVKALADPGPQPLDSDGLARLRRRGLNGEELPGLVMVGSHVPLAD
FT                   QQLMRLLADPSCIGLELPVRRIARVLEGGTPDLLLLDLEREWCEQLQALFQSGRTPVLF
FT                   TSRGEIRLASASAGRLLSQTIARLMGRLANAVAPGLGYLISKGGITSQTLLADGLGLEA
FT                   VELEGQLMPGLSLVRPSEGVAQDLPILTFPGNLGTEGTLFEAWQRMQAS"
FT   gene            complement(195900..197261)
FT                   /locus_tag="Syncc9902_0189"
FT   CDS_pept        complement(195900..197261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0189"
FT                   /product="putative glycolate oxidase subunit (Fe-S)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25164"
FT                   /db_xref="GOA:Q3B0G4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25164.1"
FT                   /translation="MSEPLSADPTSSTSLPGLPAGAADPCVHCGFCLPTCASYRVLASE
FT                   MDSPRGRIHALRAIEAGELELDATVASHFDTCLGCYACVTACPSGVRYDQLIEATRPKL
FT                   NNAKLRSSWQISFRQLLLQVLPYPRRLRALLQPLRLYAGTPIQALARRSGLTRLFGPGI
FT                   EAMEQLLPSLAATAFDDALPTVNPASAPRRGRVALLLGCVQRCFDPSVNTATVSVLQAN
FT                   GFEVVLPPDQGCCGAVSHHQGEMELTRQLASALVDSMNAIEGELDAVLVAASGCGHTMK
FT                   AYGEILQNSNGFRAPVLDVHEFLTNVGLSDSFSAQLKPIAKAVAMHDACHMIHGQGIQQ
FT                   QPRTLLAAIPDLELREPMEAGVCCGSAGIYNLVQPEEAAELGTIKANDLSNTGAALVAS
FT                   ANIGCTLQLRRHLQGRQPVHHPMELLAASAGLHPLPSLEQSAFSTEVSRKREDR"
FT   gene            complement(197341..199182)
FT                   /locus_tag="Syncc9902_0190"
FT   CDS_pept        complement(197341..199182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25165"
FT                   /db_xref="GOA:Q3B0G3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25165.1"
FT                   /translation="MSDQSNAVEGLGGDTALKRLLIALCSISTLGMGCWVWLQHNRPLL
FT                   PLPDSKAGRALLRQYQGLTHDIWLILLLLAVGYLINRIYVSKKREAHKSDQTSPRPVES
FT                   CLQFLHNNPVTTVLLIAYTVAMISGTTYLYKDMLGWYPDLVKGYFLDHFSVRESFIEAT
FT                   MRRTDYRFFPLAHQDLHILSWFSIHIKTWMLFSAAELIGIILLSVRFLNNLGKQPWARA
FT                   STVLLITSLLLIHPSTGTAFFQVIYCERLLCLAFMLYINAYLLHLKTRSNSTFYTTLLW
FT                   ALIGIYIKDIAILLFIIPPASIWAADTINMRHKAKHFSHFLPSFSRDQPLEYWLCSLSL
FT                   VFITSYIILALIPSSYASEGAYNANSAFNIVLDLRFYLFALISTVRAISIAKKKTHFNL
FT                   LDAINLSGFAYAFALAATYELDTSSYLALPFQLIATINIAWAWIAIAEKGSNQNIKGRK
FT                   KIVGAALASAIVIGAEHGTAKDTFINNISEQKFEQSYVQLTYEKLDEVTRTIRESGDNV
FT                   NIIINTNSRLSAHRHLNRIPYTSLIEYIPNKEKFIVKDGAYKRSNYTPKVGDLIANLDK
FT                   KISLIEPILKNLETDLIYQHNPSERTGVIRRITAIRQ"
FT   gene            complement(199263..200687)
FT                   /locus_tag="Syncc9902_0191"
FT   CDS_pept        complement(199263..200687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0191"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25166"
FT                   /db_xref="GOA:Q3B0G2"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25166.1"
FT                   /translation="MVKFEKLTAPITGTAIRFENGQPVVADNPIIPFIRGDGTGVDIWP
FT                   ATQKVLDAAVAKAYGGTKSIEWFKVYAGDEACDLYGTYQYLPEDTLDAIRTYGVAIKGP
FT                   LTTPVGGGIRSLNVALRQIFDLYCCVRPCRYYAGTPSPHKRPQDLDVIVYRENTEDIYM
FT                   GIEWEADDAVGQELRQYLNDVVIPANGKLGQRQIPEGSGIGIKPVSKHGSQRHIRKAIQ
FT                   HALRLEGNKRHVTLVHKGNIMKFTEGAFRDWGYELATSEFRDVCITERESWILGNLEKD
FT                   TDLSVQANARMIEPGYDSLTPEKKADIDAEVQAVIDAIGSSHGQGKWKAMVLVDDRIAD
FT                   SIFQQIQTRPQEYSILATLNLNGDYISDAAAAMVGGLGMAPGANIGEKAAIFEATHGTA
FT                   PKHAGLDRINPGSVILSGVMMLEFLGWQQAADLITKGLSAAIANREVTYDLARLMEPQV
FT                   DPVSCSGFADAVIRHF"
FT   gene            200769..201701
FT                   /locus_tag="Syncc9902_0192"
FT   CDS_pept        200769..201701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0192"
FT                   /product="putative glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25167"
FT                   /db_xref="GOA:Q3B0G1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25167.1"
FT                   /translation="MASNALWVVAACFNEETVIPRFIERVIALPEVDRLLLIDDGSSDA
FT                   TVTVIRQWQAQHPNAGVVLLELTRNFGKEAAMLAGLDHVDGECSAALLIDSDLQHPPER
FT                   IPAMVAAWRDGAEVVTAVRDDRDEESRLKVATASWFYRVFNRLVDSIQLQEGAGDFRLL
FT                   SAPVVAAITQMREATRFSKGLMPWTGYRSVEIPYSRVARAGGQTSWNSIKLWRYALDGI
FT                   FSFSVRPLKVWGVIGVLISFLSFIYAALIVLRTLVLGADLPGYASLIVAILFLGGIQLI
FT                   GIGVLGEYIGRIYVDVKRRPHYFVRGIYR"
FT   gene            complement(201783..203021)
FT                   /locus_tag="Syncc9902_0193"
FT   CDS_pept        complement(201783..203021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25168"
FT                   /db_xref="GOA:Q3B0G0"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25168.1"
FT                   /translation="MNKTRLLGRLGRYGAVGIVAAAVHAVILLLLSNWISLSLANPIAF
FT                   LAASLAGYVGHALVTFREETGGKRFARRWLALQYAVNLSVCALLPLILGAWMQPILRTV
FT                   ILVFTPTVLNALIWSRAARFSARQRFQSGTPPLLHADDLGLAAGVDHAIFDLNQSGRLD
FT                   GASLLVNGPSAKTATDTWRQLPNPPALYLHLCLTEGPGDSANVDLPTSFGRLLLASWLP
FT                   WQRRRLKPQIRRSLRQQISRYQQLTGTNEIHLDGHQHVHLIPMVLDTVLGLAQREQVTW
FT                   IRTTAEPLPTNLPLHLWWDCFRQGGALKWLVLQCLTSLARPKLRAANMGTNQSFAGVLF
FT                   TGRMTGAALECCWHTNHFQNTSENGSRAMLLIHPAQPGGGDVMQEHQFTESFAFFSSPQ
FT                   RQQEWQAIKNLKI"
FT   gene            complement(203018..203767)
FT                   /locus_tag="Syncc9902_0194"
FT   CDS_pept        complement(203018..203767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0194"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25169"
FT                   /db_xref="GOA:Q3B0F9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25169.1"
FT                   /translation="MARALHIGVLGAMPEEIGSDLSHLQLLESEQHGDLTIHHGTWAEG
FT                   IRLSLAWSGWGKVSAARAATRLLSSAPDIDLLLFTGVAGAADPALTQWDVVLADAVVQH
FT                   DMDSRPLFPRFTLPALNRAQLNPDTSWLRWASTALAQAAQEGELDGFGLPSTGLIATGD
FT                   RFIGDADVLDALREALPGLKAVEMEGAAVAQVAEQEGMPWLVLRVISDGADASAAQSFG
FT                   DFIQMYDHRAWCLLQALLSRVELAPKR"
FT   gene            203822..204289
FT                   /locus_tag="Syncc9902_0195"
FT   CDS_pept        203822..204289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25170"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25170.1"
FT                   /translation="MSPIDQCVVNAGESVRSVAQVRAVASTVNLVREQFPAAKPNLRPW
FT                   RDDAQTRQWDEPESLDLSFHFPGWSPRLQCRSLLLQLRFQNHEGDEVQKLLGVLIRGMT
FT                   YDGERWRLATVGDWIPEGSHVPQAEQAAQLRQMCRDLFLLFDLKVHQREDP"
FT   gene            204346..205077
FT                   /locus_tag="Syncc9902_0196"
FT   CDS_pept        204346..205077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0196"
FT                   /product="Heme oxygenase (decyclizing)"
FT                   /EC_number="1.14.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25171"
FT                   /db_xref="GOA:Q3B0F7"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25171.1"
FT                   /translation="MISIAFMSVALAAQLREGTKKAHTMAENTGFVSCFLKGVVDKSSY
FT                   RKLVADLYFVYEAMEEEIDKLAEHPVVGPVGKKELNRVESLSQDLAYYFGENWKEEIQP
FT                   SPSAALYVERIHALAKESPELLVGHHYTRYMGDLSGGQILKNIAQKAMNMDGDDGLRFY
FT                   IFDDIADEKGFKTMYRSTMDELPIDQAMADRIVEEANNAFHLNMKMFQELEGNLVAAIG
FT                   KVLFGFLTRRQRTGSTEAATA"
FT   gene            205096..206160
FT                   /locus_tag="Syncc9902_0197"
FT   CDS_pept        205096..206160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25172"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25172.1"
FT                   /translation="MVTTLIRFLVPGTSNRFRCGGLSVELQTARLVSGLCATEVVTYRQ
FT                   RQLDSPFLDDCLKAEKPDPGVLWIVSWGFDVPGLIRRLRGHRVAYHAHSSGYGFSLPPN
FT                   VPVLAVSRNTLGYWGARAPRNSLHLLPNALDEAWLKRGARGSTELRPIDVLVQARKCSP
FT                   YVLNQLVPALRSSGLIVEVQTGWVEDLVDLFNQSTVYIYDSAEYWRSRGVSEGFGLPPL
FT                   EALASGCVVFSSFNHALSDYANPGFTTHQIGCSSLVFDQQRIISAVNAPQQWSADPFAI
FT                   DRLLDDCSEKILISRWKTSLTNLDALNALQMDGHPYLKTIPGWRLRLRDWLGRVATVVN
FT                   RLPVWPASSKRKGA"
FT   gene            206198..208039
FT                   /locus_tag="Syncc9902_0198"
FT   CDS_pept        206198..208039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0198"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25173"
FT                   /db_xref="GOA:Q3B0F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25173.1"
FT                   /translation="MNRRVQQFSLKSQTWTELSALLGKLPRRRKRLLGLVLLASFFQGI
FT                   LDILLIAFLARFVGLFSGAKLDDRLPGVLVFGGGLLDQAGWLLALLIASFWLTSGLRFA
FT                   VAYMQSMLSAEIWNDLVNQVYMNVLRQRYEFFVQNKTANLSEQFNRILNSVSTKVVSPL
FT                   IAISGNALSVSSLMIGVVFVLGWSAFFIFSLMLLAYASASLLITPYLRLATKQRVRYGR
FT                   RINLLLMESLRSIRDVQLYSVDQYFISRFSSDGVIAKRYDRLTRLLPDVPRFVIEPAGI
FT                   TILFMIGLAPAVLGGDASDVRNAIPSLFAIMFTLLKVSGPLQNTFRSLNRLRGGLPEIK
FT                   DALELLELQSERMVLTSPGVPTTDGVMPRRLIQLKDVSFSYQGSDKKVVNGVNLSIPVG
FT                   SRIALVGRTGSGKTSLAHLLLGLLQPTSGELVLDGIPVNSLDLPAWQANCALVPQDIRL
FT                   LDGSIRDNVAFGVNPSQINDDDVWAALAIAQFDEVVAQMNYGLYTMIGENGIKLSGGQR
FT                   QRLSLARSFYRGAKVLVLDEATSALDNKTEYDLMQGLDLVGRRCTTVVIAHRLSTVRKC
FT                   DRIYEISDGQVIASGNFDELYAGSSSFREMNLLGESH"
FT   gene            208048..210312
FT                   /locus_tag="Syncc9902_0199"
FT   CDS_pept        208048..210312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25174"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25174.1"
FT                   /translation="MADIILLSTADWDHPLWTNKQHTALALAELGHRVLYVESLGLRAP
FT                   RAGGRDARRILRRLCRMVRLPRQVAPRVWVWSPPALPGGQSGWPLALNRRLIQRGLEQM
FT                   AWWLDFKHWILWTYNPLTALYLDLHSHPISVYHCVDRIQEQPGMPTERIDAWEERLCRA
FT                   AQVVFTTSPDLQANHCRWNHHTYFHGNVADFQHFNRALHQPSLACPKPLTLISRPRLLF
FT                   TGAIDAYKLDLPMTVSLARTNPNWSFVFVGPVGEADPSTELAALRACPNVFVVGSQPYQ
FT                   DLPAWAAHSDLALLPLQQNGYTRHMFPMKFFEYLAAGLPVVGTAIPALKIHSDVAWLCE
FT                   PDPVAFASAIDRALQGQGPALNERLARAQAHTYATRTKSMLTVLRRVGVLAEAEQGNPQ
FT                   RFRLHRSRWNRGKTWLVSPLLKWVGLMADQLVSAGCGRSFTRLFCFLQSRGWLAPDLQS
FT                   RLAFLLVQNGDYPQALAVLEQLWRVHGRVDAIKRLLFRRGSRPQDRYEALQMFAVFATS
FT                   KHLPEHFTGYCWIVFAHRSADLEDAVLMRQALVGVVALAERLEADPDTVVCLRDNRRNR
FT                   LKMLVSCYATLLRLQLALGDATALKAVGRAGLALMQRLDPAAIDPNTSYRLTRNSLRVL
FT                   SIAALEAVESKDSALLDAVADAMAVQHRHIHQPCFDHQAAQEDHRGFSSLMLDAAHSMV
FT                   PTLRTGLDASGCDALERLLVLVIKSERDLDDPQRQLRALAKSKALFASFWSGSPPYSPW
FT                   S"
FT   gene            210303..211481
FT                   /locus_tag="Syncc9902_0200"
FT   CDS_pept        210303..211481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0200"
FT                   /product="putative glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25175"
FT                   /db_xref="GOA:Q3B0F3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25175.1"
FT                   /translation="MVVRPELSRGRVVLYIDSLKLGGAERVTLRLASWLHAAGWEPLLL
FT                   TRKPISWDFYSVPTGVSRHVEPVDPAWMRCLGPLALPFRLLRLRAWMKHQQVCLVIGMT
FT                   TIPAIKMLLARRGLGMPCVVSERNYPPLKPLGLPWRVLRRLTYPWADLHLVQTEAVGRW
FT                   LRRHLAAEPQLLLPNPVIWPLPDGEPRLDPQEWLKKAGVRADDPVLLAVGTKARQKGFD
FT                   RLVDWFRELAPRHPRLQLVIVGLAAGSYHGRDQQQDLRQQLSLDPLFRSRLHFPGQVGN
FT                   LQQWYERAQVFVLSSRYEGFPNVLLEAMASGCCCIAADCPQGPAELIKDGLNGRLIPEQ
FT                   ASQQIWVEAIDGLLQTPFQCQRFGSAARAVRERYEPGQLARSFVDAMETLRR"
FT   gene            211478..212674
FT                   /locus_tag="Syncc9902_0201"
FT   CDS_pept        211478..212674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0201"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25176"
FT                   /db_xref="GOA:Q3B0F2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25176.1"
FT                   /translation="MSDDLWVVLPHLGAGGAQKVALLAAERYLAMGWRVRLVTLLPNQP
FT                   VVHEFPVGLVHTDLGPEVASRWALFFTPQRRLHRLAVKAIFSLGWPLVAFAPWPVWRWC
FT                   VEAIGGPQAELLRRRCAADRPQRVLSMLSRTNIISCSALWDQPCHLVVSERNDLRRQTL
FT                   PFPWPLLRRLLYRRADVLTANTLGVLESLAALDGLRDPVLLPNPLPQRSGVEMAHAEMP
FT                   RQGFIAVARLVHQKGLDVLIDALAMAGGVARDWPLTLVGEGPEREALMAQVARLQLGDR
FT                   VRFLGHRSDVPHLLAEAAVFVLPSRFEGMPNALLEAMAQGLAVVVSDASPGPLEEIDHG
FT                   RSGWVVPSEDVGALAQALEYLAADPSQRQRLGGTARDQVLSRDWSQLAPVWDEVLGGT"
FT   gene            212671..213816
FT                   /locus_tag="Syncc9902_0202"
FT   CDS_pept        212671..213816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0202"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25177"
FT                   /db_xref="GOA:Q3B0F1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25177.1"
FT                   /translation="MTLQRVLVLAPTRRAASETFVRANLAGLPFATTAYFGDERPLGQP
FT                   WRLVYGVAVLMSKVLTRLGWLRLAGWPAAVVTKLLLRRHQPDLVLVEFGFHALRVMEAA
FT                   AECQIPLVVHFRGSDLSAWTKFGAQKMRYRRLMRIASGAIVKSQPMRQTLLDLGMESER
FT                   ILISASGANAQLFHSSAPGSAPPVFLAVGRFVDKKGPLYTIRAFAQLVGQHPRTDLALW
FT                   MVGEGPLQQQAEALVRELGLESVVRFWGAQPQQKVAELMREVRGFVQHSVVAPDGDSEG
FT                   NPVAVMEAQLSGLPVVATRHAGIPEVVRHGESGWLVAEADVVGMAAGLLRLVEDPGLAQ
FT                   RWGQAGRRRIQERFTIDHHLRDVAQFLRGISPRSRFQTSDR"
FT   gene            213813..214667
FT                   /locus_tag="Syncc9902_0203"
FT   CDS_pept        213813..214667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25178"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0F0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25178.1"
FT                   /translation="MTTRPKLLLIRGLGHSGTTILDLALGAHPSIMGLGEAVRILERPR
FT                   PDEAQRGPAQLRGDLRYERSCTCGKLAADCPVWGPLLDWLPTHDDLPLKAKLKHLLATL
FT                   PSADQPRWVVDSFQDDRLLPFWTENDLEIRVIHLTRDVRSWVHSRSRKERQHGRWLPEL
FT                   RPLLRWWRLSARDSYQFKALGNRVLRLGYEELALQPDVALRRVCAWLELPFVETMLQPG
FT                   DHSTSHVLSGNRMRFDPNQRQRIQYDGSWMQAASGLTHLALCIPALSRLNRSLVYSGLP
FT                   PRD"
FT   gene            complement(214640..216499)
FT                   /locus_tag="Syncc9902_0204"
FT   CDS_pept        complement(214640..216499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25179"
FT                   /db_xref="GOA:Q3B0E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25179.1"
FT                   /translation="MSSQIVVRRMGLALTLSGVLTILAAIAWIWIDENRASFPIPTTDA
FT                   GRDLALTYNIISHAIFISILIIAVGWMSWRIRKANHVEAEHTDRISHPTSHSKTITQRL
FT                   WNAIQKYPFSTGLFTLYSSYVVHKSSWFYKEIISWYDDLVGGFLLDNFSLRWTFLIETM
FT                   SRNDYRFFPLAHQDIHILSWFTPYVKIWALVNCIELAATVVLLTKIIELLTRRKQIPSL
FT                   LAVTGILFLFTPASAYNYFQFIYSERILVLLFAIFTYNYLRYQQTQRVQNHYAAIIASL
FT                   IGAFTKDTAILLFLIPALGVMGHGLIQEQRRTGLHSLREIGIFCRNRFQLEIHLIGVSI
FT                   FFLLSFVYLSVLPSHYVGEQRYDSELRFAALQLDPRLLFLLGYSCLRALQIARRRWSFS
FT                   LLDAINLAAWSYIGVLFYLVGFKASNYMALPVQFIAIVNLMVFCTETLAPRLPRKATTQ
FT                   RVAAGLSIGCSIALVAIEDGLPNTFVHRVKDITSAHDSWAASLAAVDDVTETARLHGEE
FT                   INLIFTKGWFRNNNHLRRLKYDRLIYLNEDTKEIRIQDGIGKGNSYNPKKGDFFLNIDT
FT                   GRRLKKFDIDLSDYDLIFDLNPNIDNGKIYRHRGRQSLGGKPE"
FT   gene            complement(216499..217326)
FT                   /locus_tag="Syncc9902_0205"
FT   CDS_pept        complement(216499..217326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25180.1"
FT                   /translation="MTSDPTFLLGVGAQKAGTSWLHDQLNRRKDADFGFCKEYHVFDAL
FT                   TLDAFARYRPQKPPLWRWRTWRRERFFQDPTRYFDYFTGLLNRPGYRLSGDITPSYSCL
FT                   SANTLRWIRNAFRERSVRTCPVFILRDPIERLLSQQRMQLRKKKQLNPADELRAFHKLA
FT                   EKLERTPSLRSDYVRTLRSLNESFAKEDICLMLFEQLFDASSHQHLYEQLTLPYQPMDI
FT                   AKKVNASSSTTPVPEEILARIGKTQATTYRTLLREQPQLNLDRHWPTATQWCT"
FT   gene            complement(217351..218199)
FT                   /locus_tag="Syncc9902_0206"
FT   CDS_pept        complement(217351..218199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0206"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25181"
FT                   /db_xref="GOA:Q3B0E7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25181.1"
FT                   /translation="MARQVQLGNITFANDRPFVLLGGVNVLEDLDFALHCASHYKTVCE
FT                   RLGIPLVFKASYDKANRSSIHSFRGPGLEQGLSILEAVKNTHGIPVITDVHTPEGAVAA
FT                   AAVADIIQLPAFLARQTDLVTAMANTGAVINIKKPQFLSPEQMANIVEKFKECGNEQLL
FT                   LCERGSNFGYDNLVVDMLGFGVMKQTCQDIPLIFDVTHALQCRDPGCAASGGRRSQVVD
FT                   LARSGMAIGLAGLFLEAHPNPAQARCDGPSALPLNLLEPFLTQVKAIDDLVKGMPMLQI
FT                   K"
FT   gene            218736..221132
FT                   /locus_tag="Syncc9902_0207"
FT   CDS_pept        218736..221132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0207"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25182"
FT                   /db_xref="GOA:Q3B0E6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25182.1"
FT                   /translation="MSFLAGLNDAQRRAVDHHQGPLLVVAGAGSGKTRALTHRIAHLIG
FT                   EHGADPGQILAVTFTNKAAREMKERLELLLAQRLAQSQFGQPWSTLPPVQQRQLRSRIY
FT                   REITKELWIGTFHALFARMLRFDIDKFRDPDGLTWTKQFSIYDEADAQSLVKEIVTQEL
FT                   QMDPKRFEPKKVRWAISNAKNQGWLPDQLEANAEGQRGKLTADVYRRYRKALAANNALD
FT                   FDDLLLLPVQLLQQNEQVRRYWHRRFCHVLVDEYQDTNRTQYDLIKLLVTDGKEPQAYD
FT                   DWSGRSVFVVGDADQSIYSFRAADFTILMGFQDDFGDQAPDDATRTMVKLEENYRSTAT
FT                   ILAAANALISNNSERIDKVLRPTRGEGELITLTRCDDEIAEAEAVVHRLRMMEAANPDL
FT                   SWGDMAVLYRTNAQSRAMEESLVRWGIPYIVVGGLRFYDRREIKDLLAYLRLLVNPADT
FT                   VSLLRVINVPKRGIGKTTIQRLTDAANQLGIPLWDVVSDAEAVRSLGGRSAKGLLQFCE
FT                   LVNDLKTQVQTAAPSELLQQVMEKSGYVSELITEGTDEAEERRRNLQELVNAALQYQEE
FT                   NDDGNLEGFLASAALSSDADNKDTAADRVTLMTLHSSKGLEFPVVCLVGLEQGLFPSYR
FT                   SLDDPASLEEERRLCYVGITRAKERLFLSHASERRLWGGMREAAVPSVFLSELPEALVQ
FT                   GDLPQTGGAALRRERRLDRLTRVDRGQPSSAPANAVRRRQAGPAPGRSWSVGDKVTHSS
FT                   FGVGEITHTFGSGEKISIAVKFVGMGPKILDPRLAPIEPLPDSDG"
FT   gene            221254..221964
FT                   /locus_tag="Syncc9902_0208"
FT   CDS_pept        221254..221964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25183"
FT                   /db_xref="GOA:Q3B0E5"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25183.1"
FT                   /translation="MSTAQLPIPIFIGYDPRERAATNVLIDSLYQHSSVPLAITPLVTP
FT                   QLENQGLFQRERDPKQSTAFSFTRFLVPYLMEYQGWALFMDCDMLCQADIKALWDQRDD
FT                   RYGAMCVQHEHVPGETVKFLGEVQSAYPKKNWSSLMLLNCSRCKNLTVDYVNTASGLEL
FT                   HRFHWLEGDHEIGAIEGGWNHLVDVQRPPAQEEPAPMLHWTLGGPWFREQRTMGGPLAA
FT                   QWFAARDEAIKLWD"
FT   gene            221964..222743
FT                   /locus_tag="Syncc9902_0209"
FT   CDS_pept        221964..222743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0209"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25184"
FT                   /db_xref="GOA:Q3B0E4"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25184.1"
FT                   /translation="MAIQKCVVAVPARLQSSRLPNKVLADIGGKPMIQRVLERCRESTS
FT                   VNAVVLCTDSQELQQRAAVWGFPVLMTAESCSSGSDRIASVADALMALAWGDATPAAEQ
FT                   TAVINVQGDQPFIDPQVIDAMAAEFRRLDPVPAVVTPVYGLKPETVHNPNVVKTLLAHD
FT                   GRALYFSRSAIPHVRDVDPSQWHRHTTYWGHVGMYGFRGDVLAGWNRLPASPLEDLERL
FT                   EQLRLIEAGLTMATFEVQGTSLSVDTAEQLEQARSMV"
FT   gene            complement(222822..223373)
FT                   /locus_tag="Syncc9902_0210"
FT   CDS_pept        complement(222822..223373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0210"
FT                   /product="Phosphatase kdsC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25185"
FT                   /db_xref="GOA:Q3B0E3"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25185.1"
FT                   /translation="MRGWRWWRIGKRLRQIKLLVLDVDGVLTDGGLWFDASGQLTKRFD
FT                   VRDGLGIRLLQQAGVEIAFLSGGQGGATEVRAHQLGIQHCLVGIKDKPEALLQLQQQLG
FT                   IDSSETAFVGDDLNDLAVRPVVGLLIAPADACAPVRLGAHAVLRKRGGHGAIRELAETI
FT                   LQDRGRWQNLKRDGWRDRND"
FT   gene            complement(223370..224398)
FT                   /locus_tag="Syncc9902_0211"
FT   CDS_pept        complement(223370..224398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0211"
FT                   /product="KpsF/GutQ"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25186"
FT                   /db_xref="GOA:Q3B0E2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25186.1"
FT                   /translation="MTCMTMGRSSWISVLSALTRCLQEEASAISTAAERLSSEQVEAAI
FT                   QLLERCADRKAKLVITGVGKSGIVARKIAATFSSIGLMALYLNPLDALHGDLGVVAPED
FT                   VCLMLSNSGETTELLEVLPHLKRRGTGRIAIVGRAESSLGRGSDVVLEASIDREVCPLN
FT                   LAPTASTAVAMAIGDALAAVWMERRGISPADFALNHPAGSLGKQLTMTAADLMVPVSKL
FT                   HPLQPDTSLPDVIGGLTRDGIGSGWVEDPTSPGSLMGILTDGDLRRALQDHNANTWSSL
FT                   TAADLMTADPITVRADVLVVKALEQMENNRRKAISVLPVVGDNKQLIGLLRLHDLVQAG
FT                   LA"
FT   gene            224402..225616
FT                   /locus_tag="Syncc9902_0212"
FT   CDS_pept        224402..225616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0212"
FT                   /product="possible polyA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25187"
FT                   /db_xref="GOA:Q3B0E1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25187.1"
FT                   /translation="MNLTGVPSSLLAELRSAAVGAGVKRLAIVGGAVRDGLLHERYGRV
FT                   WTGVPDLDWILEGDAMRLAAELVKRCGEQRVTELQNYGSFGTVALQLDGIALDFAMARK
FT                   ETYPMPGENPVVEPGSLDSDLVRRDFTINAMAQDLLSGQLIDPHRGQQDLAERRLVFLH
FT                   DESVSDDPTRVIRASRYAARLGFVLSPEALQQVTATVRRWPWSWQLHDAPDQAPPALAN
FT                   RLRMELDRLFAGEPWALALDCLEEWQAMALLDPSLQHDRGRNRRIAWAQRLGLPLLPAW
FT                   LAGAPDPEAVARRLGVPGQQQRWLKQLLQLQDWLVSTDAPDVHAAPDVWTAALENQGWM
FT                   PETVAFMVCSQPPQWKPLLRWWGRWRHLKSPRSARDLIADGWSSGPALGNELQRLRLEA
FT                   LKRSR"
FT   gene            225613..227052
FT                   /locus_tag="Syncc9902_0213"
FT   CDS_pept        225613..227052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25188"
FT                   /db_xref="GOA:Q3B0E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25188.1"
FT                   /translation="MIGSRSASIVLVVALVCAGFALKALWLIDATALWSDELYSVGKSF
FT                   QASPAALLSMLRHDTHPPLYYAVLWGWGQLVGQSPITLRLLSWLAYGAGGVVMVAQARA
FT                   LAVHKRLGWTVSLAALMAFCSPYPIRFSIEGKSYALLVLFVALAWWWRNQGRLVPYALA
FT                   VALASLTHFYGLFLLVAAGAWDGSRRRWGLCLAAGLGVIPALAWIAYASDYLFSSKAGS
FT                   WIGGPSFALLEDTLARGLGVWPLPKLALLLLTLVILRRWGGLKPVRWLDVDLLDRTGVI
FT                   PSGLMVVGVVLISFFKPLAFGRYFVVLIPALVPVLAVLLGDAQLNRGGRLFAGVVLMMV
FT                   IGSWWGPGFAELDSGLGGVREQDQFRMVSRYTDGLVERYSPRARLLNLSDRMEQSMGRM
FT                   APPVAAWGDRSALHQRLSITPHPSVIWLASSGPEQALFRKLNPLHEEVEQLGYRCVDRS
FT                   QGLSHGRILQCQLESKLNPVP"
FT   gene            complement(226994..229021)
FT                   /locus_tag="Syncc9902_0214"
FT   CDS_pept        complement(226994..229021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0214"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25189"
FT                   /db_xref="GOA:Q3B0D9"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25189.1"
FT                   /translation="MTPSGSLLLAGGGHSHALLLKRWAMTPRLRPKRSIVLINRHPTAL
FT                   YSGMVPGLIAGIYRREELSINLPHLCDRAGVAFVQAEISGIDSQRQDLLLHQRPALSFG
FT                   VLSLDVGAVTRNLEHLSGVPVKPLEEALQFLSQQDPEDPQPFRIVGAGPAGIEVALALR
FT                   RRWPRRPLELQIRAGQLNATTKSILSRAHIQCVTDANAHASLLCTGSRAPSWLANSGFA
FT                   VDHDGRVLTNSFLQLEGYSHLFASGDCAVMEAQPRPASGVWAVRSAVPLAQNLEAICNG
FT                   QSLKRWTPQRDALQLIGTGNNAAWMLRGHAHTGAFRLLWSLKQRIDHSFMAGFSQLAPM
FT                   GAAEPMACRGCAAKLPARPLNAALSQAGLKTQAEDAANLGGTPALLQSVDGFPALVSDP
FT                   WLNGRLTTLHACSDLWACGAKVTSAMAVVTLPSIHSTEQQELLHQTLAGVQSVLIEQGA
FT                   SLIGGHTLESRSPTPSPTTLGLQVALTVNGQTSKPWPKGGIQPGDALLLSRPLGVGVLF
FT                   AAAMAGVAKPKDVEAALRTMNQSQHRLVDGLQKHGADIHACTDVTGFGLLGHLGEMLQG
FT                   SEPITIQLWPNRIQAHPGALDLLDQGIASSLAPANRDAWSWLEGPVQLNASPSQACLEL
FT                   LVDPQTCGPLLLACTAAAAECLMAQDSAWIQVGIAGSGHG"
FT   gene            complement(229018..230052)
FT                   /locus_tag="Syncc9902_0215"
FT   CDS_pept        complement(229018..230052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0215"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25190"
FT                   /db_xref="GOA:Q3B0D8"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25190.1"
FT                   /translation="MARRVLITGGAGFIGSHTALVLLEQGYELVVLDNFDNSSPEALKR
FT                   VKTLANSNALELVEGDVRDLDAVNRAFDRGGPVDGVIHFAGLKAVAESVANPLHYWDVN
FT                   LNGSRVLATAMEQHQCRTLVFSSTSTVYGEPEVFPLHEEMPTAPVHPYAQTKLAVEQML
FT                   SALCRSGDWRVACLRYFNPVGAHPSGRIGEDPLGTPNNLFPFITQVAAGRRDKLRIFGQ
FT                   DYSTHDGTGIRDYLHVMDLAEAHSVTLDHLFHSTAPHQLTLNIGTGCGLSVLDVVRGFE
FT                   KATGLPIPYEVVARRPGDVPKLEGCPQKAKDILGWSAKRDLAQMCRDGWTWQQANPLGY
FT                   RSVP"
FT   gene            230154..230957
FT                   /locus_tag="Syncc9902_0216"
FT   CDS_pept        230154..230957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25191"
FT                   /db_xref="GOA:Q3B0D7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25191.1"
FT                   /translation="MNCPQVLPDLKRVIGGEGRALLQRFDLLRPLVEQMVTQTVLADVE
FT                   ISDQDLDQARLELLEQRGYERLDQWSELLNEIGRSHQEVVDRMAVVIRRQSLMHEQFGA
FT                   KAEARFLDRKHELDQVVYSLLRLESSFLARELYLQIESEESNFADLAKRYAEGPERNTN
FT                   GIVGPVSLTQAHPDLVEKLRVSQPGVLLEPFKISDWWLVVRLERYSPATFTAEVSDRMC
FT                   REMFDAWVSEQADSCLEQLQNASHENKESIDSEPMTAFSDFSISK"
FT   gene            230954..233869
FT                   /locus_tag="Syncc9902_0217"
FT   CDS_pept        230954..233869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0217"
FT                   /product="Type I secretion system ATPase, HlyB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25192"
FT                   /db_xref="GOA:Q3B0D6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25192.1"
FT                   /translation="MTQASSFPLLTHPAFNGLSEIGSNDLQQATRLLKFELGQQMCDAE
FT                   VIPARVLVLLSGQARLVGRQMGRLTTVGKFGPGSVIGAASLLTGSACENVIASDDVVAC
FT                   AIPDQVWSELYASEASFRAWCDQQVWPQELLQLLERLDRGSADADESPLEQLEQALQGA
FT                   LHCAPTPESVGAAIAVGQLVYVTSCWGEARVGQQLDAASVLPESDRFALRLVALAAPEA
FT                   ADREDSPAPLVHADAVESAELLPPVSRFSPERNVVDSLHLIRADGPLAETLACFQMLSQ
FT                   LMKLPFRRDSIEKVLQDNIRRGLTPNLQLCGQLAASLGLHVMAAKVPSLAGTRLQVPSL
FT                   LPWQGGFALVVASNEMGLRLASPKHGLVVLGPQELQASFPEGIDLLLMERSNATPDQKF
FT                   GPGWFWPALKRYRSVLIQVLAASFVVQLFTLANPLLIQVIIDKVITQRSLDTLQVLGIA
FT                   LVVVTILEGILGSLKTFLFAETTNRIDQRLGAEVIDHLLRLPLGYFDRRPVGELGTRVA
FT                   ELEKIRNFLTGQALTTILDAAFSVIYIMVMLVYSWLLTLIALSVLPIQIGLTLLGAPLF
FT                   RRQYRAAAEENAKTQSHLVEVLTGIQTVKAQNVEMVSRWRWQEFYSNYIARTFEKTITG
FT                   TALNQTSQVLQKISQLMVLWIGASMVLSGDLTLGQLIAFRIISGYVTQPLLRLSTIWQS
FT                   IQELRISFERLADVIDTPQESDEVDKTKVMLPPLQGQIRFEDLSFRFRPGQPEVLKDIN
FT                   LEVKSGTFVGIVGQSGSGKSTLMKLLPRLYEPDRGRILIDGFDISKVELYSLRRQIGIV
FT                   PQDPLLFSGTVSENIALTNPDVSSEEIVRAARLANAHDFIMELASGYSTPVGERGANLS
FT                   GGQRQRVAIARTLLSNPKLLVMDEATSALDYETERKVCDNLHGNLKEQTVFFITHRLST
FT                   IRQADMIVMMHQGAVVEVGSHDDLMKHRGRYYALYRQQESL"
FT   gene            233872..235062
FT                   /locus_tag="Syncc9902_0218"
FT   CDS_pept        233872..235062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0218"
FT                   /product="possible similar to leukotoxin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25193"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25193.1"
FT                   /translation="MKFNPFKFLSPVPDDVQQGVTNFDESVLQQGRFWMRTVTWTLIGT
FT                   TVFGVGWLALARTEEIVVAKGQLEPIDSVQDIQMPVGGVVEEILVKEGDSVKAGQVLIK
FT                   LDTEASEQQRKSLETSMILKREQLNLKQIERQRYEQVNNAEVRMLENNLALQTEILSRY
FT                   MQLKAAGAFSEVQLLTQKNTVEGTRGRLMQTRADRLRQLALLDQQMAQLNSEVADISSR
FT                   LAEARVTLRYQQLKSPLDGVVFDLQPTSAGYTAQSTETVMKVVPFGSLEASVEVPSNKI
FT                   GFVKVPVGCPKQLANCMNADISIDSYPATDFGILPGKVTRIGSDALAPNPQEQRQELSY
FT                   PVTVKLIQQQLQMKRGAKLPLQVGMSLTANIKLRKVSYLQLLLGEFQDKAESLQRL"
FT   gene            235068..236315
FT                   /locus_tag="Syncc9902_0219"
FT   CDS_pept        235068..236315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0219"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25194"
FT                   /db_xref="GOA:Q3B0D4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25194.1"
FT                   /translation="MKILFVHQNFPGQYLHIVQRLAKLGGHQLVALGINPLDQSRELSS
FT                   RIQYFQYSLRRGNAKNVHPLVMETEAKVIRADACAMAAEQLKSKGFMPDIICAHPGWGE
FT                   PLFLKAIWPEVSLLCYQEFFYNNIGFDIGFDPEFQDECGWWNQAKLEMKNAYLHLILEQ
FT                   ADWNITPTHFQASSFPENWRKKISVIHDGVDTQKATPNPLVKPLMLPDGVVIKRGEPVI
FT                   TFVNRRLEPYRGCHTFLRAIPELLQRCPEARIVIVGETTGVSYGAACEGGEWKDRFLSE
FT                   IEGQYDPSRVHITGSLPYHQFIPLLQISACHVYLTYPFVMSWSLLEAMACGCAVVGSDT
FT                   APVREVVRHGVNGLLIDFFSSDDLAQAVAELLQNPERAQAFGTEARRTVQRSYELEGCV
FT                   TRQLALMDLVASRSLK"
FT   gene            236360..237652
FT                   /locus_tag="Syncc9902_0220"
FT   CDS_pept        236360..237652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0220"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25195"
FT                   /db_xref="GOA:Q3B0D3"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25195.1"
FT                   /translation="MTQLQSLRGMVDLLPQALQRWQAVESVARTHFQRSGFGEIRTPVM
FT                   EPTDLFCRGIGEATDVVGKEMYTFNDRGDRSCTLRPEGTASVVRAALQHGLLSQGPQKL
FT                   WYAGPMFRYERPQAGRQRQFHQIGVEWLGAASARADVEVIALAWDLLASLGVGGLELEL
FT                   NSLGSTDDRCAYRTALVAWLEQRSNLLDEDSRARLNTNPLRILDSKNKATQALLDGAPT
FT                   LANSLAPESRERFEVVQQGLASLGIPFRLSPRLVRGLDYYCHTAFEITSDQLGAQATVC
FT                   GGGRYNGLIGQLGGPDTPAVGWALGMERLLLVVEAAANADPDGDSARLTAVVPPNAYLV
FT                   NRGEQAEKAALILARSLRCAGLVIELDNSGASFSKQFKRADRCGARWALVLGDEEVEKG
FT                   EVRIKPLSDESDDFFLGLHDLTGLLAKLTAM"
FT   gene            237709..238668
FT                   /locus_tag="Syncc9902_0221"
FT   CDS_pept        237709..238668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0221"
FT                   /product="NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25196"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25196.1"
FT                   /translation="MINLVTGGAGFVGSHLTDRLMQAGEEVICLDNYFTGRKTNISKWI
FT                   GNPRFELIRHDVTDPIQLECDRIWHLACPASPVHYQFNPIKTAKTSFLGTYNMLGLARR
FT                   VGARLLLASTSEVYGDPEVHPQPESYRGCVNTIGIRSCYDEGKRIAETLCFDYQRMHEV
FT                   EIRVMRIFNTYGPRMLPNDGRVVSNFIVQALRGSPLTLYGDGSQTRSFCFVDDLVEGMI
FT                   RLMNGNHTGPMNIGNPGEFTIRQLAELIRAKVNPDLPLIERPLPADDPLQRQPVIDLAR
FT                   KELDWEPNVALEDGLAVTIEYFRQALQPSGFQSTEVSV"
FT   gene            238665..240098
FT                   /locus_tag="Syncc9902_0222"
FT   CDS_pept        238665..240098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0222"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25197"
FT                   /db_xref="GOA:Q3B0D1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25197.1"
FT                   /translation="MMIKNICCMGAGYVGGPTMAVIADHCPNIQVTVVDLNQQRIDAWN
FT                   DSDLSRLPVYEPGLDFVVDRARGRNLHFSTDVDSAIAAADIVFISVNTPTKVKGLGAGQ
FT                   ASDLRWVEACSRQVANAAQGHTIVVEKSTLPVRTAETIRTILEASQAPLQEGEVPKSFA
FT                   VLSNPEFLAEGTAIRDLECPDRVLIGGEDDDSINALADVYMHWVEPAKILRTNLWSSEL
FT                   SKLTANAFLAQRISSINSVAALCESTGADVQEVARAIGTDSRIGPKFLQSGPGFGGSCF
FT                   QKDILNLVYLCRHFGLPEVASYWESVVELNTWQQHRISRLIVQRLFGTVTGKRVAILGF
FT                   AFKADTNDTREAPAIRIALDLLEEGAQLAIHDPKVEQAQIARDLREAPVELDPATGKSQ
FT                   GLSGVGSWLSANSVEEAVEGADAVVLLTEWSQYKSLDWQDLSRRMRRPAWVFDSRTIVD
FT                   PDQVRSAGLRLWCVGNGSL"
FT   gene            240095..241117
FT                   /locus_tag="Syncc9902_0223"
FT   CDS_pept        240095..241117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0223"
FT                   /product="putative nucleotide sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25198"
FT                   /db_xref="GOA:Q3B0D0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25198.1"
FT                   /translation="MTRTVLVTGAAGFIGSALSQRLLQQGDRVVGVDNLNSYYDPALKQ
FT                   ARLRQIEAVAQEGNWRFESVALEHGEALMKLFSAEKPQVVVNLAAQAGVRYSIENPAAY
FT                   IQSNLVGFGHILEGCRHHGVGNLVYASSSSVYGGNRNLPFDERQPVNHPVSLYAASKKA
FT                   NELMAHTYSHLYGLPATGLRFFTVYGPWGRPDMAPMLFARAILAGEPIKVFNHGKMQRD
FT                   FTYIDDIVEGVLRCCDKPATINPDFDPLQPDPATAAAPHRVFNIGNSQPTELLRFIEVM
FT                   EQALGCEAIKNFQPMQPGDVVATAANTAALEDWVGFRPSTPIQVGVDRFAQWYRSFYSV
FT                   "
FT   gene            complement(241185..241385)
FT                   /locus_tag="Syncc9902_0224"
FT   CDS_pept        complement(241185..241385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0224"
FT                   /product="putative photosystem II reaction center J
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25199"
FT                   /db_xref="GOA:Q3B0C9"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25199.1"
FT                   /translation="MSSKKSLYPDGRIPDRLPDGRPAVAWRSRWTEGVLPLWLVATAGG
FT                   MAVFFVVGLFFFGAYTGVGSA"
FT   gene            complement(241397..241516)
FT                   /locus_tag="Syncc9902_0225"
FT   CDS_pept        complement(241397..241516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0225"
FT                   /product="photosystem II reaction center L protein (psII 5
FT                   Kd protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25200"
FT                   /db_xref="GOA:Q3B0C8"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25200.1"
FT                   /translation="MERNTNPNNLPVELNRTSLYLGLLFVFVTGVLMSSYFFN"
FT   gene            complement(241526..241663)
FT                   /locus_tag="Syncc9902_0226"
FT   CDS_pept        complement(241526..241663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0226"
FT                   /product="Cytochrome b559, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25201"
FT                   /db_xref="GOA:Q3B0C7"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25201.1"
FT                   /translation="MSQAPMATTPRNYPIFTVRWLALHTLGIPTVFFLGALAAMQFIRR
FT                   "
FT   gene            complement(241667..241915)
FT                   /locus_tag="Syncc9902_0227"
FT   CDS_pept        complement(241667..241915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0227"
FT                   /product="Cytochrome b559, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25202"
FT                   /db_xref="GOA:Q3B0C6"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25202.1"
FT                   /translation="MAAGSTGERPFFEIITSIRYWVIHAVTLPSIFLAGFLFVNTGLAY
FT                   DAFGTPRPDAYFQATDTKAPVVSQRYEGKAQLDVRLK"
FT   gene            complement(241986..242987)
FT                   /locus_tag="Syncc9902_0228"
FT   CDS_pept        complement(241986..242987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0228"
FT                   /product="photosystem II stability/assembly factor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25203"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25203.1"
FT                   /translation="MNRLLSSAVNLLLVLVLGVGLSGCVSTRVPTASSSPWKAIDLETQ
FT                   ANPLDVSFTDPSHGFLVGSNRMIRETDDGGAHWNDRSLDLPDEENFRLISIDFEGQEGW
FT                   IAGQPGLLMHSTDGGQNWTRLFLDTKLPGEPYLITALGKSSAELATNVGAVYKTNDGGE
FT                   SWEASVTDAAGAVRDLRRSSNGSYVSVSGLGNFYATWEPGETVWKVHQRVSSQRLQSIG
FT                   YQPDGNLWMVARGAQIRLNDGDGNVEDWSKAIIPITNGYGYMDMAWDDDGGIWAGGGNG
FT                   TLLVSHDGGDSWETDPVGDQQPSNFTRFVFDDDHAFVLGERGNLLRWVGNAV"
FT   gene            complement(242999..243487)
FT                   /locus_tag="Syncc9902_0229"
FT   CDS_pept        complement(242999..243487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0229"
FT                   /product="probable rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25204"
FT                   /db_xref="GOA:Q3B0C4"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25204.1"
FT                   /translation="MHPSSRAVSDELESVEQSEPAAEAAETLEKAAVSDELESVKQSEP
FT                   APETAVEASAETDPRTHRFECRSCGYVYDPEEGVKKVGIDAGTAFSDLDPLSFRCPVCR
FT                   SKVAAFRDIGPRTKASGFEENLNYGLGVNRMTPGQKNVLIFGSLALGFAFFLSLYSLR"
FT   gene            243550..243912
FT                   /locus_tag="Syncc9902_0230"
FT   CDS_pept        243550..243912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0230"
FT                   /product="putative NADH dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25205"
FT                   /db_xref="GOA:Q3B0C3"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25205.1"
FT                   /translation="MFALPGYDAFLGFLLIAAAVPVLALVTNKLLAPKSRAGERQLTYE
FT                   SGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAIL
FT                   LVALAYAWRKGALEWS"
FT   gene            243916..244650
FT                   /locus_tag="Syncc9902_0231"
FT   CDS_pept        243916..244650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0231"
FT                   /product="NADH dehydrogenase (ubiquinone), 20 kDa subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25206"
FT                   /db_xref="GOA:Q3B0C2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25206.1"
FT                   /translation="MPESPSISAVRDLREATCGPIGTPEVTNELSENIILTSLDDLHNW
FT                   ARLSSLWPLLYGTACCFIEFAALLGSRFDFDRFGLVPRSSPRQADLLIVAGTVTMKMAP
FT                   ALVRLYEQMPEPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPPRPEAI
FT                   FDAVIKLRKKVGDESLAERSKHQQTHRYFTMTHQMKAVEPQVTGAYLRAESQQAALAAA
FT                   PAGQTLATDAAVLNPAPEMVQP"
FT   gene            244647..245228
FT                   /locus_tag="Syncc9902_0232"
FT   CDS_pept        244647..245228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0232"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25207"
FT                   /db_xref="GOA:Q3B0C1"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25207.1"
FT                   /translation="MSDSAPTNPTPTNPAPEESASAVATLEPGPVSQWLNTQGFDHDVL
FT                   DPDHVGVEQIGVESAVLPIIVAAIKSHGFDYLQCQGGYDEGPGERLVCFYHFIAMAEQV
FT                   EAMTAGRPHELREVRLKVFLSREGTPSLPSIYGLFRGADWQERETFDMYGIEFEGHPHP
FT                   KRLLMPEDWKGWPLRKDYVQPDFYEMQDAF"
FT   gene            complement(245256..246665)
FT                   /locus_tag="Syncc9902_0233"
FT   CDS_pept        complement(245256..246665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25208"
FT                   /db_xref="GOA:Q3B0C0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25208.1"
FT                   /translation="MSRPLAPKSPQSRRQQARANRGHRRQELMTRSQRAVRWLQPGLVV
FT                   KRWVLTSGLGLLLALIGGAVWADLKPIYWILETLSWLLGALTTILPREFTGPLVVLVGV
FT                   ALVLWGQSRSFGSIQQALAPDKDTVLIDALRAKSRLNRGPNIVAIGGGTGLSTLLSGLK
FT                   RYSSHITAIVTVADDGGSSGVLRRELGVLPPGDIRNCLAALSTEEPLLTRLFQYRFSAG
FT                   SGLEGHSFGNLFLSALTAITGNLETAITASSRVLAVQGQVVPATNVDVRLWAELENGQR
FT                   IEGESNIGHAPSPIVRLGCIPERPPALPRALEAIANADLIVLGPGSLYTSLLPNLLVPE
FT                   LVSAIRRSRAPRLYICNLMTQPGETDGLDVRGHLRAIEAQLASLGLNQRLFPAVLAQDD
FT                   LPSSALIKHYQSRGAEPVVCDSKGLKKDGYDVTQAPLQGARPTSTLRHDPRSLALAVMR
FT                   FYRKHKREQSQ"
FT   gene            246822..247520
FT                   /locus_tag="Syncc9902_0234"
FT   CDS_pept        246822..247520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0234"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25209"
FT                   /db_xref="GOA:Q3B0B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25209.1"
FT                   /translation="MQPGERLAVVGPSGAGKSTVLRLLAGLQLPTSGQLRLFGEPQDYL
FT                   RLDQTNPPDVRLVFQNPALLASLTVEENVGFLLREKGTLSNVEIRERVETCLEAVGLYE
FT                   VAHLYPGELSGGMQKRVSFARALIDDPQRGDQSMPLLLYDEPTAGLDPVACTRIEDLIV
FT                   KTTTVARGCSVVVSHVRSTIERSAERVLMLYEGHFQWQGSVDEFRSSTNPYVEQFRTGS
FT                   LRGPMQPAEH"
FT   gene            247526..248386
FT                   /locus_tag="Syncc9902_0235"
FT   CDS_pept        247526..248386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0235"
FT                   /product="possible ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25210"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25210.1"
FT                   /translation="MRRSVRDAIVGFTVLGGLVGFAATGMWMRGIRLGSSEWRLTANFN
FT                   DASGLAERSPVTYRGILVGSVRSIKVTSSAVVAELEITKGDLRLPLPVTATIGSASLLG
FT                   GDAQVSLMSRGKPLPENAPLPKAVTCQPKAQLCDGATVMGQEASSITTVTETLQELLTQ
FT                   AKAEKLIPNAAASMEQIDETAKSFEALTVQLQAELLKVDPVLRNLQAATAHANNIVASL
FT                   DNPETLTSLQQTATNAAELTAKLDAVGGDVETLTSDPAFMDGLRNVTIGLGALFSEVYP
FT                   AQTSR"
FT   gene            complement(248423..250534)
FT                   /locus_tag="Syncc9902_0236"
FT   CDS_pept        complement(248423..250534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0236"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25211"
FT                   /db_xref="GOA:Q3B0B7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25211.1"
FT                   /translation="MVASGVVAKNDQATRAFPLAAITGHGTLKLALLLAAVDPGLGGVV
FT                   IAGGRGTGKSVLARGLHTLLPPIDILDIDGGVGRNLDPQNEEEWDNATHEQISGDAPSK
FT                   VIPAPFVQIPLGITEDRLVGAVDVAASLSSGSAVFQPGLLADAHRGVLYVDELNLLDDG
FT                   IVNLMLAAVGSGENRVEREGLSLSHPCRPLLIATYNPEEGNIRDHLLDRFAIALSANQL
FT                   VSTEQRVEITNAVLAHGQCSRTFAETWSEETDALATQLLLARQWLPDVRISREQIEYLV
FT                   TEAIRGGVEGHRSELYAVRVARAHAALSGRDQVEADDLQVAVALVIAPRASQLPPPDQQ
FT                   MEPPPPQEQEPPPSQGDQQDQQDNPPPPPEGSGEEDDTPDDSNADEDNSDDDNTDDDSP
FT                   EDQAPPSVPEEFMLDPEAIDVDPDLLLFNAAKSKAGNSGSRSVVLSDSRGRYVKPMLPR
FT                   GPVRRIAVDATLRAAAPYQKARRERQPGRAVIVEEGDLRAKLLQRKAGALVVFLVDASG
FT                   SMALNRMQSAKGAVIRLLTEAYENRDEVALIPFRGEQAEVLLPPTRSITAARRRLESMP
FT                   CGGGSPLAHGLTQAARVGANALATGDLGQVVVVAITDGRGNVPLSKSLGQPELDGEEKP
FT                   DLKQEVLDVAARYRMLGIKLLVIDTERKFIGSGMGKDLAEAAGGKYVQLPKASDQAIAS
FT                   IAMEAIGTI"
FT   gene            250574..251065
FT                   /locus_tag="Syncc9902_0237"
FT   CDS_pept        250574..251065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0237"
FT                   /product="7,
FT                   8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25212"
FT                   /db_xref="GOA:Q3B0B6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25212.1"
FT                   /translation="MLRSDDLPLAIALGANLPYADAGSRQTLLMVRPLLTVVVNDWAAV
FT                   PLRFSWSPLFDTTPIGGPPDQPRYWNAVVVVHGLVATPSNEAAMRLLGELHQLESQFGR
FT                   QRSSEQRWGPRTLDLDLLFWGEHRMEHPNLVLPHPRLHLRGFVLEPLLAAMNQSSDWIA
FT                   "
FT   gene            251122..251682
FT                   /locus_tag="Syncc9902_0238"
FT   CDS_pept        251122..251682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0238"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25213"
FT                   /db_xref="GOA:Q3B0B5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25213.1"
FT                   /translation="MAPLPAPEPFELLETVETVDVRKLRFERNRIRLPMGVESTFGMVR
FT                   HPGASLAVPITDDGRVVLLRQYRFAVQARLLEFPAGTLEAGEDPLQSMQRELGEEAGFS
FT                   AARWDALGPMLPCPGYSDEVIHCFLARELTALENPPAGDDDEDLEVVTMTPVQLDDVLA
FT                   SGNEWLDGKSVTAWFRAKQLLGL"
FT   gene            251682..253115
FT                   /locus_tag="Syncc9902_0239"
FT   CDS_pept        251682..253115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0239"
FT                   /product="Deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25214"
FT                   /db_xref="GOA:Q3B0B4"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25214.1"
FT                   /translation="MTASRVLFWHRRDLRLADNLGIQAAVEISPAVTGVYVLDPALIQP
FT                   PQSLPPMAPARLWFLLESLIELQQRWRAAGSRLLILEGDPVQVLPPLAERLGAEAVVWN
FT                   RDVEPYSRERDRQVAKRLQADGRKVVVDWDQLLIPPELLKTGAGDPYRVYGPFLRNWRG
FT                   KVQAQQPITIEAPSGLVDLHSDLVPDRDPLAALLHRHGFQGTEICPCRPGESAALEQLT
FT                   LFADGPLSGYEPDRNFPSVVGTSYLSAALSVGTLSPRQAWCAAQQGRDHARSDEQRTAI
FT                   AVWEQELGWREFYQQALFHFPELADGPYREQWRRFPWENNEAWFSSWREGMTGMPIIDA
FT                   AMRQLNESGWMHNRCRMIVASFLVKDLICDWRWGERAFMELEVDGDLAANNGGWQWSAS
FT                   SGMDPKPLRIFNPATQATKFDADGEYIRRWVPELRHVNTKDLLTGEIGGLERRGYPEPL
FT                   ITHKTQQALFKTLYATIRS"
FT   gene            253238..253765
FT                   /locus_tag="Syncc9902_0240"
FT   CDS_pept        253238..253765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25215"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25215.1"
FT                   /translation="MWKGKEVRPKKIIRLHDEIRSDFYEQSDLSPEGLDWKKPTKKINA
FT                   EVPKGRLKPMEEISDGFIDEIVNFKGTKRHVIANLGIRKAGTRVGIHVHENDGITFVLK
FT                   GKGEITDFVEGSERSLNKQGDYYFMPRNVPMSASNLSGSDMTLLDLFVTDISTPLITII
FT                   EPGYPGYRNPVL"
FT   gene            complement(254315..255541)
FT                   /locus_tag="Syncc9902_0241"
FT   CDS_pept        complement(254315..255541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0241"
FT                   /product="putative pleiotropic regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25216"
FT                   /db_xref="GOA:Q3B0B2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25216.1"
FT                   /translation="MQVPPFSLSQQINDLSADLERAVLSVLQSGQYIGGAQIQHFETAF
FT                   AAATGVDFAVGCNSGTDALILALRALGVGAGDEVITCSFSFFATAEAISAVGATPVFVD
FT                   VDPTTYLINFDQIEAVITPRSKALIPVHLFGRPVDMTRCMAIATTHNLKVVEDCAQATG
FT                   ATWAGQPVGSFGDVGCFSFFPTKNLGAAGDGGAVTTNDAGLAQTMRELAVHGMPQRYLH
FT                   TALGYNSRLDAIQAAVLNVKLPKLAGWIKNRSTIANRYLERLAELPGIVLPKGDNGHSW
FT                   NQFVVRVGPCANASPLCAGSCPTSATSATHGLPESRCRDWFKQALQDAGVSTIIYYPIP
FT                   IHRQPAYAHLGHGEGTFPVTERLCSEVLSLPIFPELTATQQDQVVKALENLLSHDPLVK
FT                   NVTQNRMVA"
FT   gene            complement(255561..256229)
FT                   /locus_tag="Syncc9902_0242"
FT   CDS_pept        complement(255561..256229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25217"
FT                   /db_xref="GOA:Q3B0B1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25217.1"
FT                   /translation="MPSGAILMETVWICSAAMARTASTMLALGTPLPAFRLARVNGDKV
FT                   NGVQVKADTFASTDFEQKPILLMVLCAHCPFVKHIEPEITRLENDFASQVQFVGLSSNS
FT                   LITHPQDGPAQLAEQAQRHGWAFPYLLDDQQVLAKSLQAACTPEFYLFSQDSKDSSPTL
FT                   QYRGQLDSSRPGNNQPLNGSDLRAALNAVLTGTSVSQKQVASVGCNVKWNPGQEPEWFG
FT                   "
FT   gene            256251..256790
FT                   /locus_tag="Syncc9902_0243"
FT   CDS_pept        256251..256790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25218"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25218.1"
FT                   /translation="MLSGLVIGLVSCGVSSEPPSWRIFALQRHGAHDGLAVVNQPDGYG
FT                   IHIVLETDTSNPEVCQPRWLPDAARLFNGNGSTPFSSGLASRTEFFQSVARRDVLRALQ
FT                   GELQQLCALRAPQARWTWTKPPRSEAEVIPVELPALEEEDLLTNPLEELKRLKQLMKNQ
FT                   SDGLKSSQTTGSASRQ"
FT   gene            complement(256736..257176)
FT                   /locus_tag="Syncc9902_0244"
FT   CDS_pept        complement(256736..257176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25219"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25219.1"
FT                   /translation="MDLKRPIVWVHEESLGSTNPALEDYPDAPALFVFDQDWIRTKHIS
FT                   RKRLGFLYECCLDLPVTLRKGDVVAEVLAFAERHGADGVISSGAIEPRLQRHGAAINRD
FT                   CPLWILDGEPFVDLPRPPRLGRFSRYWREAEPVVWELFKPSD"
FT   gene            complement(257176..258072)
FT                   /locus_tag="Syncc9902_0245"
FT   CDS_pept        complement(257176..258072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0245"
FT                   /product="Deoxyribodipyrimidine photo-lyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25220"
FT                   /db_xref="GOA:Q3B0A8"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25220.1"
FT                   /translation="MPAPASPPIAGDLPRDISSREALNTLLEQEFPEASGAISPIRGGR
FT                   RAAEKQIRKMDVKRYARSRNHVNGAVTRLSPYIRHGVFTLAEVRDAVFQGISKRDDGSK
FT                   LINELGWRDFWQRMWQDLGDRIDDDQEAFKTGHSAASYSRELPDDVRDGCTGLACMDGF
FT                   REELVSTGWLHNHARMWMAAWLVHWRHVHWKAGADWFLEHLLDGDPASNHLSWQWIAST
FT                   FSHKPYFFNRDNLERYSEGRFCKTCSSANQCPFDASYEQLETTLFTQRAPIRDIPARRQ
FT                   NHRNKSTARPNPSTQRF"
FT   gene            258112..258939
FT                   /locus_tag="Syncc9902_0246"
FT   CDS_pept        258112..258939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0246"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25221"
FT                   /db_xref="GOA:Q3B0A7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25221.1"
FT                   /translation="MGENRANSTLFRFVLMLLDLTGKKILVTGIANNRSIAWGIAQQLK
FT                   AAGADLGITYLPDDKGRFESKVRELTAPLEPSLFLPLNVQDPEQMASVFAEIKEKWGVL
FT                   DGLVHCLAFAGKEELIGDYSATTAEGFARSLDISAYSLAPLCAHAKPLFSEKAGVITLS
FT                   YLGADRAIPNYNVMGVAKAALEASVRYLAAELGPDKQVRVNAISAGPIRTLASSAIGGI
FT                   LDMIHHVEERAPLRRTVTQMEVGGTAAFLLSDLASGISGQTIYVDAGYCVTGM"
FT   gene            259107..259712
FT                   /locus_tag="Syncc9902_0247"
FT   CDS_pept        259107..259712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0247"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25222"
FT                   /db_xref="GOA:Q3B0A6"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B0A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25222.1"
FT                   /translation="MRTGEVHRHTGETDVKVKLDLDGSGCCEASTGVPFLDHMLNQISS
FT                   HGLIDLTITAVGDTHIDDHHTNEDVGIAVGQALSQALGDRKGIHRFGHFVAPLDEALVQ
FT                   VALDCSGRPHISYGLTIPTQKIGSYDTELVKEFFVAVANNSGLTLHIRQLDGVNSHHIV
FT                   EACFKAFARALRMATEIDPRRAGAIPSSKGVLEQAGAN"
FT   gene            259780..261249
FT                   /locus_tag="Syncc9902_0248"
FT   CDS_pept        259780..261249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0248"
FT                   /product="lignostilbene-alpha,beta-dioxygenase and related
FT                   enzymes-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25223"
FT                   /db_xref="GOA:Q3B0A5"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25223.1"
FT                   /translation="MTVAPTRPYSREDWSSAFVNVDEELTDVALIPVRGTIPSELKGTL
FT                   YRNGPGRLERNGHRVHHPFDGDGMIAAMRFENGAVSLTNRFVRTEGWLAEEKANKVLYR
FT                   GVFGSQKPGGRLANAFDLRLKNIANTNVVRLGDQLLALWEAAEPHALDPVSLETRGLSR
FT                   MDGVLKKGEAFSAHPRFDAGHHDRPRMVTFGVKAGPRSTIRLMEFATDGPDAGVLLNDR
FT                   SDSFPGFAFLHDFAITPNWAVFLQNAISFNPLPFVTGEKGAAQCLASQPGGKGRFWLIP
FT                   RDCGRFAGQKPRILEAPDGFVFHHLNAFEDGDHVVVESIVYDDFPSIGPDDDFAQVDFD
FT                   SIPEGILHRCRLDLSREMVQTERIANRTCEFAMVNPQRQGLSAQYAWMAVAERDIGNDP
FT                   LQAIQKLDLSSGDTSTWSAAPRGFVSEPLMVARPGASAEDDGWVLDLVWNGARGASDLV
FT                   ILNAADLSEAAVLELPLAIPHGLHGSWAASV"
FT   gene            261347..262027
FT                   /locus_tag="Syncc9902_0249"
FT   CDS_pept        261347..262027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25224"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25224.1"
FT                   /translation="MRSFRAVVIVGLLLGAATPMHAHEVRCDGTLLELAVVEEGTSHTD
FT                   RFQFALRLEAKASSKNDALNELNRRLGTVRRKISGLAMGGLIVSAPRTYTVGSTTATQQ
FT                   RHQATSSITGEVSRSNYDPLIQQAGRLPGVSLQGMTSLSSTDGARSLQQQLLERALATG
FT                   RRQAESTQQLLGLRQLRLIRIDQRSGGGALRMSALSRKERSFDPAEAPKPRQSIRLNLD
FT                   YCLN"
FT   gene            262168..263187
FT                   /locus_tag="Syncc9902_0250"
FT   CDS_pept        262168..263187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25225"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25225.1"
FT                   /translation="MLWIHAGPHKAASSYVTERLRKNRSTLAAQRVLMDGDNNLLANSI
FT                   AEKNYQPLEQALSGLPSDFQRILISSSSLDTRILKRSVLTILRDMASSYGFKLGISYFI
FT                   RDQQSWLNSVYCHRVRRFRSTQDFPDYCRYIMNNPSSWDISYPSKFSPLKDYPEIVKMF
FT                   LPLSRQVEITDPFLALTSALGLKEPPGIGWLKGEPSKKNIQPGAKGIWMSRVCYQLMES
FT                   LGFDPDVLNRKGKVIRDLAIERGWDQEKFDGFDQPLLDRVAGFYASSNDAFSREHWGVS
FT                   WNELFPVKAASQFVYSGPDSEQEKKEMRRLMVRVLRELHFPWPLRKRFFKGYDSIVAG"
FT   gene            complement(263369..264919)
FT                   /locus_tag="Syncc9902_0251"
FT   CDS_pept        complement(263369..264919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0251"
FT                   /product="putative glycine betaine transporter, BCCT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25226"
FT                   /db_xref="GOA:Q3B0A2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25226.1"
FT                   /translation="MSEIPTTSRSWWKQPPLWVGAGPLLIFLVVSAIDLALAKHFTETG
FT                   KAIVSNALGGIWQWMVLLLFLIAIAIAISPVGRLRLGGEDAKPSLKFFDWCAVLICTLL
FT                   AGGGVFWSAAEPLFHFQTPSPTFEGVTGGTAAAVDPALAVSFLHWGFLAWALVATTTTI
FT                   TYSILERRGEPLRPRTLLVNILPRQLVDGPLGDLADGLSVVAAIAGTVGPLGFLSLQLS
FT                   NAAGQLPWLSDSAGLQSVVVLMLTAVFATSTVSGIQKGIKWLSELNVWLTIGMAAALLL
FT                   LGPGLWLIQHFFSGFLTYLIHLPQMALAQNDSANNWVNGWTVFYWGWFLGYAPLMGLFT
FT                   AGVSRGRSLRELVLAVAIFCPIVTNLWFTLLGGTGMHLELAGAGITDALAQNGAAAALL
FT                   AILSALPLSGLLIPVGLILVVLFMCTSADSMSYAAAMVVSGRNEPPPALRLFWALMIGS
FT                   LTLVLLRIGTGLGDSTSIDALQAFIVITAVPVTPLVLFTLWSAPRLAWKESLKQNRSN"
FT   gene            complement(264952..266145)
FT                   /locus_tag="Syncc9902_0252"
FT   CDS_pept        complement(264952..266145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0252"
FT                   /product="putative sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25227"
FT                   /db_xref="GOA:Q3B0A1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25227.1"
FT                   /translation="MSNNLSSLPDQASVVIIGGGMAGLSCAASLARQGVSDVVLLEAKT
FT                   LAHAQASSFGETRMFREMYSDPVLCKLAQEANRLWREEEVHAGETLRETHGLLFYGESW
FT                   DEETIEGSIPGARRVMDDQGIPYEALNAGEISARFPLKPKADFTGLFEPTAGAVRSDKV
FT                   IAHWRKTAEQAGHRLVEHAPVRSLDDDGGGVLLESGQHIAADQVVVACGVWSQLLLAPL
FT                   GLAPKLEVWPMLWAHYTVDPALADRYPQWFCFQKERGDDGGLYYGFPVLSTTSDGRPRI
FT                   KAGIDWAPKELRVKEPNAMCSEPPARLVELLDHFLFNNVSGIQERVETVISPYSMTSDV
FT                   NFVLDRLSPKLSLFCGGSGQSFKFAPLIGDSLARLARGESPAVDISCWNHKRSAVCA"
FT   gene            complement(266142..267197)
FT                   /locus_tag="Syncc9902_0253"
FT   CDS_pept        complement(266142..267197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0253"
FT                   /product="Glutamate dehydrogenase/leucine
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25228"
FT                   /db_xref="GOA:Q3B0A0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B0A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25228.1"
FT                   /translation="MANATKPEPSVSVLAQHVSAHLSVFVVAENTDSKRPANGGLRLLN
FT                   YPSDEACIADGQRLAGLMTHKHDLYGTGFAGGKIVARAQEPAAVKDELISVTAGLLESL
FT                   DGSMITGCDLNTSLEDMERLMSLTPHVLAAVGSPVDASAATAHGTLGAVEAVLSSDLKD
FT                   ATPGRALVHGCGAVGGTVAKTLVEEGWTVFTVDLNRERAGLAGATPLPPSCPWWEVKVD
FT                   LMLPCSISGLINSEIAEGMRTKAVVPAANAPFQNPQLADELRQRGIPVLPDPLVNAGAV
FT                   IADSIERFSPQAWKGAGAEDVYAFVRSEVRRRATEYLSQREQGLSVGDALTEVAADTAT
FT                   DPIGLSFKDTP"
FT   gene            complement(268303..268893)
FT                   /locus_tag="Syncc9902_0256"
FT   CDS_pept        complement(268303..268893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0256"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25229"
FT                   /db_xref="GOA:Q3B099"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B099"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25229.1"
FT                   /translation="MTENRVLVIASGNQGKIHEFQGLLSGLPLEVKPQPEGLDVEETGA
FT                   TFAANARIKALAVAQTTGHWALADDSGLSVSALNGAPGVHSARYAPTDPERIEKLLAAL
FT                   LQCNERSAHFSAALCVAAPDGAVLLEVEGRCEGQITKTPRGDQGFGYDPIFEVNNTGRT
FT                   FAEMSLAEKKSYGHRGRAFALLEPLLKNLIAVD"
FT   gene            complement(268890..270353)
FT                   /locus_tag="Syncc9902_0257"
FT   CDS_pept        complement(268890..270353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0257"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25230"
FT                   /db_xref="GOA:Q3B098"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B098"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25230.1"
FT                   /translation="MASAPLPLGPAPIQFGTDGWRGVLGVDITVERLLPVAAAAAQELA
FT                   HRAPEGLESRTVVIGYDRRFLAPELAESIAAAVRGCELEPLLTDTPVPTPACSWAVVER
FT                   QALGALVITASHNPPEWLGLKIKGPFGGSVEGDFTAAVERRLAAGGITTPIQTEVARFP
FT                   GRDEHLNGLRRKLDLAPIMAGLKAMNLKVIVDPMHGSAAGCISDLFGPAGTGWIEEIRS
FT                   ERNPLFGGNPPEPLAPYLQELITAVRASTAAGTPAVGLVFDGDGDRIAAIDEAGEFCST
FT                   QLLMPLLIDHLARARALPGSIVKTVSGSDLMRLVAEAQGRDVLELAVGFKYIAAEMLAG
FT                   DVLIGGEESGGVGFGMHLPERDALYAAVLVLEALVEGGQPLGARLTALQDQHGGASHYD
FT                   RLDLRLANMEARERLEQTLATATPKTVAGEDVREVIRTDGIKLRMGPSHWLMLRFSGTE
FT                   PLLRLYCEAPDVDRVHAVLAWAQHFAEAA"
FT   gene            270408..271916
FT                   /locus_tag="Syncc9902_0258"
FT   CDS_pept        270408..271916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25231"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25231.1"
FT                   /translation="MGATPLADNVLTDRLLRSWLRCRRKAWLDRHGDANQRRWTAHRNL
FT                   LLDDQQRSFVALLPHKPGHGLAACAAGDEGVVGLRFKGEGPSGEPVEAHPPLLLRVAGQ
FT                   SRWGPFAYQPVLARQGRRITREHQLPLALMGHLLEAYQAGPVPELLVLGGGGRRLERER
FT                   IRLTSGLRKQLSEALRKLNADLERPQPPALAADRRKCTLCSWRESCSRVASADGHLSEV
FT                   SGIGAKRREMLQELGVHGLNDLASANPERLAVEMERFGEQHGDVARVLVAQAVAQRDGL
FT                   VERLDSTFALPELQGAPGVLLYDIESDPDARHDFLHGFLRLPRQSDGRWDLAAATYHPL
FT                   LVMAEHGEQRSWLRLQRLLSRYDGWPILHYGETETLSLRRLAQRQGASDAQLRRLKRRL
FT                   VDVHARIRSHWRLPLSSYGLKSVAAWRGFRWSQSGVDGARALLWWRQWLGEGPKRRGSR
FT                   HGLAWIFRYNQDDCRATWAVAEWLLKEDDRLKTGSDTDQPTAGP"
FT   gene            complement(271895..272692)
FT                   /locus_tag="Syncc9902_0259"
FT   CDS_pept        complement(271895..272692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25232"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B096"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25232.1"
FT                   /translation="MNGALHWDATFPLLKLEGEGTRNFLQGQTSADVADTPEGNLVQTC
FT                   WLTATGRLRALLELRLRANGADVLVLAGDATAVARGFDQVIFPADRVRLQPIAEQRRVQ
FT                   RLSTSSAALWLDDDSQLPPNWTSNPANPKQFERWRIEQRLVFGPGELNADANPLELGLS
FT                   DHVSLSKGCYLGQETVAKLANLGGAKQELRGWICNQVLSVGDTLRANGERAGTITSVLD
FT                   TSEGSIGLALVRRRHLSAETLDGSDGETVQMNLLPADQGPAVG"
FT   gene            complement(272689..273273)
FT                   /locus_tag="Syncc9902_0260"
FT   CDS_pept        complement(272689..273273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0260"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25233"
FT                   /db_xref="GOA:Q3B095"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B095"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25233.1"
FT                   /translation="MPTSPGLTEEQRSDLMRRLATSAYKRGNFTLASGRQSEHYVNCKP
FT                   VSLSGTGLLLISTAMLSHVEDQSVAVAGLTLGADPLVSGVAVAGSLAHRDLDALIVRKA
FT                   AKGHGTGAWLEGPLPQPGALITVLEDVVTTGGSSLKAVNQLREAGYVVNRVITIVDREE
FT                   GGAAAMDAAELELISLFRLSEISAFAAELNQ"
FT   gene            273295..273861
FT                   /locus_tag="Syncc9902_0261"
FT   CDS_pept        273295..273861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25234"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B094"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25234.1"
FT                   /translation="MSLVCAEKGQTFASPGMRKFSALLTACMATAVSEMALSQMAVPVM
FT                   AGPVMCTTTLEAPDPSAGSGLVPVEVTTCGPTETTSALLNRRMFTWTAPFVRGIDVTHQ
FT                   ITDLLGIAVAGTGGNQLMGFGFPDQTIVWDASAIENTVEALIEEQSPLSAWRTQDISNG
FT                   FGSSLSMEQGQPPAQMEIPLVTPLW"
FT   gene            273960..275243
FT                   /locus_tag="Syncc9902_0262"
FT   CDS_pept        273960..275243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25235"
FT                   /db_xref="GOA:Q3B093"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B093"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25235.1"
FT                   /translation="MRLFLLAVLLVLPAFFAAAEVSLLRLRPSRVELLVEEGHAGAQAI
FT                   QRLQRRLRRALMVSQLGATLALVSLGWAGRGLGGRLWSDGSLGVAWRDASLFVLIVLLA
FT                   TFLGGLLPKAWVLNRPEKAALRLAPLLEVVMRCLAPLLNLLEAVAGLLMRLLGLAPQWD
FT                   VLVPALSAGELETLVESGRVTGLFPDERNILEGVFALRDTQVREVMVPRSGMVTLPASV
FT                   CFAELMEAVHHTRHARFPVIGESLDDVRGVLDLRQMAEPIARGQLESNSPLEPYLQPAV
FT                   RVLETSTLAELLPMIRSGQPLLLVVDEHGGTEGLVTAADLTGEIVGDDVQDETDEPELQ
FT                   AEEGRSGSWLVAGELEIFELNRQLDLDLPEADDHHTLAGFLLERLQHIPAPGEALSFQG
FT                   LQFEITVMAGPRIDRVRLILPNLDEVSD"
FT   gene            275281..276288
FT                   /locus_tag="Syncc9902_0263"
FT   CDS_pept        275281..276288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0263"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25236"
FT                   /db_xref="GOA:Q3B092"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B092"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25236.1"
FT                   /translation="MSADPIVPVKVGVIGIGNMGWHHARVLSLLRDADLIGVADPDPER
FT                   GHMATEQFGCRWFADYREMLSEVEAVCIAVPTLLHHPVGLACLQAGLHVLIEKPIAASQ
FT                   DEATALINAAHQAHRLLQVGHIERFNPAFRELIKVVANEEVVVLEGRRHSPHSDRANDV
FT                   SVVLDLMIHDIDLVLELAQAPVVRLAAAGGRSAEGPIDYVNATLGFENGVVASLTASKM
FT                   SHRKIRSLSAHCRSSLVETDFLNHTLHIHRRAHEWVSADHGELLYRNDGFIEEVSTTSI
FT                   EPLYAELEHFLQCVRGRETPAVDGLQASRALKLADLIEQAVEHPDSGHPLAAPI"
FT   gene            complement(276311..279493)
FT                   /locus_tag="Syncc9902_0264"
FT   CDS_pept        complement(276311..279493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0264"
FT                   /product="putative phosphorylase kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25237"
FT                   /db_xref="GOA:Q3B091"
FT                   /db_xref="InterPro:IPR008734"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B091"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25237.1"
FT                   /translation="MVLSTTELPQDNSRRDEVLERLDRAIERVVLERQDPISGLLPAST
FT                   AHTIHGNYGDAWVRDCVYSIQCVWGLTLAHRRRDGSSSPRAWELEQHVVALMRGLLRSM
FT                   LRQANKVERFKTSLNPLDALHAKYDGCSGDPVVVDDAWGHLQLDATSLFLLQLAQLTRS
FT                   GCAVIRSRDEADFIQNLIHYIARAYRIPDYGIWERGDKANHGCPERNASSIGMAKAALE
FT                   ALDGLDLYGPHGNGSCRVLVPQGAIVRLRRALVGLLPRESASKEADSACLSVVGYPAWA
FT                   VEDSDLVDRTLRRIRRELGGHYGYKRFLRDGHQTVVEDASRLHYEPEELSEFEGIESEW
FT                   PLFLAFELVTACCEQRWDDAQTWHAKLKTLAVQTNGDALYPELYLVERSAIEDERRTPG
FT                   SQRRIANTNLPLIWTQSLAWLGEMLLERLITPADIDPCNRRTPAALGADSVLVAFAPQT
FT                   ADVREALIAAGCPVDAEETISIHSSSALKNHLKSAGNNQRLGLSGRPGHRVETEETARF
FT                   YRHNGQQLVFTPTVLEDSNSYLADDTQQLLESVVDELHLLQRHWRGSGLPLLVIPVNSA
FT                   LFHQDPEIYLQLCQKLESGSLETISVQCDCLSRLAAQGQWVDLPNNQAPLNSTNITPSI
FT                   VLRDATDLRDLTAAEEQELDDTSIEQLTKRLSRSSLLHEQAEVLELLQRRLGSQKVQLR
FT                   PGERPIELRQLLAEVYQHGLRCQDWNVVRRCAGAMGMVHPQLEDALTDLLVRQKQVVVG
FT                   RNYTGESRLSQPQDSTAIAERIERTSGIDARERMLEQELLLALDSMVRREPTLLDGSLT
FT                   LQLGQLLLLLTSELSGEQSLSQDEAFEILCCEPPHRIRSRLRSVLTDVDHAKAALKRSE
FT                   QLHVSGRVQWTVPDPLERRPGNGDWLQHRIRLGSLQKVPRDFYAGIWSLLQHCRGLVIG
FT                   DKLERRNRLNSRLVLEKTAGERNFATLVDHLLSRIEAPEYRQLCCECLLSLMAFVEANA
FT                   DVRFDDDLALDVVIGHAVRVGWQHSHPSMDVDEYAKHKAQAWDQFYLASPGDCRRWQVI
FT                   ALKELTEQNSLV"
FT   gene            279542..280276
FT                   /locus_tag="Syncc9902_0265"
FT   CDS_pept        279542..280276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0265"
FT                   /product="N-acetylmannosaminyltransferase"
FT                   /EC_number="2.4.1.187"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25238"
FT                   /db_xref="GOA:Q3B090"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B090"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25238.1"
FT                   /translation="MDSVTTSPYDHRRCHVLGVPVDACRDVQAAALGLHANGGGRIVTL
FT                   NAEMTMAARDDQQLGAAIQTAQLVIPDGAGVVWALSKQRVHVVKSAGIELAWSLLSYAA
FT                   SHGWRVALIGASPAVMESLRMSLPQKFPGLNLVFAVDGYQSDQAWPGLESELKILQADL
FT                   VLIALGVPRQETWSQRVQQGQSGLWMGVGGSFDVWAGTKKRAPNWMCRMQIEWLYRLLQ
FT                   EPSRWKRMLALPAFVWQVVKTG"
FT   gene            complement(280282..280464)
FT                   /locus_tag="Syncc9902_0266"
FT   CDS_pept        complement(280282..280464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25239"
FT                   /db_xref="GOA:Q3B089"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B089"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25239.1"
FT                   /translation="MVASNLNACLTLGMAAFTLDLMAQLPEAYQAFSPLIDILPLIPVF
FT                   FLLLAFVWQASVGFR"
FT   gene            complement(280458..281576)
FT                   /locus_tag="Syncc9902_0267"
FT   CDS_pept        complement(280458..281576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0267"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25240"
FT                   /db_xref="GOA:Q3B088"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B088"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25240.1"
FT                   /translation="MFNFEISAHCPHTKGRCGCFHTPHGPVQTPRFMPVGTLATVKGIS
FT                   TEQLARTGAQMVLSNTYHLHLQPGEQVVAEAGGLHRFMGWDGPMLTDSGGFQVFSLGNL
FT                   NKIDERGVVFRNPRDGRTIDMTPEHATNIQMALGADVAMAFDQCPPYPATENDVKDACR
FT                   RTHAWLERCVNAHTRSDQALFGIVQGGCFPHLRRESARAVAAFDLPGIAIGGVSVGEPT
FT                   DDMHRIVRDIGPLLPLDRPRYLMGIGTLREMAVAVANGIDLFDCVLPTRLGRHGTALVG
FT                   GERWNLRNARFRNDHTPLDSSCSCLACTGHSRAYIHHLIRSDELLGLTLLSLHNITHLV
FT                   RFTNAMAQAIQDGCFSEDFAPWQEDSPAHHTW"
FT   gene            281699..282454
FT                   /locus_tag="Syncc9902_0268"
FT   CDS_pept        281699..282454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0268"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25241"
FT                   /db_xref="GOA:Q3B087"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B087"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25241.1"
FT                   /translation="MKAGIVRIVFPWLSDLAGAWIFYSVLPAWPWPRPRFERIARFAPW
FT                   IGLWIGVLQALLWWGLSGLGWSDVALAPVVMAVGIWLGGGLHQDGLMDTADGLAAGAAR
FT                   RLEAMEDSRVGASGALALAVVLLLQLAALFQLQEQAPLALLLAGFWGRVSPLWAMARFD
FT                   YLRSDGTAGFHRRYGQPLWDVVPTVVACLAFVPFVAPLPLLIGAPVAVGVAERLGRRLG
FT                   GHTGDSYGAVVVVSEAITLLLLAGLAAAN"
FT   gene            complement(282414..283538)
FT                   /locus_tag="Syncc9902_0269"
FT   CDS_pept        complement(282414..283538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0269"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25242"
FT                   /db_xref="GOA:Q3B086"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B086"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25242.1"
FT                   /translation="MQLTDRFLDFADQQLTPVVSLMGFTHLGLYLSAPPGQEGPPLILI
FT                   KQWSSTNRALPAADVDPELRQASEERRWYPLQDAGLILGALRVELEPGLSWTADLEEEM
FT                   RRCALAISHALGRDLECIQLQEELHQQRNQLKTLVHQLRNPLAALRTYAQLMMRRLEPD
FT                   SAHLSLVDGILTEQHQLGRYIDALENLGRQSLPNGPDPSTAYLLPPGAAPQRESLKELL
FT                   LPLIERASATASLQGRPWHGPSQWPAWSTHSAGDGSTAEIVANLLENAFRYSPPGRAIG
FT                   LALLPDGLCVWDDGPPISSEERELIFHRGERGTSSRDRPGTGLGLALARALAERNGGHL
FT                   TLSVEPWRIQTNLPAQGNAFQLSWPQPALPAATA"
FT   gene            283930..284298
FT                   /locus_tag="Syncc9902_0270"
FT   CDS_pept        283930..284298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25243"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B085"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25243.1"
FT                   /translation="MSKKRKRISRRRLAGQRVLAHVQTHHLETGEYKPVTAARRYIAEG
FT                   GLVPPALLNVRRNEHTTDRFFWGEKGLFSAQYAEENHFLFPSLRIIVDSVGEDTLFEGL
FT                   DLTSDDWEEMEEYEYAFV"
FT   gene            complement(284299..284868)
FT                   /locus_tag="Syncc9902_0271"
FT   CDS_pept        complement(284299..284868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0271"
FT                   /product="probable esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25244"
FT                   /db_xref="GOA:Q3B084"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B084"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25244.1"
FT                   /translation="MPQRLVLLHGWGATAADLQPLGEQLAAQHPEPLDIVCLEAPEPHP
FT                   QPGGRQWYGLFPSDWDAVPNAVQQLTTRLLGLSRDGIPLERTVLFGFSQGGAMALSCGC
FT                   SLPLAGVISCSGYPHPDWQPPLNHPPVLAMHGSEDEIVPPGALELIKGRLDSERCEALL
FT                   FKNGHTIPLEMMQPLNVTLQTMLKLP"
FT   gene            284925..286487
FT                   /locus_tag="Syncc9902_0272"
FT   CDS_pept        284925..286487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0272"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25245"
FT                   /db_xref="GOA:Q3B083"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B083"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25245.1"
FT                   /translation="MAPVALLSVSDKSGLLPLAEALHRIHGYQLLSSGGTAKVLEQAGL
FT                   PVTRVSEYTGAPEILGGRVKTLHPRVHGGILAKRGDAAHQNDLEQQNINFIDVVVVNLY
FT                   PFRETVAKADVTWDQAIENIDIGGPTMVRSAAKNHADVAVLTSPDQYDRLLEAMAQAGG
FT                   EVPAALRRQLALEAFQHTAAYDTAISRWMDQAVAADGSPWLEAVPLRQTLRYGENPHQK
FT                   ARWYSHAQQGWGGAVQLQGKELSTNNLLDLEAALAMVREFGYGSDGAEPAVQPAAVVVK
FT                   HTNPCGVAIGSDVSTALTRALDADRVSAFGGIVAINGVVSAAAAGELKSLFLECVVAPS
FT                   FSPEAREILAAKANLRLLELQPAAIDAAGPDHVRSILGGLLVQDLDDQAITPSEWTVAS
FT                   QRPPSSQEQQDLEFAWRLVRHVRSNAIVVASKGQSLGIGAGQMNRVGSARLALDAAGDQ
FT                   ATGAVLASDGFFPFDDTVRLAASHGITAVIHPGGSLRDADSIKACDELGLAMLLTGRRH
FT                   FLH"
FT   gene            286541..286999
FT                   /locus_tag="Syncc9902_0273"
FT   CDS_pept        286541..286999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25246"
FT                   /db_xref="GOA:Q3B082"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B082"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25246.1"
FT                   /translation="MLATLPFTLNFAHPLMEWSLLATGGWALYLGIKVKRTRTGTPEQR
FT                   KLLVPKKFAQRHYLWGSILLALMTLGTLGGMAVTYLNNDKLFVGPHLLVGLGMTGMLAV
FT                   AASLSPLMQRGNVIARKVHVGLNMGMLTLFLWQAFSGMEIVNKIWTSR"
FT   gene            complement(287032..287673)
FT                   /locus_tag="Syncc9902_0274"
FT   CDS_pept        complement(287032..287673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25247"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B081"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25247.1"
FT                   /translation="MLLLSRTDTANLRHENDPQVRCYRSQFSDQMEMMLASDQVEEYLD
FT                   RHQGWFERCAAPMRVHPIDAQSYDLTLGKFGNFGFEVEPTIALRLLPQHKGIYRIETIP
FT                   STPKAQDLREHYDVDFQASMHLIPMQESGDEPNPKGQVGTSVQWDLDLSVWIRLPKVIT
FT                   MLPDNLVQSSGDHLLKQIVRQISRRLTWKVQEDFHASHDLDCPPRRRAAF"
FT   gene            complement(287734..288933)
FT                   /locus_tag="Syncc9902_0275"
FT   CDS_pept        complement(287734..288933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0275"
FT                   /product="LytB protein"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25248"
FT                   /db_xref="GOA:Q3B080"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B080"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25248.1"
FT                   /translation="MDTHAFKRSLHHSERYNRRGFGRAEEVAENLEQAYQSGLIGTIRD
FT                   NGYKLTHGRLNVHLAEAFGFCWGVERAVAMAYETRRHYPSERLWITNEIIHNPSVNDHL
FT                   REMDVLFIPVEEGVKDFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKV
FT                   WNTVEKHKKHTFTSVIHGKVKHEETLATSSFAGTYLVVLDLEEAQIVVDYILGKGDREA
FT                   FMQRFAKACSEGFDPDRDLERLGVANQTTMLKSETEEIGRMFERTMLSKYGPADLNEHF
FT                   LAYNTICDATQERQDAMFSLVDEPLDLLVVIGGFNSSNTTHLQEIAVSRGIRSFHIDTP
FT                   DRIDETTNSIEHKPLSEDLKRDQVFLPAGPVTVGITSGASTPDRAVEAVIEKLMRLSEN
FT                   "
FT   gene            complement(289036..290505)
FT                   /locus_tag="Syncc9902_0276"
FT   CDS_pept        complement(289036..290505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0276"
FT                   /product="Ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25249"
FT                   /db_xref="GOA:Q3B079"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B079"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25249.1"
FT                   /translation="MTTAYQSPPLRRRKTLQEASLLNGPMLLLNSIRGFSSNRAAIWLA
FT                   CAPLALLGLGIFTLSAKAEELPELSAAFLANNLWLLVATILVIFMNAGFAMVEAGMCRQ
FT                   KNAVNILAKNLFVFALAVTAYWFVGYSFMYGDAAIDGWLYFAGFFFDPAVTAETISEAG
FT                   LVPTVDFLFQAAFAGTAATIVSGLVAERIKFGEFVIFALVLTAFIYPVAGSWEWNGGWL
FT                   NSVGNKEFIDFAGSSIVHSVGAWAGLVGAMLLGPRIGKYVGGKAQAIPGHNMSIATLGC
FT                   LILWIGWYGFNPGSQLAMDQWVPYVAVTTTLGAAGGAIGATVISTITSKKPDLTMIING
FT                   ILAGLVSVTAGCGNLTLPGSWVAGLVGGIIVVFAVSALDNAGIDDPVGAFSVHGVCGVW
FT                   GTVVIGLWGFDVQGDGSPLGLLVGGGIEQLGIQALGAGAYAIWTVVTCFVAWKIIGALF
FT                   GGIRVTEQEETEGLDIGEHGMEAYAGFSTTN"
FT   gene            complement(290601..291350)
FT                   /locus_tag="Syncc9902_0277"
FT   CDS_pept        complement(290601..291350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0277"
FT                   /product="Sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25250"
FT                   /db_xref="GOA:Q3B078"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25250.1"
FT                   /translation="MPLLEFEPLQEGVLIKRYKRFLADIELSNGEVVTAHCANTGPMTG
FT                   VLIPGQRVRLRHAPSPKRKLAWTWEQAEVPGADGQPCWAGINTALPNRLIRATIEAGCL
FT                   SEQLGAISNIRAEVAYGTNRRSRIDLLLTPGESNPDQRLIYLEVKNTTWTDGTTALFPD
FT                   TVTERGQKHLIELMGVLPEARAVLVPCLSRPDVMDFAPGDEADPRYGSLFRDALEAGVE
FT                   VLPCCFRYQSNEISWQGLRPLKKFQNL"
FT   gene            291442..293049
FT                   /locus_tag="Syncc9902_0278"
FT   CDS_pept        291442..293049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0278"
FT                   /product="Virulence factor MVIN-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25251"
FT                   /db_xref="GOA:Q3B077"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B077"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25251.1"
FT                   /translation="MARSLKGIAVVVTLGTLLSKIGGLARQLVIAAAFGVGAAYDAYNY
FT                   AYVLPGFLLILLGGINGPFHSAMVSVLSRRPREEGAHILAALNTTVSALLLVVTVLLVL
FT                   AADPLISLVGPGLNPQLHAIAVVQLQVMAPMALLAGLIGLGFGSLNAADEFWIPAISPL
FT                   MSSLALMVGVGLLWWQLGGEIGAPSSAMVGGLVLAAATLVGALAQWLIQLPALMRQGLA
FT                   RFKLVWDWTHPGVREVWRVMGPATLSSGMLQINVFTDLFFASGIVGAAAGLGYANLLVQ
FT                   TPLGLISNALLVPLLPTFARLTAPKDQPQLLARIRQGLMLSTASMVPIAALFIALGTPI
FT                   VALVYERGAFDSAAAQLVAALLMAYGLGMPAYLGRDVLVRVFYALGDGTTPFRLSLAGI
FT                   GLNVIFDWLLVGGPTPWGNQSPFNFGASGLVLATVAINVLTCLALLLVLKRRMPAMTLI
FT                   PWGLDTTRLLLAGALTGCIVWGLSLWVDWPLGWFGLLARVGIPSLLGLAFFGLIGSALG
FT                   VAEVREIGTMVLRRMRLR"
FT   gene            293159..294349
FT                   /locus_tag="Syncc9902_0279"
FT   CDS_pept        293159..294349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0279"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25252"
FT                   /db_xref="GOA:Q3B076"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B076"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25252.1"
FT                   /translation="MAQQQGGDLRHARTGIELRPGLDGVPATKSAICDIDGDQGLLTYR
FT                   GYPMEDLAVNSSFLETAYLLIWGELPTDDQLQAFEHEVQMHRRVSFRVRDMMKCFPASG
FT                   HPMDALQSSAASLGLFYSRRAIDDPGYIYKAVVRLIAKIPTMVAAFQLIRKGQDPIQPR
FT                   DDLAYSANFLYMLTEREPDPRAARIFDRCLMLHAEHSLNASTFSARVTASTLTDPYAVI
FT                   ASAVGTLAGPLHGGANEDVLAMLEEVGSPAQAGAFLDEAIAAKRKIMGFGHREYKVKDP
FT                   RAVILQSLVEEMFNDFGHDDLYDVARAIEHEAMARLGPKGIYPNVDFYSGLVYRKLGIP
FT                   RDLFTPVFAIARVAGWLAHWREQLGANRIFRPSQIYSGAQPRRWTPMEKRAVSTAD"
FT   gene            294374..295495
FT                   /locus_tag="Syncc9902_0280"
FT   CDS_pept        294374..295495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0280"
FT                   /product="NADH dehydrogenase I chain 1"
FT                   /note="NADH dehydrogenase I chain H"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25253"
FT                   /db_xref="GOA:Q3B075"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B075"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25253.1"
FT                   /translation="MVSPGLDLELSFSQAMQGFGLSPEVARLLWLPLPMLLVLVAAVVG
FT                   VLVSVWLERKISAAVQQRVGPEYAGALGVLQPLADGLKLLVKEDIIPARADSILFTLGP
FT                   ILVVVPVIVSWLIIPFGQNLLISNVGVGIFLWIAFSSVQPIGLLMSGYASNNKYSLLGG
FT                   LRAAAQSISYEIPLALAVLAIVMMSNSLSTVDIVNQQTGAGILSWNIWRQPVGFLIFWI
FT                   CALAECERLPFDLPEAEEELVAGYQTEYAGMKFALFYLAGYINLVLSAVLVSVLYLGGW
FT                   GFPIPVEWLADWLHQPIDAPVVQVITGSVGIMMTILKAYLLVFIAILLRWTTPRVRIDQ
FT                   LLDLGWKFLLPLALVNLLVTAALKLAFPVAFGG"
FT   gene            295569..296201
FT                   /locus_tag="Syncc9902_0281"
FT   CDS_pept        295569..296201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0281"
FT                   /product="NADH-plastoquinone oxidoreductase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25254"
FT                   /db_xref="GOA:Q3B074"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B074"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25254.1"
FT                   /translation="MFGFLKQVGDYTRDAVDAARNLAQGFAVTFDHMQRRPVTVQYPYE
FT                   KLIPSERYRGRIHYEFDKCIACEVCVRVCPINLPVVDWVMNKATKKKELRNYSIDFGVC
FT                   IFCGNCVEYCPTNCLSMTEEYELAAFDRHSLNYDNVALGRLPTSVTTDPSVQPLRELVY
FT                   LPAGEMDPHTVSADRPRAGKLPAEVLETLAPVKDEGQSSKAVLKEDA"
FT   gene            296198..296800
FT                   /locus_tag="Syncc9902_0282"
FT   CDS_pept        296198..296800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0282"
FT                   /product="NADH dehydrogenase I chain 6"
FT                   /note="NADH dehydrogenase I chain J"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25255"
FT                   /db_xref="GOA:Q3B073"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B073"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25255.1"
FT                   /translation="MTIATSTELICFLVLSAVVVTGALGVVLLSNIVYSAFLLGGVFMA
FT                   VAGLYLLLNASFVAAAQVMIYVGAINVLILFAIMLVNKREDLKAIANLTTRRIVSGGVC
FT                   LGLLALLVRVVVTTPWSLPGPAAVGEEATARIGEHLFTDYLLPFELASVLLLMAMIGAI
FT                   VLARRDVLANDVVTGEAADQGLIEKARTPLLLERRSS"
FT   gene            296812..297141
FT                   /locus_tag="Syncc9902_0283"
FT   CDS_pept        296812..297141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0283"
FT                   /product="NADH dehydrogenase I chain 4L"
FT                   /note="NADH dehydrogenase I chain K"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25256"
FT                   /db_xref="GOA:Q3B072"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25256.1"
FT                   /translation="MNDLLSTLPSLQAYLLVAAMLFCIGVWGLINSRNAVRVLMSIELM
FT                   LNGVNINLMAFSSYVDGDLIRGQVFAVFVITVAAAEAAVGLAILLSLYRNRVTVDMEQF
FT                   NLLRW"
FT   gene            297160..298110
FT                   /locus_tag="Syncc9902_0284"
FT   CDS_pept        297160..298110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0284"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25257"
FT                   /db_xref="GOA:Q3B071"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B071"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25257.1"
FT                   /translation="MRLDRVWVIYRADSPPAQREARHCAKQLEALGAKVVSAMSGPRAN
FT                   PFPGLLAVEGELPNLAVVLGGDGTVLGAARHLAVHDIPLLSINVGGHLGFLTHDRLVLQ
FT                   GAEVWQRLLDDQFAIERRMMLQAMVDRRCAAERAEGPALLQQPDVEDDEEHHWALNDFY
FT                   LRAYRDEISPTCTLELEIDGEVVDQVRGDGLILATPTGSTGYVMAAGGPILHPGIDAII
FT                   VTPICPMSLSSRTVVVPPRSRLVLWPLGDAGHQIKLWKDGVGCTVLQPGECCVVQQARH
FT                   HAQMVLLNQSPSYYRTLTHKLHWAGSLTASQPSPN"
FT   gene            298118..298624
FT                   /locus_tag="Syncc9902_0285"
FT   CDS_pept        298118..298624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25258"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B070"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25258.1"
FT                   /translation="MALEIERRFLVSGEAWRAHAGCAQPLRQGYLAASAEGVTVRLRIQ
FT                   DNNQAWLTLKAPAGVSGLVRHEFEYVIPVEDAEAMWKLAPHRLEKTRWLLDLPGGEWVV
FT                   DCFAGTNAPLVLAEVELPQVDQSVVIPPWCGLEITGESLWSNAVLAQHPVQSWPLQERV
FT                   RHGLA"
FT   gene            298621..298869
FT                   /locus_tag="Syncc9902_0286"
FT   CDS_pept        298621..298869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25259.1"
FT                   /translation="MTPGPIYRFPLDSGQASGALTVVGLYDATGMLRFVGSSIEACMEY
FT                   ANLFELALLPSSLQALPEPVVPSIKVRGDRHLEERSS"
FT   gene            complement(298826..299104)
FT                   /locus_tag="Syncc9902_0287"
FT   CDS_pept        complement(298826..299104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0287"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25260"
FT                   /db_xref="GOA:Q3B068"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B068"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25260.1"
FT                   /translation="MSSVDTTDPLDISLSAREIEIIQLVAEGLTNQEIADRLTISKRTV
FT                   DNHVSNVFTKTGSKNRVALLNWAMDNGKICRDGFNCCALPDADPHEP"
FT   gene            299183..300076
FT                   /locus_tag="Syncc9902_0288"
FT   CDS_pept        299183..300076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25261"
FT                   /db_xref="GOA:Q3B067"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B067"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25261.1"
FT                   /translation="MKTALQCAIEAGKQALTAEVMPPRGADPAHMLAMAAHLQGRVHAL
FT                   NVTDGSRAVMRMSSVAACKLLIEAGAEPVLQLACRDRNRIALQADLLGAHALGIRNLLC
FT                   LTGDPVRSGDQPSVRPVNELESVKLLQQVEALNRGEDPVKGSLPDGATALFPGCAADPH
FT                   SRSWSGLQRRLQRKAGAGARFVQTQMVMDPQVLDRFQRELAGPLQLPVLAGVFLLKSAK
FT                   NALFINRVVPGACIPEHLIERLEGASNPAMEGVSIAAEQVRQYLGIVQGVHLMAIKAEE
FT                   RIPLILDQANISSPTT"
FT   gene            complement(300057..301235)
FT                   /locus_tag="Syncc9902_0289"
FT   CDS_pept        complement(300057..301235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0289"
FT                   /product="putative sugar-phosphate nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25262"
FT                   /db_xref="GOA:Q3B066"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B066"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25262.1"
FT                   /translation="MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHG
FT                   FTEVMVNVSHLAEEIENYFRDGQRFGVELAYSFEGRIEDGELIGSAMGSAGGLKKIQDF
FT                   QHFFDDTFVVLCGDALIDLDLTEALKRHREKGAIASLVTKRVPKDQVSSYGVVVTDDEG
FT                   RISSFQEKPSIDEALSDTINTGIYIFEPEIFDHIPSGVSFDIGSDLFPKLAASGAPFYA
FT                   IPMDFEWVDIGKVPDYWQAIRSVLSGDVRQVGIPGKEIRPGVYTGLNVAANWDKINVTG
FT                   PVYVGGMTKIEDGATIIGPTMIGPSCHICEGATVDNSIIFDYSRIGAGVQLVEKLVFGR
FT                   YCVGKDGDHFDLQEASLDWLITDARRQDLVEPSPQQKAMAELLGTDLMSSVN"
FT   gene            complement(301278..302201)
FT                   /locus_tag="Syncc9902_0290"
FT   CDS_pept        complement(301278..302201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0290"
FT                   /product="putative segregation and condensation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25263"
FT                   /db_xref="GOA:Q3B065"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B065"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25263.1"
FT                   /translation="MTRRGSPLHQAVPNEGADAGARLAIRLLQDAAERGDLDPWDVDVI
FT                   AVVDGFLDQLRQRIEVPRQIAAALAGRGGSYERDLAESSEAFLAASVLVGLKAEVLEAS
FT                   MLPPPPEVEEYFDTDFDDQGWLDPSFDLPRRPERHLLRRPVAPPPLRRPVTLGELIEQL
FT                   ESIAGQLESDELEMRRRQRRKRFSTRDAINQVANLAHREKLPETTAALGVFLNGWEDAL
FT                   DWVDFEGLVQRWGQVAAADLDQDRVGVFWALLFLSSQGSVELEQSQWLHGPLRLKRIPA
FT                   AGIPTQLPISSLQVATPIPAPTAVAA"
FT   gene            complement(302251..302634)
FT                   /locus_tag="Syncc9902_0291"
FT   CDS_pept        complement(302251..302634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25264"
FT                   /db_xref="GOA:Q3B064"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B064"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25264.1"
FT                   /translation="MRQINFGLIFGFGLVTVFFTLENTAATTVHVLPGMQYTLPLAGLL
FT                   LFVAGIGAASAWFFATWTGMLNNVDQLSKATEFEAQQVRIQELETDLNRYRSTVETQLG
FT                   LLPATTVSTTVSTSEVDSPISST"
FT   gene            complement(302699..304345)
FT                   /locus_tag="Syncc9902_0292"
FT   CDS_pept        complement(302699..304345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0292"
FT                   /product="Proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25265"
FT                   /db_xref="GOA:Q3B063"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B063"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25265.1"
FT                   /translation="MIEFAVAGLSDPVQATVPWLSLSILVPIGGALLIPFIPDQGEGKQ
FT                   IRWYALIVTLITFLITVAAYLTGYDPSLSGLQLFERVSWLPEIGLTWTVGADGLSMPLI
FT                   LLTSFITSLACLAAWPVTFKPRLFFFLLLAMDGGQIAVFAVQDMLLFFLAWELELLPVY
FT                   LLLAIWGGKKRQYAATKFILYTAGSSLFILLAALAMGFFGGGTPSFEYTALAAKDFGSG
FT                   FQLLCYAGLLIAFGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNCE
FT                   LLPAAHAQFAPLLIVLGVVNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSVL
FT                   GSSGAMLQMISHGLIGASLFFLVGATYDRTHTLLLDEMGGIGQKMRIMFALWTVCALAS
FT                   LALPGMSGFVSELMIFAGFATDEAYTLPFRVVICGLAAVGVVLTPVYLLSMLREIFFGK
FT                   EKAELASHTNLVDAEPREVYIIGCLLVPIIGIGLYPRLMTDSFSSSIEALVSRDVTAME
FT                   QLTKPTAPLIRGQSTVPAILRAPNLGTPTPK"
FT   gene            complement(304436..306445)
FT                   /locus_tag="Syncc9902_0293"
FT   CDS_pept        complement(304436..306445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0293"
FT                   /product="NADH-plastoquinone oxidoreductase, chain 5"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25266"
FT                   /db_xref="GOA:Q3B062"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B062"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25266.1"
FT                   /translation="MPSAAELAWLIPVLPLFGAVITGLGLISFNRTVNRLRKPVALLLI
FT                   TCVGAAAVLSYAILASQLAGSPPVEHLFIWASAGDFTLPMGYVVDPLGAVMLSLVTTIA
FT                   LLVMVYSHGYMAHDKGYVRFFTYLALFSSSMLGLIISPNLLEIYVFWELVGMCSYLLVG
FT                   FWYDRDGAAHAAQKAFVVNRVGDFGLLLGILGLFWATGSFDFQGIADGLQQGLANGSVA
FT                   PWAALLLCLLVFMGPMAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLVARLD
FT                   PLYTQFPVVQTVIAVVGTITCFLGASIALTQMDLKKGLAYSTVSQLGYMMLAMGCGAPV
FT                   AGMFHLVTHAFFKAMLFLGSGSVIHAMEEVVGHEPVLAQDMRLMGGLRQKMPITAITFF
FT                   IGCIAISGIPPLAGFWSKDEILGQAFNAFPVLWLVGFLTAGMTAFYMFRLYFLTFEGEF
FT                   RGNDKAMQTSLLAAVGKENKEHGDHATSVHESAWPMTVPLAVLAVPSVLIGLLGTPWNS
FT                   RFAGLLNPEEAAEMAEHFSWAEFLPLAGASVAISLVGITLAVLAYALRRIDLGQLVAGR
FT                   FPTINAFLANKWYLDSINEKLFVRGSRKLAREVLEVDAKVVDGVVNLTGLLTLGSGEGL
FT                   KYLETGRAQFYALIVFGGVIAMVVLFGVIGGPIS"
FT   gene            complement(306480..307211)
FT                   /locus_tag="Syncc9902_0294"
FT   CDS_pept        complement(306480..307211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25267"
FT                   /db_xref="GOA:Q3B061"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B061"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25267.1"
FT                   /translation="MATTHHSSLVMLVLLVLFAVIHSGGAALRVRAEAVIGARAWRLIF
FT                   AALSIPSAVVVIGYFLAHRYDGLRLWNLQGVPGMVPMVWVGTAISFLFLYPATYNLLEI
FT                   PAVLKPQVRLYATGIIRISRHPQAVGQILWCFTHALWIGSSFMLVTCAGLIAHHLFAVW
FT                   HGDRRLKLRFGDAFDELKNSTSSVPFVAVLDGRQNLDWREFVRPAQLGIAIAVGVFWWA
FT                   HRFIPQAGELVRNSALESLFS"
FT   gene            307292..308287
FT                   /locus_tag="Syncc9902_0295"
FT   CDS_pept        307292..308287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0295"
FT                   /product="putative Rubisco transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25268"
FT                   /db_xref="GOA:Q3B060"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B060"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25268.1"
FT                   /translation="MADLPFTLDQLRILRAIVSEGSFKKAADSLYVTQPAVSLQIQNLE
FT                   KQLEVSLFDRGGRKAQLTEAGHLLLSYCDRILSQCAEACRALDDLHNLKGGSLIVGASQ
FT                   TTGTYLMPRMIGLFRQKYPEVAVQLQVHSTRRTGWSVANGQIDLAIIGGELPPELNELL
FT                   QVVPYASDELALVLPVKHPLARLTELTKEDLYRLGFVCLDAQSTTRKMVDQLLARSGLD
FT                   VQRLRIEMELNSLEAIKNAVQAGLGAAFVPVVSIDRELAAGTIHRPQVADLQVKRQLKL
FT                   ITHPARYCSRASAAFRQDVLPVFASPDSPIRQKVATPVVPLSSADQLTQN"
FT   gene            complement(308278..308898)
FT                   /locus_tag="Syncc9902_0296"
FT   CDS_pept        complement(308278..308898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25269"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25269.1"
FT                   /translation="MNRSRYDSYDRPQSGGRYERGYDDRRNSGRGNRPPGPPPEGGGPD
FT                   FNFSSRTVAVLAGVLVVGIGIGSAVTSTTQGDQGNIASSQQLDMAVPDPEFCRQWGASA
FT                   FVMDIEMYTTLNPSSSFVTQPTLQPGCVIRRENWSVLRKEGAITGDQERECKQRMNTFA
FT                   YIGSVRDKPVVRCVYQTDISENRFLTKGIADDTVGITPEADQF"
FT   gene            complement(308895..309242)
FT                   /locus_tag="Syncc9902_0297"
FT   CDS_pept        complement(308895..309242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0297"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25270"
FT                   /db_xref="GOA:Q3B058"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B058"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25270.1"
FT                   /translation="MADTLLKCTTRHVRLFTARVDNDDLVPSANELTLDLDPDNEFIWS
FT                   ESCISQVQQRFKQLVDAAAGGELSDYTLRRIGTDLEGFIRQLLQRGELSYNPEARVQNF
FT                   SMGLPRTPELL"
FT   gene            309327..310745
FT                   /locus_tag="Syncc9902_0298"
FT   CDS_pept        309327..310745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0298"
FT                   /product="zeta-carotene desaturase / three-step phytoene
FT                   desaturase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25271"
FT                   /db_xref="GOA:Q3B057"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25271.1"
FT                   /translation="MRVAIAGAGLAGLSCAKYLADAGHTPILVESRDVLGGKVAAWKDE
FT                   DGDWYETGLHIFFGAYPNMLQLFKELDIEDRLQWKSHSMIFNQPEEPGTYSRFDFPDLP
FT                   APVNGVAAILGNNDMLTWPEKISFGLGLVPAMLRGQGYVEQCDQYSWTEWLRLHNIPER
FT                   VNDEVFIAMSKALNFIDPGEISATVLLTALNRFLQEKNGSRMAFLDGAPPERLCQPVVE
FT                   HIESLGGEVHLDCPLREIKLNDDGSVAAFQIGGVKGKEGFDLVADAYVSALPVDPFKLL
FT                   LPEPWKQMDVFQKLEGLRGVPVINIHMWFDRKLTDIDHLLFSRSPLLSVYADMSIACKE
FT                   YEDPDRSMLELVFAPAKDWISRSDEDIIEATMGELLKLFPMHFGGDNPAKLRKSKVVKT
FT                   PLSVYKTTPGCQQLRPDQTTPIKNFFLAGDYTMQRYLASMEGAVLSGKLCAGAVDAKTD
FT                   QLSKSSSVGEPVTA"
FT   gene            310750..311664
FT                   /locus_tag="Syncc9902_0299"
FT   CDS_pept        310750..311664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0299"
FT                   /product="phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25272"
FT                   /db_xref="GOA:Q3B056"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B056"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25272.1"
FT                   /translation="MPIASMATDLDEAFEACRRETAEWAKTFYLGTLLLPLEKRRAIWA
FT                   IYVWCRRTDELMDSAEAQSRSVEELAERLDHWEQQTRDLFNGHVSNDLDAVMAHTLERF
FT                   PQDIQPYLDMIEGQRMDLTWTRYPTFEDLKLYCYRVAGTVGLMTQGVMGVDQAYTSAPW
FT                   SDSPDTSDAAVALGIANQLTNILRDVGEDRGRGRIYLPQEDLDRFGYSESDLMAGRLNE
FT                   AWRELMAFQLERAREWFTRSESGVRWLSGDARWPVWTSLRLYRGILDAIERIDYDVFNR
FT                   RAYVGKVNKLLDLPRSYALAQFR"
FT   gene            complement(311740..312177)
FT                   /locus_tag="Syncc9902_0300"
FT   CDS_pept        complement(311740..312177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0300"
FT                   /product="RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25273"
FT                   /db_xref="GOA:Q3B055"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B055"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25273.1"
FT                   /translation="MSIRLYIGNLPQTFEEQELAALLKGIGEGIRFKSVLDRDTGSCRG
FT                   FGFANVDDPKVADAVIEQLNGKEFGGSTLRVERSERRESGGNNRRGGAPAPMGAGQPQV
FT                   ARKTVNKVVHSDAPGEGAPDPRWAGELSKLKDLLGNQKTAV"
FT   gene            complement(312233..313429)
FT                   /locus_tag="Syncc9902_0301"
FT   CDS_pept        complement(312233..313429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0301"
FT                   /product="poly A polymerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25274"
FT                   /db_xref="GOA:Q3B054"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B054"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25274.1"
FT                   /translation="MADAAPDEQARLLLKQLDPDAWPISIDQLPEGTALVGGAVRDALL
FT                   GRHNPHPDLDLVVRSDALRHSARLAKIFGGKHVVLDEQRDIARLVLNGWTIDVARQEGD
FT                   GLEDDLWRRDYSINAIALPLQPMASLCDPTGGLGDLKQGRLRAVREQNLIDDPLRLLRG
FT                   LRFLAEIPLVLDAQTGEWIQRHHQALGQSAPERILAELQRLVKGPHADQALHLLEQWPL
FT                   LQPWATTSQTVASYDTTLLNAEEATNALPLARLTKLISDDGLKRLKASKILQQRCARLR
FT                   HWGLQAKQQPEALPEQERLQLHLELEGDLAALILDLPKELQPQWLKRWRDPSDPLFHPT
FT                   MPLDGGSLQKELGLSAGPTMGKVLAQLRLERAFGRIQTRDEALKTAHRLCAEIEAVCD"
FT   gene            313709..314332
FT                   /locus_tag="Syncc9902_0302"
FT   CDS_pept        313709..314332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25275"
FT                   /db_xref="GOA:Q3B053"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B053"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25275.1"
FT                   /translation="MSGNSLLMALHSSTERFGVAVHDPMSSSEPSAVQVFDDGRGLSNT
FT                   LITRVSAMLPRERWTQLSGLAVATGPGGFTGTRLSVVMARTLAEQLRCPLLGISSFALM
FT                   APRLHNQLPVDQRGQPFWIARELPRRGLVAGCYCLDANDVNELEEPHLVAKGRSLGPIV
FT                   EAAEDVHADVLRLLELLRCAHLAGKAMPWSEVLPIYPTSPVGQV"
FT   gene            314332..314907
FT                   /locus_tag="Syncc9902_0303"
FT   CDS_pept        314332..314907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25276"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B052"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25276.1"
FT                   /translation="MAGLKTGMVLGVALTVWLLGPGPMAPYRRALLNRSAPQMVLVLGG
FT                   DVDRERMGARLARQLDLPLLVSGGSNREYATWLLQEERLNPERVTLDYRARDTLSNFTS
FT                   LVDELQSDGIQHVLLVTSEDHLARSMAVGQVVAGSRGIHLTGVPVACSPDCDEEGRIKQ
FT                   ISDWLRAMAWVITGRDLRDAANLGPEAR"
FT   gene            complement(314870..315529)
FT                   /locus_tag="Syncc9902_0304"
FT   CDS_pept        complement(314870..315529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0304"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25277"
FT                   /db_xref="GOA:Q3B051"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B051"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25277.1"
FT                   /translation="MSNSVQIISTAPSPSLTYRLVSGLLVFPIFRGLFRGSTQGNENVP
FT                   KQGALVVAANHGSHLDPPILGHALGRPVAFMAKAELFDVPLLGRLIRALGAYPVRRGAS
FT                   DREAIRTATATLEAGWATGVFLDGTRQANGRVNAPLPGAALLAARSGAPLLPVAILNSH
FT                   RALGSRQFWPRLVPIQLLIGTPIPPPVSRRRADLDATTALLQERINALLDQGLQHP"
FT   gene            complement(315526..316422)
FT                   /locus_tag="Syncc9902_0305"
FT   CDS_pept        complement(315526..316422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0305"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25278"
FT                   /db_xref="GOA:Q3B050"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B050"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25278.1"
FT                   /translation="MAIAWVFPGQGSQKVGMADPLLSMSGANERFSQASELLGRDLLAI
FT                   CQGESGRGEGPDDLNDTRNTQPALFVIESLLVDNLIQQGRDASLVAGHSLGELVALYAA
FT                   GAFNLETGLQLMKVRSELMAGAGGGAMTAVIGFDRSQLEELVRATDGVSIANDNSDAQV
FT                   VISGRPDAVAAVSDQLTCKRAIPLAVSGAFHSPFMAEAAHQFSVTLDAMAFHDTRIPVL
FT                   SNCDPSASNTGVDLKERLKQQMTTGVRWRETMVAMTEQGVDSLVEIGPGNVLSGLAKRS
FT                   MAGVTTAQISSSGDLGQ"
FT   gene            complement(316451..317500)
FT                   /locus_tag="Syncc9902_0306"
FT   CDS_pept        complement(316451..317500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0306"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="FabH"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25279"
FT                   /db_xref="GOA:Q3B049"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25279.1"
FT                   /translation="MTDANLDPIALVEPLHNTSGVLLRGCGSATPTRSISNDELGKRVD
FT                   TNDAWIRSRTGIAARRVVGAEESLGELSGLAAERALEMAGWKADSLDLIVLATSTPDDL
FT                   FGSAPRLQARIGAINAVAFDLTAACSGFLFGLVTAAQYIRSGAMRRILVVGADQLSRWV
FT                   DWDDRRSCVLFGDAAGALVIEASNDGKDDLEGFLLRSDGSRGAVLQLPQVTERRELIGD
FT                   ASHQRGGFEPIQMNGQEVYKFAVREVPAILASLLNSTGTSPESIDWLLLHQANQRILDA
FT                   VAERFKIPNEQVLSNLAFYGNTSAATIPLMLDEAVRDGRIQPGHRIASSGFGAGLSWGA
FT                   ALLRWSGPA"
FT   gene            complement(317497..318804)
FT                   /locus_tag="Syncc9902_0307"
FT   CDS_pept        complement(317497..318804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0307"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25280"
FT                   /db_xref="GOA:Q3B048"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B048"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25280.1"
FT                   /translation="MLPKDPDPSQAPEPRSKSTRPRAIRRLVIWYRRNSAVTTIVDSAA
FT                   SSASAAGTVAGTVVSGAGTVASSVLQPLVFDPLRRLQGGNDEDEIKDEDRLWVAVDGMG
FT                   GDDAPGPILEGCLQAIERLPLKIRFVGEQDRVRAAAADLELEAILEKAQASGHLELVPS
FT                   GPSIGMDDEATAVRRKRDASINVAMDLVKQGRATAVYSAGNSGAVMASAIFRLGRLKGI
FT                   DRPAIGALFPTKDPGQPVLVLDVGANMDCKPTYLHQFALLGNIYSRDVLQVEQPRVGLL
FT                   NIGEEECKGNELSLKTFELLKEESRLHFAGNCEGRDVLSGEFDVVVCDGFTGNVLLKFL
FT                   ESVGSVLLGVLRSELPRGRRGKVGSAFLISNLKRIKKRLDHAEHGGALLLGVNGIAVIG
FT                   HGSSKALSVVSALRIAHSAASHGVMDDLAALQSGCD"
FT   gene            complement(318785..319531)
FT                   /locus_tag="Syncc9902_0308"
FT   CDS_pept        complement(318785..319531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0308"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25281"
FT                   /db_xref="GOA:Q3B047"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B047"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25281.1"
FT                   /translation="MTATAPSKETILVVDDEASIRRILETRLSMIGYNVVTACDGTEAL
FT                   ELFPNCMPDLVVLDVMMPKLDGYGVCQELRKESDVPIVMLTALGDVADRITGLELGADD
FT                   YVVKPFSPKELEARIRCVLRRVEKEAIAGIPNSGVIQVSDLRIDTNKRQVFRNDERIRL
FT                   TGMEFSLLELLVSRSGEPFNRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPAN
FT                   PELILTARGTGYLFQRIIDSVASEGP"
FT   gene            319621..321018
FT                   /locus_tag="Syncc9902_0309"
FT   CDS_pept        319621..321018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0309"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25282"
FT                   /db_xref="GOA:Q3B046"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B046"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25282.1"
FT                   /translation="MPKPTAIFVCQACGAKARQFFGRCPECGSWNSLVEQSQPSTDGRR
FT                   RRAAPDQKDAPSPRRSTAMASLDDQPLQRLPTGSSEFDRVLGSGLVPGSLVLVGGDPGI
FT                   GKSTLLLQSASAMAAHSSVLYVSAEESAQQVKLRWQRLAGETSDLQLLAETDLDLVLEE
FT                   LEALRPAVAIIDSIQALHDPNLTSAPGSVGQVRECAASLQRLAKRQNTALLLVGHVTKE
FT                   GMLAGPKVLEHLVDAVLTFEGDRFASHRLLRAVKNRFGATHELGLFEMQAGGLAEVGNP
FT                   SELFLSDARASGVATIVACEGTRSLVVDLQALVNVTSYASPRRTATGIGTNRLHQILAV
FT                   LEKHMGIPLSRFDCYLAVAGGLDVEEPAADLGVAAAVVASFRDLTLPPGTVLIGELGLG
FT                   GQLRPVGQLELRLQEAARLGFRRAVVPSGSGLGALASGLDLALLEAANVTEALVLALGD
FT                   EVRTEPN"
FT   gene            complement(321023..321586)
FT                   /locus_tag="Syncc9902_0310"
FT   CDS_pept        complement(321023..321586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0310"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25283"
FT                   /db_xref="GOA:Q3B045"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B045"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25283.1"
FT                   /translation="MTGPSGWSDINRRAVPRSNRNDNFIDKSFTVMADLIVKLLPINAR
FT                   SKEAYVYYRDGLSAQNDGDYAEALENYDEALKLETDPTDRGETLKNMAIIYMSNGEEER
FT                   AIETYQKALDENPKQPSCLKNMGLIFEKWGRIAEESGQQDDADRWFDQAADVWTQAVRL
FT                   NPGGYLDIENWLKSTGRSNVDVYF"
FT   gene            321632..323935
FT                   /locus_tag="Syncc9902_0311"
FT   CDS_pept        321632..323935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0311"
FT                   /product="Copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25284"
FT                   /db_xref="GOA:Q3B044"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25284.1"
FT                   /translation="MQTVVLDVEGMKCGGCVSAVERTLLEQPGVQRADVNLVSRAAWLD
FT                   LAESDGNVDEVLAALAARGFPARERSLEFQPGLKGATGSTGLSWWRQWRQLMVALVLLL
FT                   LSVMGHLSEAGQLSVPVIGSLPFHAGLATVALFGPGRQILSGGIKAARVGAPSMDTLVG
FT                   LGVGSAYLASLAALVWPTVGWPCFFNEPVMLLGFVLLGRFLEERARFRTGQALQQLAQL
FT                   QPETARLVLTDGEIREVRVGALRPGERVQLLAGDRIPVDGVVREGLSAVDVSSLTGEPM
FT                   PLQVEPGTELSSGSLNLEAPLVLEVSRVGSDTALARIIRLVEQAQARRAPIQGLADRVA
FT                   GRFCYGVMALALATFLFWWLFGASHWPEVLQANAPGLPHAHGMVHGAQTHHSGLGSGAT
FT                   TPIGLALQLTIAVLVVACPCALGLATPTVITVSTGLAARRGWLFRGGDVIETAAALDQV
FT                   VFDKTGTLTLGRPLVTDVFGEDPNLLLQWAASLEQSSRHPLAYALLQEAQRRDLALIDV
FT                   TRVSTVSGEGLWGELDGVVGDLRVGKPAWLQSFGVDFSAGATAWLAAAQGSVVAVSAGQ
FT                   VLVGLLQVEDKQRPDVAPSLERLRASGLKLAIFSGDREVAVRRLGERLGFAEADLGWQM
FT                   LPQQKLERLEQLRQEGRVAMVGDGINDAPALAAADLGIAIGTGTQIAQDTADMVLLGDR
FT                   LDNLPEALSLARRTLNKVRQNLFWAFGYNLIALPVAAGVLLPSQGVLLSPPFAALLMAL
FT                   SSITVVVNALALRI"
FT   gene            323932..324561
FT                   /locus_tag="Syncc9902_0312"
FT   CDS_pept        323932..324561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0312"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25285"
FT                   /db_xref="GOA:Q3B043"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B043"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25285.1"
FT                   /translation="MTGRFIVLDGIDGCGKSTQIRHLAQWLPASGLMPSTAQLICTREP
FT                   GGTPLGQSIRELLLHTEADQVPSVTAELLLYAADRAQHVDTVIRPALLRGDWVLSDRFA
FT                   GSTLAYQGYGRGLDRQLITRLESIATTGLEPDLTAWLMVPVEVSLQRRHGEKEDRIEAE
FT                   GRAFLRRVADGFAVLAEQRNWSQIDAQQSVSKLSQVLEQTLRETLQ"
FT   gene            324558..325514
FT                   /locus_tag="Syncc9902_0313"
FT   CDS_pept        324558..325514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0313"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25286"
FT                   /db_xref="GOA:Q3B042"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B042"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25286.1"
FT                   /translation="MSELFDGLVGQPLAVHLLEAALQQNRLAPAYLFAGPDGVGRRFAA
FT                   LRFLEGVLSGGVGCDRARRRLEERNHPDLIWVEPTFQHQGRLLTRDEAVDAGMSRRTPP
FT                   QLRLEQIRGVSRALARQPVESTRGMVVIESAEAMAEAAANALLKTLEEPGHGLLILLTA
FT                   APERLLSTIRSRCQLIRFVRLDVPSVSQVLHRLDAVEHDPPELLAMAAGSPGALLEHRS
FT                   RWAALPTELMPRLRHLPNEPMHALALARDVCEALDGEQQLWLIDWWQQALWATSGDVHS
FT                   LKRLETLRRQLLSFVQPRLAWEVALLDLTADSTAAPA"
FT   gene            complement(325529..326308)
FT                   /locus_tag="Syncc9902_0314"
FT   CDS_pept        complement(325529..326308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0314"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25287"
FT                   /db_xref="GOA:Q3B041"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25287.1"
FT                   /translation="MKPCILLIEDDQDMRDLVSGHLEHSGFDVQRADDGIKGQALALQY
FT                   TPDLILLDLMLPKVDGLTLCQRLRRDERTAGIPILMLTALGGTKDKVSGFNSGADDYLT
FT                   KPFDLEELQVRIKALLRRSDRAPLGASNQNEILSYGPLTLVPERFEAIWFDSPVRLTHL
FT                   EFELLHCLLQRHGQTVAPSLILKEVWGYEPDDDIETIRVHVRHLRTKLEPDPRKPRFIK
FT                   TVYGAGYCLELPTGGQLDDVVSLAREERKQQGDRATA"
FT   gene            complement(326685..327374)
FT                   /locus_tag="Syncc9902_0315"
FT   CDS_pept        complement(326685..327374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0315"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25288"
FT                   /db_xref="GOA:Q3B040"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25288.1"
FT                   /translation="MSPDQGHAELHVDSVSHRWQNGDRVLNRCNLTIQRPGLWMLVGSN
FT                   GSGKSTLFRLIAGLLEPQAGSIECKQRAALVFQNPDHQLLLPSCGSDLLLGIRSNQSMD
FT                   QRRQRVEACLNQLGLHGLATRPIHTLSGGQKQRLAIAGALASNAGLLLLDEPTALLDPQ
FT                   SQRAVLSAVHTLCHHPTRPITALWITHRLEELNEADGAAQMHHGRIGPWNTGKELRQRL
FT                   QSGRSDR"
FT   gene            complement(327364..327627)
FT                   /locus_tag="Syncc9902_1952a"
FT   CDS_pept        complement(327364..327627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_1952a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_1952a"
FT                   /db_xref="EnsemblGenomes-Tr:ABB26910"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B039"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB26910.1"
FT                   /translation="MYVIELTLRMSPIPVSVQRKEPSDAEALYQEIRQAIDHGQPRLLD
FT                   LTCEKVEGKKAALLISEVLAVQLYEKASAAGGSKRPGFSLES"
FT   gene            327793..328848
FT                   /locus_tag="Syncc9902_0317"
FT   CDS_pept        327793..328848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0317"
FT                   /product="Photosystem II reaction centre protein PsbD/D2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25289"
FT                   /db_xref="GOA:Q3B038"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005868"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B038"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25289.1"
FT                   /translation="MTIAVGRAPQRGWFDVLDDWLKRDRFVFIGWSGLLLLPTAYMAIG
FT                   GWLTGTTFVTSWYTHGIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWC
FT                   QLGGLWAFVALHGAFALIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQ
FT                   SSWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLF
FT                   EDGEQANTFKAFEPTQEEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTS
FT                   SIGIIGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVF
FT                   PEEVLPRGNAL"
FT   gene            complement(328936..329610)
FT                   /locus_tag="Syncc9902_0318"
FT   CDS_pept        complement(328936..329610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25290"
FT                   /db_xref="GOA:Q3B037"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B037"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25290.1"
FT                   /translation="MTTHKLRAILLYISGTLFAAHLVGEIGIYAFDADKNWLLPFNMDR
FT                   EFNIPTLFSSTIMLACAYILNEIKKVSEKLPSKDWRLLSKIFIFLAIDEFFQIHEIFII
FT                   PDLRPYLSPALGSTWVMPYTALVIYLGWRFSKFLRSLEKYTRQKFLQSAGIFLSGAIGM
FT                   EMVGSYLVRAGIIRLHSIWYGSITGLEELLELLGLIIFLTALANHLIEKNGAIYLRATI
FT                   TE"
FT   gene            329680..330684
FT                   /locus_tag="Syncc9902_0319"
FT   CDS_pept        329680..330684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25291"
FT                   /db_xref="GOA:Q3B036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B036"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25291.1"
FT                   /translation="MGEVGEVHALQSPNAAMSRLALVEERKHFLAQAFGVFIALLGLAM
FT                   LGVLVGNVLGNGTAGVRSVSWAQILQGCIGALFVVLVFRGDVARAVMALANDSSRRLNI
FT                   FLIPLIVWPFFLLYRVQITDLKSYLRRISEGSLVEWLGFLFLLAAACLLWKAAAQASST
FT                   GLKLLIRSGSVGLFVLSMEEMSWGQMIFNWGTPATLNEHNVQHETNIHNLSFWHSHTWT
FT                   VAACVFTLLFFLSVCGFLVRRSDSIRLGSWIDVVLPLGCTASYFGVAALMYWGVVAEKN
FT                   GIDLIYLHTREQEIAEFLFAVGVFIHVVYLYLSLPELSCAGSNSSSDQTHQVV"
FT   gene            complement(330720..332117)
FT                   /locus_tag="Syncc9902_0320"
FT   CDS_pept        complement(330720..332117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0320"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25292"
FT                   /db_xref="GOA:Q3B035"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B035"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25292.1"
FT                   /translation="MAVRLTPHRSTPTALWWCSAVLGLLGWGCSALRHHLLQSNAYDLG
FT                   LFDQWAWLIGRGLEPVSSMEHVHVLADHGAWLLYGAGAAYGLLPGVHWLFASQAIALSF
FT                   TAIPIWWLGQQAGLSPKHCWLACALWWLQPVVFNTILFDFHPETWVMPAFALALWAERA
FT                   EKPRLWFALLLLMLGARDGLILVIAGMALDLGWRQRWRWCAAAGGLSTGWLFILSQRLY
FT                   PLLRGGSGPKAAERMFGHLGDGFLSLLSSLEWGEIAFYLLILSLPLGWLWRRSSRSTLL
FT                   IGSPLLLVNLLSASASYRTLVHHYSLPLALIAVVAAIRGGLQSPSRRGIPTWGLIWATA
FT                   CWLALAKPWFFTGPYLERQSDLEDVRDAIALIKPNDSVLTTSYLVPQLSQRSTIAFPKR
FT                   SSRGPLAETSWSVLLLNPKDPGWGSSARVQRSLLDQAQANGWSCQHWPSSLSICQKVET
FT                   EPNISKR"
FT   gene            complement(332102..333691)
FT                   /locus_tag="Syncc9902_0321"
FT   CDS_pept        complement(332102..333691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25293"
FT                   /db_xref="GOA:Q3B034"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B034"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25293.1"
FT                   /translation="MHSVVSRTRRSEDATTSLRSGLLNTNGSVQEMKRPLQGRRWVTPI
FT                   LLWIITLCLWLPGLGNLPLRDWDEGRVATVARSTTGLLPMKWERSYLNKPPGLHWPMGQ
FT                   LIRSKGEQESVVRLLPALTSSLAIPLIVLLRRNLGGQGHDQSALLAGVVLMTLLPMARH
FT                   GRLAMLDGTLVSCSLLLWWGWLGCKASSGRALAAGLACSGVLLLKPPALLGFGVIALLA
FT                   GGCRLHPTGRRWWALIVGLLPGAGWHLWHWFARGEEAFLMWGGQGFARLTTTVGDGFGW
FT                   WTPWAELLEGGWPWLLLLPAGISWAWTHRKEKAGRWQLVLLIGSAVMVLPLRTQLPWYS
FT                   HLLWPPIALMCAEGLHKLLDEGRPRWVSQTWQVMGGILVIIGCVVIVNQSSTIPGLSLV
FT                   LAGLGIAAGGRTLQAKAKRRRLQGLGLLVIGWGLALLALWNSQLWLWELNESWDPRPVA
FT                   AAIKTLPSEAKVFLKGPTRPSLGWYANKELGRFRQNDRPDEEHWVVSNRPIPGCRRHDQ
FT                   IVEGGWQLWQCD"
FT   gene            complement(333882..335528)
FT                   /locus_tag="Syncc9902_0322"
FT   CDS_pept        complement(333882..335528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25294"
FT                   /db_xref="GOA:Q3B033"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25294.1"
FT                   /translation="MHQRPFISRRILLVAGVFSLSLLALQGWRSWVLLASYDQGIFQQV
FT                   LWNSLHGHWFESTLSSQLSTNVIHDGALPSIGYARLGQHFTPTLLIWAPLVGLIGGAAL
FT                   PLVQVGLITAAGLVLHRLANQLVPERTADWIAYGYFAGNALIGPTLGNFTDLCQLPLAV
FT                   FSLLLGLQEKRRWLVVLSALLMPLIREDTGVLLVAIGAWLLVREQQRWPLALALIAWGG
FT                   GWVMACTNLLMPMFSDDNAKRFMVENFGQYLGADHAKGSSSLGTLRQVLSQPSLLLQQL
FT                   VDPPGQTLLYLLGQGLPFLFIPLISLDTALLAGPSLLGLFLAQGANDPLSITIRYTLLV
FT                   VPGFALGALFWWARRPNPNLGSKVRLAWGCALTLSLLLTVSSNPHRSLSALIPDSIDPW
FT                   VHSGWSDQWAHGKAAREALQVIPATASVAANTPLIPLIARRSVVVRFPFSTDFQDREGT
FT                   VKAVDWIAIDLDFLNRYGVAFRGDWKQLRNSKRWIENNRDTHNVQALNDGVVVMKRTTN
FT                   PEADHNLKLENALDDLLAAPLPNDPKRRSKP"
FT   gene            335934..337475
FT                   /locus_tag="Syncc9902_0323"
FT   CDS_pept        335934..337475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0323"
FT                   /product="possible porin"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25295"
FT                   /db_xref="GOA:Q3B032"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25295.1"
FT                   /translation="MKLFQQMLVAPAALGLLASGANAAELNINGVSDYAASADQVTSVT
FT                   QFSDVYPTDWAYQALSNLVEQYGCVAGYPNGTFRGNRAMTRYEAAALLNACLDRVTEVT
FT                   DELRRLLKEFETELAILRGRVDGLEARVGELEATQFSTTTKLKGSTHWVLGAAKYHGEG
FT                   SKAEATANGGTSFSYDLRLALETSFTGKDSLVTRLRSGNMNNIYGGNGVGLFGQEYGVN
FT                   TDNAVVIDRLFYSFPLGDEFTIVGGPRVRMDNMLPVWPSAYPSDMTMDFFTYAGAPGAY
FT                   NLALGGGAGIYWQTEGGFSVSTSYLSTDAELSDPNAGGLLTDAAGTSATTQIAYAPENW
FT                   GIAGAFTYASGGEGGGALYGGNGTPGAVALSGSGNTYSYGLSAWWMPEDSGLIPSISAG
FT                   WGLTDIPDPSISGVKEATTQSWYVGLEWSDVFVEGNSLGMAVGQPTFISDVDTKKGVDD
FT                   FVAGSGYAWEFFYKFQVTDNITVTPAIHYLSKPYASQDSDGLNAMSGLIKTTFKF"
FT   gene            337693..339225
FT                   /locus_tag="Syncc9902_0324"
FT   CDS_pept        337693..339225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0324"
FT                   /product="possible porin"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25296"
FT                   /db_xref="GOA:Q3B031"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25296.1"
FT                   /translation="MKLFQQMLVAPAALGLLASGANAAELNINGVSDYAASADQVTSVT
FT                   QFSDVYPTDWAYQALSNLVEQYGCVAGYPNGTFRGNRAMTRYEAAALLNACLDRVTEVT
FT                   DELRRLLKEFETELAILRGRVDGLEARVGELEATQFSTTTKLKGVTNWVLGAAKYHGNG
FT                   SDAAATTAGGTSFSYNLQLNLETSFTGKDLLYTRLRAGNMDNVYGGNGLFAQEYGFDSD
FT                   NAIVVDRLYYSFPVGDEFTVVAGPRVRMDDMLPVWPSAYPSDMTYDFFTYAGAPGAYNL
FT                   ALGAGAGVYWQTEGGFSVSTSYLSVNGNNSCPNNDFCGDSAGGIGTDAAAFSATTQIAY
FT                   APESWGVAAAYTKASGVNGVGLYQGNATIPAAALSYLDDQSNSFGLSAWWTPEESGWIP
FT                   SISVGYGGSWLSFGGDDAYTNSWYVGMEWDDALIEGNSFGIATGQPTYIVSVDDDDYNA
FT                   GAGYAWEFFYKFQVTDNITVTPAIHYLSKPFAEQDSNGLNAMSGLVKTTFKF"
FT   gene            339327..340295
FT                   /locus_tag="Syncc9902_0325"
FT   CDS_pept        339327..340295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0325"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25297"
FT                   /db_xref="GOA:Q3B030"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B030"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25297.1"
FT                   /translation="MAIAADITALIGGTPLVRLNRLPQACGSQAEVLAKLESFNPSASV
FT                   KDRIASAMVLEAEQAGTIAPGRTVLVEPTSGNTGIALAMVAAARGYRLILTMPESMSTE
FT                   RRAMLRAYGAELQLTDGSEGMKGAIALAKELVAEIPEAYLLQQFDNSANPAVHERTTAE
FT                   EIWTDCDGVLDVLVAGVGTGGTITGCARVLKQRNPQLQVVAVEPEASPVLSGGSPGAHR
FT                   IQGIGAGFIPEVLDLDLIDLIVAVSDDDAMEMGRRLAREEGLLCGISSGAAIAAALRLA
FT                   QQPGMANKRMVVMLASYGERYLSTPMFSRGSVLPARRDGQV"
FT   gene            340306..340974
FT                   /locus_tag="Syncc9902_0326"
FT   CDS_pept        340306..340974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0326"
FT                   /product="Heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25298"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25298.1"
FT                   /translation="MNDPYTVLEVSSHASAAEIKAAYRRLVKQHHPDAGGDDQRMLALN
FT                   AAWEVLGDQDRRRKFDRTRISPPAASRQPDLRRARSAHGRAVAADDALVEWLRRVYAPI
FT                   DRMLGEVINPFPAQFKALSADPYDDELMEVFCNYLEASSRKMERVKTLFQSLPTPASAR
FT                   GFGLSVYHCLSEVEDALAELERYTMGYVDNYLHDGREMLREAKQRRKRLQDERRRLDIL
FT                   "
FT   gene            340971..343016
FT                   /locus_tag="Syncc9902_0327"
FT   CDS_pept        340971..343016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25299"
FT                   /db_xref="GOA:Q3B028"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25299.1"
FT                   /translation="MSQRCRFWGGVALIWLLATLADRLWWTLQGGVPAWDQADYLNSAL
FT                   DHGRALGLLPGGVWQGWNALLDLSPKIPPLASLVNGSVMAVSGGAPDQAAWSLSLWHGL
FT                   LLMAVAGWGRRLYGPGFAWLACGLTAMVPALLELRTDYVLEMPLAAVCTLALWRLDVWC
FT                   DPSDGGRWNQVWGCTLAAVAALLVKQSAFLVLTPAGLGALYFVFRRRGHWLRQAMLLPL
FT                   MVAALLGPWLRHNWITSLGGTNRAVFESAAREGDPGVFSWASWLWYPRLLPEQLGVVLL
FT                   AVGVSGLMLWWLHRHDPTTDRTWSWRWLVINLLAAWILTTLSPNKGDRYIAPLLPMLVL
FT                   LLARGWWQWGLWWQHKGLRWIRPLLAAGLLASSPAGVSTQLERLGDRPRGPLQALVDAA
FT                   GGADAAVPSRTLIVVPSTPDLNQHNVSYYGRRNGGHVVGRQLGGNDADRDPVLERADWV
FT                   VLAEGDQGSVRKSARRLDRAVRRSGVFEQVKQFQRPQGGSYSLWRRRGNQPVQGPSFAE
FT                   RFPSLALGLAQGPGGLDPVFSAVALEHMLDGHFSYRQPVSLEATRRLQINPNDQQARWS
FT                   LALLAVLANRPKEASEQFAQLQTLIPDNPWPAAYRSVVNLAGWNPWAAMSVADSAGQQH
FT                   QEPVLRALGDLSGVLSGAVWRFPAALISVPAAVTSVEGGLESSDQE"
FT   gene            complement(343007..343261)
FT                   /locus_tag="Syncc9902_0328"
FT   CDS_pept        complement(343007..343261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25300"
FT                   /db_xref="GOA:Q3B027"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B027"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25300.1"
FT                   /translation="MADSDTSAPAKAKPAALRKGALVKVNRKAYSASIEAAASDPTPPD
FT                   YIFDGPGELLVVKGDYGQVRWNRPVPDVWLRMDQLEVYS"
FT   gene            343345..344550
FT                   /locus_tag="Syncc9902_0329"
FT   CDS_pept        343345..344550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0329"
FT                   /product="putative Na+/H+ antiporter, CPA1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25301"
FT                   /db_xref="GOA:Q3B026"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25301.1"
FT                   /translation="MAFGGLLLAAVLLDDLADRVKLPGILLVLALGLLVDNDLRSTSEP
FT                   LLSLVRADRITQSALVLVLFFGGLTTNWTRMKSVIRPAARLASLGVLLTAGLLTLIGVG
FT                   ALMAQGTWQVGLLAQVLFVGAMLSSTDASAALSLLRPLAGRLPQRVLDLIEMESTINDP
FT                   MAVVLANVALALAGGTGLATADLVTDVIRQFLLGGLLGFIGGSMISQLLMGSQSLTRGS
FT                   MLPVVSLALLLVLSGGTTLMGGSPLLAAYVAGLVLGNSRAAAQEVLEEAHSSFAKMAEL
FT                   MLFLCLGLVVAPQNVVEAAGWALLLVLAMQLVRWLMVQLLLLRADFQSSEKRFVSWTGL
FT                   RGAVPIAMAIQAWASPVAWGKLMPPLALAVVLFGLLLQGFALVPIAHRLGLVLPSEESE
FT                   PT"
FT   gene            344578..345507
FT                   /locus_tag="Syncc9902_0330"
FT   CDS_pept        344578..345507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25302"
FT                   /db_xref="GOA:Q3B025"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B025"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25302.1"
FT                   /translation="MRLLLLGCTGFVGRELVPALLEADHQLTLVSRRLAWGYEAERADG
FT                   RVKWLQLDPAKSVSWQTPELVEALSTSDAVVNLAGEPIAEKRWTAVHRKVLEDSRLDTT
FT                   RLLVDALAVSKSPPSVLINASAIGFFGTSPTAKFVESSPAGADFLASLCQRWETAAAAV
FT                   PDSVRQVSLRIGIVLASDGGALGKMLPIFRTGFGGPIGTGKQWMSWIHRSDLCDLIQTA
FT                   LTDQTWSGVVNAVSPEPVSMAAFSKQLGRSLNRPSLLPVPGPILQLLLGDGAKVVLEGQ
FT                   QVTSERLDSLGFSFRYPTLVSALAAATS"
FT   gene            complement(345455..345727)
FT                   /locus_tag="Syncc9902_0331"
FT   CDS_pept        complement(345455..345727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25303"
FT                   /db_xref="GOA:Q3B024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25303.1"
FT                   /translation="MTAGTEPTWKRWLDRLLMLNVLVVILGAGFFVAAVVAQSQGQSGP
FT                   MDLFQRLWQPLFTPAISLLIMAAVLSGIVSWWQRRGLKQGSGSGN"
FT   gene            complement(345724..346905)
FT                   /locus_tag="Syncc9902_0332"
FT   CDS_pept        complement(345724..346905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25304"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B023"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25304.1"
FT                   /translation="MGRILLLSNGHGEDLSGSLLGSVLRTLGHEVTALPLAGLGRPYSQ
FT                   ATIPLLGSSHEFSTGGIGYTSLQGRLTELIQGQLLYLLRRLLRLLRHAHRFDLIVVVGD
FT                   VIPVIAAWLTRRPVATYLVAYSSHYEGQLRLPWPCGPMLSGKNFQAIFSRDQLTADDLS
FT                   NQLARPVQFLGNPFMDPVLPPTSLLTNTQPRIGLLPGSRRPELEANLQLLLRLSDQLPD
FT                   NIGISLELALVSSLDDTGLERCANGVGWQLRDGLLQRQGSPAVRVRRGAFQAVLQQSDL
FT                   VISMAGTAAEQAVGLAKPVLQLAGQGPQFTASFAEAQRRLLGPTVFCAPGDSGSQDNLF
FT                   ASAQLALKLLKRIHHDLDFQKQCRTEAQRRLGSSGGGLRMASAIGGLCPSTAP"
FT   gene            complement(347154..347573)
FT                   /locus_tag="Syncc9902_0333"
FT   CDS_pept        complement(347154..347573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25305"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B022"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25305.1"
FT                   /translation="MESSADNLFDQAMARYQAGAAASEVLPDFLQITEASPGQSAGWTC
FT                   LSWLQLLCDQPEDALRSARLAVKFNAQDPQARINLSLALLETKSKGVRDHIQVVQQVIA
FT                   FAPEAAGDLKTSIDDGLQRKPGWKALEKVKAWLDF"
FT   gene            complement(347630..348061)
FT                   /locus_tag="Syncc9902_0334"
FT   CDS_pept        complement(347630..348061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0334"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25306"
FT                   /db_xref="GOA:Q3B021"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B021"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25306.1"
FT                   /translation="MNLHRVGVEHAATMTTTPTTMPAHTAKDGKGILITEPAMQQLAKL
FT                   CGEQGTNQVLRVGVRSGGCSGMSYTMDFVPASDTLDDDESYDYESSDGQGFRVICDPKS
FT                   LLYIYGMQLDFSTALIGGGFNFTNPNATQTCGCGSSFAV"
FT   gene            348093..349559
FT                   /locus_tag="Syncc9902_0335"
FT   CDS_pept        348093..349559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0335"
FT                   /product="zeta-carotene desaturase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25307"
FT                   /db_xref="GOA:Q3B020"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25307.1"
FT                   /translation="MRVAIVGSGLAGLTAAVDLVDAGHEVNLYEARPFMGGKVGSWEDP
FT                   DGNHIEMGLHVFFFNYANLFALMKKVGAFENLLPKDHTHLFVNEGGDLRELDFRFPIGA
FT                   PFNGLKAFFTTPQLSWIDKLRNALALGTSPIVRGLVDYEGAMRTIRALDSVSFQDWFVG
FT                   HGGSPESIRRMWNPIAYALGFIDCEAISARCMLTIFMMFASKTEASKLNLLKGSPHRWL
FT                   TGPILDYIQARGAKLHLRHRVKDVQFSDGENPVVTSLLLGTPEGDTTVEADIYLAACDV
FT                   PGIQKLLPEAWRKFPQFEAIHQLEAVPVATVQLRYDGWVTELNDEHESQRRDLKNPTGL
FT                   NNLLYTADADFSCFADLALASPEDYRKEGEGSLLQCVLTPGDPWIPKSVDEIVAHTDRQ
FT                   VRALFPSAHNLKLTWSNVVKLAQSLYREAPGMEPYRPDQRTPIGNFFLAGSYTKQDYID
FT                   SMEGATMSGHLAAAAILDQPVRLATNAAVA"
FT   gene            349560..350000
FT                   /locus_tag="Syncc9902_0336"
FT   CDS_pept        349560..350000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25308"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25308.1"
FT                   /translation="MGRWLENTVTTEVQASADKVWAVWSDLEAMPKWMRWIESVKTQKD
FT                   DPDLTDWILAAQGFRFTWKARITQRVEEQQLHWASVGGLPTKGAVRFYPQTPDCTVVKL
FT                   SVSYELPRVLAPLMEPSILGGIVTKELQANLDRFRDLVEVVD"
FT   gene            350011..350511
FT                   /locus_tag="Syncc9902_0337"
FT   CDS_pept        350011..350511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25309.1"
FT                   /translation="MHSLGWLVLALGLSSCGDQASMAPSAEQNVPPLALQSQQSSAASP
FT                   LPPLIPGATGLKPLPTAQQVQAAVPSGRADPFSPLPLATGADQPSSGGSRLLGVLTVGK
FT                   QTRALFSFGMSRGEICVGPRGRCSQDQPLVLPEGWSVLNIDGQKGCIQLAENGKAQDLL
FT                   CIA"
FT   gene            complement(350487..351305)
FT                   /locus_tag="Syncc9902_0338"
FT   CDS_pept        complement(350487..351305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0338"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25310"
FT                   /db_xref="GOA:Q3B017"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25310.1"
FT                   /translation="MSLPASRSDQPLQHRTVVITRAAEQQGEAKELLEAKGANVLDLPA
FT                   LVIVPPDHWGPLDDALADLDNFHWLVFSSANGVLAVEQRLQRQQRNLCRLPRGLKIAAV
FT                   GRKTARLLEELGAPADFVPPSFVAESLIDHFPVSGWGLTMLLPRVQQGGRTVLADAFGE
FT                   AGVRVVEVAAYDSRCPEHMAEPAATALADGAVDAIAFTSGKTATHTAQLMEKRFGSEWK
FT                   QHLNGVAVVSIGPQTSRSCREHFGRVDAEADPHDLEGLVEACTQAIQSKS"
FT   gene            complement(351302..352504)
FT                   /locus_tag="Syncc9902_0339"
FT   CDS_pept        complement(351302..352504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0339"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25311"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B016"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25311.1"
FT                   /translation="MLSLSMIVRNEEARLATCLASVKGFADEMVVVDTGSIDGTVAIAE
FT                   QAGARVEQMEWPGDFAPARNHALKFLTGDWVLVLDADEQLRPEVVPSLKALMAQPDVLV
FT                   INLLRYEIGAAMAPYSSVSRLFRRHPSIQWSRPYHSMIDESVQALITSEPQWRIANCSE
FT                   PAILHDGYRPELLSGSDKADRLREAMEDDLKRHPGDPYASAKLGGLLISEGRASEAIPL
FT                   LRQGLEGATAQSSERYELLLHLGLALNESDPDEAVAFYRQALDIPLDTRITLGARLNLA
FT                   ARLMEQDQLDEAIQLTQTATQRAPEVALGWYNLGLMLRKKGEIASALEAYGRSLALDPN
FT                   NAACHQNHAVARLLGGDIEAARNGFRKAIELLAAQGRSEEARQLRDNVQGIVKLDAELV
FT                   M"
FT   gene            complement(352541..354157)
FT                   /locus_tag="Syncc9902_0340"
FT   CDS_pept        complement(352541..354157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0340"
FT                   /product="putative beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25312"
FT                   /db_xref="GOA:Q3B015"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041518"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B015"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25312.1"
FT                   /translation="MSCSPIDRLAQKIAELIVVRASGHLSDPQRRYPRWELNNATLERL
FT                   LHRGVGGVILLGGSAVELQQRTEMLRRWSAQPLLLCADVEEGVGQRFEGASWLVPPLAL
FT                   GRLYQNDPQRALDLAERYGRCTGDQARRCGLNWVLGPVCDVNNNPANPVINVRAWGEDA
FT                   ATAGTLAAAFQRGLSRTGVLGCAKHFPGHGDTSSDSHLDLPVLPHSKERLAAVELPPFQ
FT                   EVIAAGVDSVMTAHLLLPELDQNHPATLSTTVLTNLLRHDLHFDGLVVTDALVMEAITK
FT                   RYGAAEAAVLAFEAGADLILMPADADAAIDGLCDAFRSGRLPMQRLEDSLQRRRQALKR
FT                   IDKHQPLNPAQDTPLPSESERQLEQELVAACLHLQPSTGINCSQGINLIRVDGIVPCPV
FT                   LSGTAPALRLPEGQGFKSLVIHSQGPSPWQPDQDSPLALERLGQGPVLLQLFMRGNPFR
FT                   GTQDSIEPWSAAVQQLQKLHRLAGLVVYGSPYLWEQLRTVLKPDIPAAYSPGQMPEAQQ
FT                   QVLKSLLNRSHTAACNADFTD"
FT   gene            complement(354138..354542)
FT                   /locus_tag="Syncc9902_0341"
FT   CDS_pept        complement(354138..354542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0341"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25313"
FT                   /db_xref="GOA:Q3B014"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B014"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25313.1"
FT                   /translation="MAQGRRVERVAALIRKETSELLINGIRDERVHKGMVSITSVEVAG
FT                   DLQHCKIFVSIFGEPNDQNEVMEGLEAASGFLRGELGRRLQMRRAPEVKFQLDRGLEKG
FT                   TSVLGLLNQLEDQRQERGEIPPGSDELQPD"
FT   gene            complement(354501..354573)
FT                   /gene="tRNA-Glu1"
FT                   /locus_tag="Syncc9902_R0043"
FT   tRNA            complement(354501..354573)
FT                   /gene="tRNA-Glu1"
FT                   /locus_tag="Syncc9902_R0043"
FT                   /product="tRNA-Glu"
FT   gene            complement(354542..354748)
FT                   /locus_tag="Syncc9902_0342"
FT   CDS_pept        complement(354542..354748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25314"
FT                   /db_xref="GOA:Q3B013"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B013"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25314.1"
FT                   /translation="MREFFLNVTRYPRYLVTFTLGVMNSVAEPLAQRRSNPVTAVAMIG
FT                   ALISGFISLSFVLRAMVNGVPMA"
FT   gene            354808..355533
FT                   /locus_tag="Syncc9902_0343"
FT   CDS_pept        354808..355533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0343"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25315"
FT                   /db_xref="GOA:Q3B012"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25315.1"
FT                   /translation="MMELHQFRHSAFCLKVRMVLQAKGLSYRTVDVTPGIGQVAVFRMS
FT                   GQRQVPVLVDGDIVLADSSAIARHLEQREPSPALIPGDVREAAQVQLIEDWADTTLAAA
FT                   GRSALVQAAAMDPSLRVALLPDDLPDPVRTVMGAIPGGWVGSVTELVNQNERADLLTSL
FT                   EQLSASVQQSPWLVGDEMSMADLSVAAQLSLLCFPSSAGAALAGKGVPGLSDHPKLQPL
FT                   FQWRDQLELKLMERTLEEV"
FT   gene            complement(355499..356173)
FT                   /locus_tag="Syncc9902_0344"
FT   CDS_pept        complement(355499..356173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25316"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25316.1"
FT                   /translation="MGRNLLALLIGFSILLGGSPAWASPLEQRLELWPNWTLPAPLSRP
FT                   SSRDDLIYPQWFQGRWQVESVDLDALDQPALSHEARFISDNQNRLVGDRAFNANAIGRA
FT                   LLGEQLLRVEDDPRSSNRQMAQLTGDRRLETTVTGRRQLSPNADTFLADELVLQILHAP
FT                   GPPRLSQVETLSRYQRCGLDICAEQWQGIFPPPGENLRDTIKASHHYQLRFTPLPASAP
FT                   ST"
FT   gene            356172..356438
FT                   /locus_tag="Syncc9902_0345"
FT   CDS_pept        356172..356438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25317"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B010"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25317.1"
FT                   /translation="MSDPLIRACDDYVVLEPGKPEQLLDVPNTLAWLSRWLQTMDQLPA
FT                   DLAGLSSVEAAAQRLLDTACDLELSPGVSIQWFAVRLEPPSTL"
FT   gene            complement(356452..357027)
FT                   /locus_tag="Syncc9902_0346"
FT   CDS_pept        complement(356452..357027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0346"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25318"
FT                   /db_xref="GOA:Q3B009"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B009"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25318.1"
FT                   /translation="MTDPILSLKERLSGRSIYLIGMMGSGKTSTGRPLAKRLGYGFVDA
FT                   DAVIEQVAGCTIPEIFERDGEAGFRSIESQVLNAISQRHSLVVATGGGVVTKPENWGQL
FT                   HSGIVVWLDVNRAQLIERLRDDSTQRPLLQQPNPEAALDTLLQERRPLYGEADLTVVIK
FT                   DESPDAVADGILQLLPTLIKDPTEQRER"
FT   gene            357079..357999
FT                   /locus_tag="Syncc9902_0347"
FT   CDS_pept        357079..357999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0347"
FT                   /product="6-pyruvoyltetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25319"
FT                   /db_xref="GOA:Q3B008"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B008"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25319.1"
FT                   /translation="MTETKSIARHGQGRSCVITRRACFSASHRYWLPELSADDNAARFG
FT                   PCSFAPGHGHNYELIVSMAGDLDADGMVLNLSEVKHAIRSEVTGQLDFRFLNEAWPEFD
FT                   VSSSEGCLPTTEALVRTIWHRLRSHLPITALRLYEQPGLWADYLGDSMDAFLTIRTHFA
FT                   AAHRLARPELSQEENEQIYGKCARPHGHGHNYLVDITVRGAIDPRTGMVCDLSALQRLV
FT                   DDLVVEPFDHTFLNKDVPFFAECVPTAENIALHIADRLSSPIKAIGAQLHKVRLQESPN
FT                   NAAEVYAEVPQLEMLPASMDAVAAI"
FT   gene            357980..358678
FT                   /locus_tag="Syncc9902_0348"
FT   CDS_pept        357980..358678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0348"
FT                   /product="putative riboflavin-specific deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25320"
FT                   /db_xref="GOA:Q3B007"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B007"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25320.1"
FT                   /translation="MPLQPSDDCAAPALERPETRLVLAISLDGRLAPAEGGAAQLGGKG
FT                   DRRVLDTALAWADACLMGAGTLRAHQSTCLIRDRALLQQRVDQGRSAQPTAVVVSRSDA
FT                   FPLQWQFFRQPLERWLLAPKAPAEGFDRWIPLGHSWPERLEALYACGVRRLALLGGASL
FT                   AAEVLQADCVDALQLTLVPTLLGGPHTWLPVDAKPLPLSMLGAGAWSCDGLEDLGEGEM
FT                   VLRYRRQRVH"
FT   gene            358777..359163
FT                   /locus_tag="Syncc9902_0349"
FT   CDS_pept        358777..359163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25321"
FT                   /db_xref="GOA:Q3B006"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25321.1"
FT                   /translation="MGKKNKKRKLRGTSGSDELTGLISNQRIYGLAGDDIISTVEGKFK
FT                   VWGGKGRDTFVTLNGGDGYLQVMDFEVGDKIQFCGCASTRIEQKGRNALIVKSNDVKAV
FT                   LRGVDADELHLDFTQGLIAFAADS"
FT   gene            359239..360414
FT                   /locus_tag="Syncc9902_0350"
FT   CDS_pept        359239..360414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25322"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B005"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25322.1"
FT                   /translation="MTSLTARWHRSVAEISPQQWVEMIGKDSLPFYQWEWLNALESSGS
FT                   TIPDQGWQPLHLALWRDETPIAVAPLFVKGHSYGEFVFDQAFARLAADLGLRYYPKLLG
FT                   MSPVSPVTGYRFHMLPGEDEVQLTIVLLQTIDRFCENNGILSCNFLYVDPSWRPLAEAA
FT                   GCAVWLNQQSLWSRGNDQSFDDYLQGFNANQRRNIKRERKAVAKAGVMVTPLTGDQLDG
FT                   ELLEIMYQFYEQHCSQWGPWGSKYLEQGFFASLADQYRENIVLFSAHRGDPRDPVAMSL
FT                   CVRDATRLWGRYWGTHEQIDCLHFEVCYYAPIEWALQQGIKSFDPGAGGSHKRRRGFVA
FT                   QPHASLHRWYEPQMDALIRAWLPKVNGLMLEEIDAINAELPFKAESPTLGL"
FT   gene            360424..360828
FT                   /locus_tag="Syncc9902_0351"
FT   CDS_pept        360424..360828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25323"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B004"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25323.1"
FT                   /translation="MAKLSDVVPRSEAREELDERLSQRFIALDPKGYFLIKVDSGSAEL
FT                   VLEHYGNTIDDKGLAHDPETGEVLSCKGGNGPRQPSAVYRGSTAKQVGIQLTEGDGPHP
FT                   LSCLDHALYLGRELQKAEACLNEGTAYVQD"
FT   gene            complement(361132..362358)
FT                   /locus_tag="Syncc9902_0352"
FT   CDS_pept        complement(361132..362358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0352"
FT                   /product="putative multidrug efflux MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25324"
FT                   /db_xref="GOA:Q3B003"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B003"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25324.1"
FT                   /translation="MTVLQLQPEQQRRLFLVASGVSTAGSFAGITAKGWILMDGSADPF
FT                   LLALNFAALALPTLIISGPAGVRTDRVGCERVLVQSQWALLAAAGLGALAIPLFEGMAQ
FT                   VVLLLSSTLLVGIAGAYELTARNKYCSILVGPNQLGSYLTSFSVVFNVGKLVGPPIGGW
FT                   LLAATGPAWALGIDAASYLLPIASVMFLLQPDRTREVRSTNVKNASLSSAWRQCGPTLQ
FT                   GVLTLTAVMCLVGFFHPGLAPLIAFEVLGGKPTDLGLFTSVLAAGSIAGGVVLQRNSVQ
FT                   FSHRPFLTLGGFGMITAIAQLGMSRSPGVAFSLAMAFLIGAGTAGLLSSCNLITQIGSD
FT                   PVMRGRMAGLSQIAFLGGGGISGLLVAGVVVATNLSTAFALCGGISLVVAIRWILTRGQ
FT                   KTLEPIRST"
FT   gene            complement(362355..363755)
FT                   /locus_tag="Syncc9902_0353"
FT   CDS_pept        complement(362355..363755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0353"
FT                   /product="Protein of unknown function UPF0004"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25325"
FT                   /db_xref="GOA:Q3B002"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3B002"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25325.1"
FT                   /translation="MTSTTTQPTTQPMAKPKVAFAHLGCEKNRVDTEHMVGLLAEAGYG
FT                   VSTDEEDASVVVVNTCSFIQDAREESVRTLVGLAEQGKELIIAGCLAQHFQEELLESIP
FT                   EAKAIVGTGDYQHIVDVLQRVEAGERVNRVSAVPSFVGDEHLPRQRTTDQAVAYLKVAE
FT                   GCDYRCAFCIIPKLRGDQRSRPIESIVAEAHQLAEQGVQELILISQITTNYGLDLYGKP
FT                   KLAELLRALGEVEIPWIRVHYAYPTGLTASVVAAYRDVPNVVPYLDLPLQHSHPDVLRA
FT                   MNRPWQADVNERLLNEIREQLPDAVLRTTLIVGFPGETEEHFQHLKHFLETQRFDHVGI
FT                   FTFSPEDGTAAADLPNRVDPDVAQARKDALMALQQPIAAERNQRWVGKTVDVLIEQHNP
FT                   QTGEMIGRCARFAPEVDGEVHVQPGDDGQQAAPGSFVPVKITGADIYDLTGHIVGARSM
FT                   VAEARVKD"
FT   gene            363841..364770
FT                   /locus_tag="Syncc9902_0354"
FT   CDS_pept        363841..364770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0354"
FT                   /product="Thioredoxin domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25326"
FT                   /db_xref="GOA:Q3B001"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B001"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25326.1"
FT                   /translation="MGSTRLVSRRRQDPGAKWARIAMAVLATIGVIDTGSITLKRWGFL
FT                   GDLTCPMGADGCDKVLNSAWGSLADGIPLSLVGLVAYGVVVLMALVPLLPGLQENKSEL
FT                   SRRTWWGLFMVSTGMAVFSGVLLGLMVFKIQAFCFFCVLSAALSLILLVLSVVGGGWDD
FT                   PGTLIFRGVLLALAVLLGGLIWASVVDPDRPESVETGAGIAPVVTQESSPASVALADHL
FT                   TAGGAVMYSAYWCPHCHDQKEMFGKEASQQLQVVECAADGQNNQADLCRSKGLEGFPSW
FT                   EINGEIDSGVKSLDSLADLSGYKGDRDF"
FT   gene            complement(364772..366433)
FT                   /locus_tag="Syncc9902_0355"
FT   CDS_pept        complement(364772..366433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0355"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25327"
FT                   /db_xref="GOA:Q3B000"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B000"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25327.1"
FT                   /translation="MAQPRPLDPIPPGPWDVVVVGAGAAGLMTCLDLPAGLRVLLLNRN
FT                   TGRRSSSRWAQGGIAAVTRPEDNSSSHAEDTIHAGAGLCDGDAVRLLVDEAPHCVERLQ
FT                   RLGMAFDRDGPNLATTLEAAHSHKRVLHVQDQTGRALVDVLRERVEEREGLLHRRGVRV
FT                   TKLTVENGSCSGVQVLDGRLLYTVQARAVVLASGGGGHLFANTTNPAQACGEGVALASQ
FT                   AGAAVEDLEFVQFHPTALRLDDAPCFLISEAVRGEGGVLVDDLGCSPVAHLPRGDLSPR
FT                   DQVSRALVQSMKRQGVGQIWLDFSAIPREQAEARFPTILDRCSEFGLNPLEHPIPVAPA
FT                   AHYWMGGVATDLQAATNLPGLFAVGEVACTGLHGANRLASNSLMECLVFAHQLKSIELG
FT                   PQQTPVKRSKPDRCDLDLSSGESSTGLMARIEHLRQLCWQTAGVDRVVQGLRQALQQVQ
FT                   AEESWLEKQPLLQLVKDLDHAETLELGDSSRRNLNLLLDLHHRLLTSRLMLEAGLFRRE
FT                   SRGGHFRIDAPVALPQWQCHSRQCLQHGIRTRAVRR"
FT   gene            complement(366513..366911)
FT                   /locus_tag="Syncc9902_0356"
FT   CDS_pept        complement(366513..366911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0356"
FT                   /product="photosystem II extrinsic protein (psbU)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25328"
FT                   /db_xref="GOA:Q3AZZ9"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25328.1"
FT                   /translation="MKRLLSWLTGALVMAGLLSSLVLPSAVYAEEDLLGKYSGSEIRNV
FT                   VDDKIAEREGKVDLNNSSVRRFQQFPGMYPTMAGKIVLGGPYNNVDDVLELDLSERQKE
FT                   LFAKYRDNFTVTPPSIALNEGDDRINDG"
FT   gene            complement(367024..367740)
FT                   /locus_tag="Syncc9902_0357"
FT   CDS_pept        complement(367024..367740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25329"
FT                   /db_xref="GOA:Q3AZZ8"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25329.1"
FT                   /translation="MVGGTWQSTASDRQWFVSVPKAAAAMVVLPVFLQAPWVRVHPFSA
FT                   TLFTALLVAIGVVLNRSDNQQKADFGSLIVGFSGSWLAGCVFWGWLRAHPVLHLPVEAF
FT                   ALPLALAGFGTRWRLASAFYLSSLVGTAFTDLMMAITGVMRFWPGVVTASMDTAPQLLH
FT                   EAGLHLLHPLPLTALVLAASSIIWLAGTLSKRETAVFKSNDTLAMSAAVLMTTLWVDGL
FT                   FLLAAVVQPGLSGLIE"
FT   gene            367828..368679
FT                   /locus_tag="Syncc9902_0358"
FT   CDS_pept        367828..368679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0358"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25330"
FT                   /db_xref="GOA:Q3AZZ7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25330.1"
FT                   /translation="MIDTTAPLSLLEALVLGIVQGLTEFLPISSTAHLRVVPALLGWDD
FT                   PGVSVTAAIQLGSVAAVIAYFRRDLTQVLTGISRAVRHGQWRDPDARLGVAMVIGTLPI
FT                   LVLGLGIKFFWHAGYASSPLRSVPSIAIVSIVMALFLAMAECMGPRLKQLGGVTGRDGF
FT                   VVGLAQALAVIPGVSRSGSTLTASLFDGWNRADAARFSFLLGIPAISIAGLVELKSALS
FT                   TSAGAGPLPLLVGIFSAAVVSWLAIDWLLRFLQRNSTWIFVGYRLVFGAGLLVWWAFKS
FT                   AN"
FT   gene            368700..370097
FT                   /locus_tag="Syncc9902_0359"
FT   CDS_pept        368700..370097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0359"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25331"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25331.1"
FT                   /translation="MWNEPSTGVAIAALDPKTSARQPQPAVVATVEPGSIGEELGFEPG
FT                   DQLLSINGVRPRDLIDYRYLCVEEELSLQVLDTAGELHCVDLEKDADDGLGLAFTEALF
FT                   DGLRQCNNNCPFCFIDQQPPGHRDSLYLKDDDFRLSFLYGSYLTLTNLTDVDWQRIEDQ
FT                   RLSPLFVSVHATEPELRSRLLVNQRAGLLMDQLAWFDQRDLQIHAQVVVCPGLNDGAAL
FT                   ERTLSDLARFAIGEWPAVLSAAVVPVGLTRFRPEQDGLIPVDSRCARTVIAQVEQIQSE
FT                   FQSQLGSRFAWLSDEWYLMAGLPLPPRADYEDFPQQENGVGSIRAFLESLDEASTELPK
FT                   AVDRPRHCSWVVGSIVESALQSVTQRLNAVEGVSLQLFGLPSPYWGQDQVVTGLLTGQD
FT                   LLDGLNGQDLGDELLLPSVMLRQGQPVFLDDMTLETVQSQIPVPIRVVHGAADIVASVL
FT                   SANEKTP"
FT   gene            370186..371910
FT                   /locus_tag="Syncc9902_0360"
FT   CDS_pept        370186..371910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0360"
FT                   /product="putative RND family outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25332"
FT                   /db_xref="GOA:Q3AZZ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25332.1"
FT                   /translation="MLGQASSSKDSTSALTDQSTLPTAPQLKGGRPRLNDDAVAPAATE
FT                   LTPSLQPLKAPPSLALPNQKQQVSIHELRPLTLEDALLLAEVNSPVLKAAASQVEQAKS
FT                   SLRAAISSWYPTVDLSASGLPEYFKSYSFQNPDFVPDRLVQKNTGEINPLTGAPLTRNE
FT                   TRDGYNERYGREWRVNASLQVSWDIINPRRVPQIAAARDQYEQARDSYAIALRDLRLNT
FT                   STDYFNLQEADEGVRIGQASVRASLVSLRDARARFNAGVNTKLEVLEAETQLARDRNIL
FT                   TSKLGDQDTSRRLLASKLDLPQDVTPTAATPARPLGSWQPSLQESIVAAFNFREELDSL
FT                   LLSISINNSEANASLAAVQPVLSFVNTSSTSRREGQSGKTSLGDIDMDDYVWSVQNSTS
FT                   LRATWRLFDGGRARAEYRRSKQAAEESSYRFARARDSIRLEVEQSFFGLRTAVQNIQTT
FT                   GSEVLSARESLRLSQLRVQAGVSTQREVVNNQRDLTNAELRYAGAIRDYNTSLAQLRRR
FT                   TGLDALVSCSNPVLPSSKTVETQTSIPIEPTPLKSVCPAMAISTASTDRAESVRSLW"
FT   gene            373319..374797
FT                   /locus_tag="Syncc9902_R0046"
FT   rRNA            373319..374797
FT                   /locus_tag="Syncc9902_R0046"
FT                   /product="16S ribosomal RNA"
FT   gene            375574..378439
FT                   /locus_tag="Syncc9902_R0047"
FT   rRNA            375574..378439
FT                   /locus_tag="Syncc9902_R0047"
FT                   /product="23S ribosomal RNA"
FT   gene            378570..378660
FT                   /locus_tag="Syncc9902_R0048"
FT   rRNA            378570..378660
FT                   /locus_tag="Syncc9902_R0048"
FT                   /product="5S ribosomal RNA"
FT                   /note="Data from Rfam and Infernal"
FT   gene            378749..379747
FT                   /locus_tag="Syncc9902_0363"
FT   CDS_pept        378749..379747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0363"
FT                   /product="serum resistance locus BrkB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25333"
FT                   /db_xref="GOA:Q3AZZ4"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25333.1"
FT                   /translation="MCPYTWISVFIAVTFRCIGQAEVLKQKAFRWFVLSLWRASQRWSD
FT                   AACVDLSAAFAYFTLQSFFPLLLIALSVAARVFGRTDSLDKLITFVAQILPPSAVDLVD
FT                   STLRGLVAQGFGAGLFGVVVLIITASNAYLTLQRGADRLWSEILPSASINSPLSTQIYQ
FT                   FVRARVEAFVIILAIAVLILADQIAAGFRWLPEAFIGNLDYYIPSLMLLVRESPIVSIG
FT                   QILLPALALSLMALLLQRVLPSRRVPIMPLIPGSILIGLGLSFLNAALSLSLVSLGNRF
FT                   QAYGVIGGVLVLTLWVWLVGVILYFGQCWSVELAASRMRRLSQGDPNSSVA"
FT   gene            379801..380148
FT                   /locus_tag="Syncc9902_0364"
FT   CDS_pept        379801..380148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25334"
FT                   /db_xref="GOA:Q3AZZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25334.1"
FT                   /translation="MNRPPLFVLIAIGLLLLLPAGAGRVLLDLAGGLLAVLLVLPILLG
FT                   GLGWVGWKVLQSRLQPCPACGAVGFGANLQCGVCGTPYSSRTEGEESTAVSIPASDLTI
FT                   DITAQDVDSDS"
FT   gene            complement(380124..380474)
FT                   /locus_tag="Syncc9902_0365"
FT   CDS_pept        complement(380124..380474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25335"
FT                   /db_xref="GOA:Q3AZZ2"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25335.1"
FT                   /translation="MRKALPWIYLILAILGAVLPWRANLEFMAESTGNFDIQQFVADAS
FT                   ATAAARSLGADLLIGATAVSIWICIEGPKQKIKGWWIAILLSFGVAFACGAPFFLFLRE
FT                   RHLQAQESESTS"
FT   gene            complement(380467..380763)
FT                   /locus_tag="Syncc9902_0366"
FT   CDS_pept        complement(380467..380763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0366"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25336"
FT                   /db_xref="GOA:Q3AZZ1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25336.1"
FT                   /translation="MTRAKTKATQIKAWKKDISGLSYEEATQALDLILAELQSDSVPIA
FT                   DLQNRVLHGEVVLDHCEALLKSVEQAVLQLDPDSMIETNNLTESITTNESSNA"
FT   gene            complement(380760..381923)
FT                   /locus_tag="Syncc9902_0367"
FT   CDS_pept        complement(380760..381923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0367"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25337"
FT                   /db_xref="GOA:Q3AZZ0"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25337.1"
FT                   /translation="MSADRVPTYSVGELNTAIGSLLERGFAPRFLLEATVSRPQVKKGH
FT                   LWLTLTDGTASISGVVWASRLAQLSYRPTDGDGVTVVGKLNFWAARASITVQALDIRPS
FT                   LSTVLRQFEQVRQRLEDEGVINPGRQRSLPSQPATLALLTSVPSSALADMLRTGRERWP
FT                   MTRLLVIPIPVQGAVADQIIKVLNRLAERCEALAVDGLVLARGGGSREDLAVFDDEALC
FT                   RCLAQFPRPVVTGIGHEDDLTIADLVADHRAATPTAAMVACLPDRDSAKRNLQDRRQRM
FT                   KDVVGWRIERDRQRLNDRRAFLRQQSPLRRLQQLQDDLNRKRDLLRALSPSRWLQRGLA
FT                   LLSNDAGETLSGVTSIKVGDRVVIQMNDGELDTDVKVVRPSSHQSMS"
FT   gene            complement(382209..382349)
FT                   /locus_tag="Syncc9902_0368"
FT   CDS_pept        complement(382209..382349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0368"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25338"
FT                   /db_xref="GOA:Q3AZY9"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25338.1"
FT                   /translation="MSDNARFGFVNFAETWNGRLAMLGFVIGLGTELLTGQGILTQIGL
FT                   G"
FT   gene            complement(382437..384941)
FT                   /locus_tag="Syncc9902_0369"
FT   CDS_pept        complement(382437..384941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0369"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25339"
FT                   /db_xref="GOA:Q3AZY8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25339.1"
FT                   /translation="MKDFPIDPLLPTICQQIKPGSTLLLQAPPGAGKTTRVPLALIGAL
FT                   TPIAAEITRAGRVLMVEPRRLATRAAATRLAQSLDEPLGQRIGYAMRGEQKRSTKTQVE
FT                   VVTDGLFLRRLQADPSLEGVSCVLFDEFHERRKDADLALALLREAAPVLRPDLALVLMS
FT                   ATLDLSDLRDRLPQADVLESAGRCYPVETHHQRARENESLPRQVLRALENHALTLSKGS
FT                   GALVFLPGLREIERCRTLLSDAKALQRWRIAILHGQLPLDSQSAALHRCGPEHDGTVIL
FT                   ASGIAESSITIDAVRLVIDSGLSRQLRYDPNTGMEGLETVPSSLASAEQRRGRAGRQSA
FT                   GQCVRLWSPAEQQRRPNFSPPELLLADPQPILMELAQWGAGLGKDLPWLDAPPQAAMQE
FT                   GLSDLQALGLLQPNGQLSSMGRQLSTLGVHPRLGLLMLEAREHGCSQLGCDLAVLLSER
FT                   DPLAGRDAGCDLEARLSVIGQHRTLRVRSRQLRRQLDRLGVTAPEKTDSANAAALVLRA
FT                   FPQWLAQERPGQPGRYLLRQGRGAILPPLDQLRGSPALAVARVDTGGRDTLIQLALPLD
FT                   SSTLEELGEREGTWVESVSWDASRQQVKAERRLQLGELVLRRTPQSAPSPEQCQALLLN
FT                   ALHEAGTLEALPWTAFNQQLRQRLSWMHRHDGPPWPPRDKETLLQDTTWLAPTLLSCQS
FT                   WRDLSPAMLDEALWGALSWTERQRLDQVLPERIAIPSGRQAKLRYDDEEVVLAVKLQEM
FT                   FGETTGPHVLRGQIPVTLELLSPAGRPLQRTRDLEGFWTGSYADVRREMRGRYPKHPWP
FT                   DDPTRATPTAFTKRKQLQQKGS"
FT   gene            complement(385190..385573)
FT                   /locus_tag="Syncc9902_0370"
FT   CDS_pept        complement(385190..385573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25340.1"
FT                   /translation="MDQRTRIVAAVMKGMKLPPRFRLRLVKEDPVRLELSVTPAYGKDP
FT                   IIVGLVESLDLVARRDREGRIPRDLQGTWDWTVRHGQVSTGGWNPYLKEALQTMFETGL
FT                   PAIVFEELTGEEYHPVDGTRHVR"
FT   gene            complement(385608..385865)
FT                   /locus_tag="Syncc9902_0371"
FT   CDS_pept        complement(385608..385865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25341"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25341.1"
FT                   /translation="MLSALFPLLYGTVLVALLWQAFRVMGKGFRAASGPISEPNDRTGR
FT                   ITVHPELLDSDGRITGEDLLTVRFSGNDDGETETHGHGTE"
FT   gene            386010..387143
FT                   /locus_tag="Syncc9902_0372"
FT   CDS_pept        386010..387143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0372"
FT                   /product="PDZ/DHR/GLGF"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25342"
FT                   /db_xref="GOA:Q3AZY5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25342.1"
FT                   /translation="MSDRTRSFVTSALVGGALAGGMSVLPLLLPQPPVSARSVLPLTSF
FT                   VASAVKRSGPAVVTLETSRTMQSPSLSGLPKGIRLNPLFRNFFGVPGESPPRPRVQRGQ
FT                   GSGVLFDARGLLLTNAHVVEGAEELTVGLSDGRRVKGRVIGTDSLTDLAVVRLEGEGVW
FT                   PVAALGNSDRLNVGDWAIAVGNPYGLENTVTLGIISNLNRNVAQLGISGKRLDLIQTDA
FT                   AINPGNSGGPLLNAEGEVIGINTLVRSGPGAGLGFAIPINRAKAIASELVATGKARHPV
FT                   IGIGLSRVPADRPGRPAPKGAVIRSIQKTGPADKAGLQVNDVITAVDGLAVDGPAAVVS
FT                   AIEQRGVGETLTLQIRRASESKVVRLKPVDLSFFDRS"
FT   gene            complement(387487..389238)
FT                   /locus_tag="Syncc9902_0373"
FT   CDS_pept        complement(387487..389238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0373"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25343"
FT                   /db_xref="GOA:Q3AZY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25343.1"
FT                   /translation="MMDASRSGPLLRLEQVSKIYPTGEVLRNVTWEVKPGDRIGLVGVN
FT                   GAGKSTQMRLIAGFEEPSSGQVVRQGSPRIAYLQQEFDVDLERSVREELFQAFGEAATV
FT                   LNRQREVEEEMGSEKAAEDPNHLDELIHELGRLQSRFEGLHGYELDARIDKLLPTIGFS
FT                   AAGAERPVKDYSGGWQMRIALGKILLQDPDLLLLDEPTNHLDVETIQWLEGYLLEQNAA
FT                   LVVISHDRTFLDRVCNQIVSTERGISRSYLGNYTSHLELKQLEQQSTQAAFERQQKEIA
FT                   TQQAYIDRFRASATRSTQAKSREKQLDKVELVEAPVESVSGPSFRFPAAPRSGAQVALF
FT                   ENLTHSYGDKILFLGADLEVERGDRIAFVGPNGAGKSTLLRLVMGAEIPDEGIAQLGEH
FT                   NVVAGYFEQNQAEALDLNKTVIDTMYEAVPDWTQTQVRSLLGNFCFSNDSVFKDVGQLS
FT                   GGEKARLALALMLLSPCNLLVLDEPTNHLDIPAKQMLEDALMAYEGAALLVSHDRYFIS
FT                   RVANRIVELRDGELVLYRGDYNYYLEKKEEERAEAREKELASERDAKKKANQDKQKART
FT                   ARKKKST"
FT   gene            389280..389498
FT                   /locus_tag="Syncc9902_0374"
FT   CDS_pept        389280..389498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25344"
FT                   /db_xref="GOA:Q3AZY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25344.1"
FT                   /translation="MLKLEQFVALVVAAGLAIVSYMLFFSWAGGGGYEPRQPRRDELSR
FT                   LKASSEVALGTTPRGRFENGRAAAHNW"
FT   gene            complement(389549..389779)
FT                   /locus_tag="Syncc9902_0375"
FT   CDS_pept        complement(389549..389779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25345"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25345.1"
FT                   /translation="MSSNAAALYAQISSNPEQTQALFRQALQDPSGAMESICGLGKQLG
FT                   LPVTPEDVRTHLASLDDDDSNRWLVKARGGL"
FT   gene            complement(389827..390144)
FT                   /locus_tag="Syncc9902_0376"
FT   CDS_pept        complement(389827..390144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25346.1"
FT                   /translation="MTQSTPKSKPTLQSRRSTAPRRSRTRSPRRSPENSDVLVSAVVST
FT                   YLLTHLHHVLQRAEYAAVQEGRGSQAANYAQLRKVLCMDARSMEDASALGQRDESFEQA
FT                   A"
FT   gene            390254..390547
FT                   /locus_tag="Syncc9902_0377"
FT   CDS_pept        390254..390547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25347"
FT                   /db_xref="GOA:Q3AZY0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25347.1"
FT                   /translation="MPTRQTSASGKPKSPRIQVVLPEDLCARLTALAESESRTVSNMAR
FT                   VLIQQGVQRQEQGEAPAEKPLSREERFRSALESQQPRRLRGAPRRLRLYRPS"
FT   gene            complement(390544..391686)
FT                   /locus_tag="Syncc9902_0378"
FT   CDS_pept        complement(390544..391686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0378"
FT                   /product="conserved hypothetical protein, transport
FT                   associated"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25348"
FT                   /db_xref="GOA:Q3AZX9"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25348.1"
FT                   /translation="MRCLGLMSGTSADGVDAVLADFRGSPNHPQWDLIRHVHHPYPEAL
FT                   RHRVVSAGQGEPSRADQWLDLAEAITEAQAMAARSCDPHAEAVLVGCHGQTIWHRPPTS
FT                   QQRGASWQLLQAPLLAQLLERPVVHDFRAADLALGGQGAPLVPKADAALLGGTKGWRAL
FT                   LNLGGIANLTLIPPCCGPDRDASVQGWDCGPANSLIDLAVQQFSNGTLLFDRGGAMAKA
FT                   GHSDETSIRRWLQEPYFQSPPPKSTGRELFGRANLQQRLNDLGRDCSSQDAVATLTSFS
FT                   AAVVAQDLEQLMQRDRIRPLELIVAGGGRHNPVLMDQLQQRCRGLQLSSSQEMGLPVEA
FT                   REALVFALLAWWHQRKHPGNSPSITGATRESVLGVLVHPG"
FT   gene            complement(391690..392394)
FT                   /locus_tag="Syncc9902_0379"
FT   CDS_pept        complement(391690..392394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0379"
FT                   /product="putative potassium channel, VIC family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25349"
FT                   /db_xref="GOA:Q3AZX8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25349.1"
FT                   /translation="MNEWWHWSPLQGSERLGFAIIGVGRFGIAVCRELLQNGADVLAVD
FT                   RSARAIEELRQVEPSVEARVVDCTDEESLREAGVLDMGTVVVAISEPIEASITATLIAK
FT                   DSEGSQVKQVIARATSDLHEKMLKRVGADRVIFPSRMQGERLGLELVRPNLMERLALDE
FT                   QHCIEEIKVPELFVGRSLRDLNLRKNFRVNVLAAGPQSSLTVNPPASHVLELGHLLVVM
FT                   GLIDDLQRLPKM"
FT   gene            complement(392425..393840)
FT                   /locus_tag="Syncc9902_0380"
FT   CDS_pept        complement(392425..393840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0380"
FT                   /product="possible sodium transporter, trk family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25350"
FT                   /db_xref="GOA:Q3AZX7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25350.1"
FT                   /translation="MPIRKAIERSQSWRLRLTVPQFTVVTGLLVVFLGTLLLATPLCSN
FT                   SSVGLWEALFTATSAITVTGLSIIDIGVDLTAFGQAVLALMILTGGLGLMAITTFLQGF
FT                   VMHGTALRRRLDRGQTLDEFGVGGVGSTFRAIIITALVVILLGALVLYNYGFDDIPNRG
FT                   ERLWAAVFHSISAYNNAGFGLWSDSLERYHANPVVNGVVMVLIITGGLGWRVTSDLATQ
FT                   ALRRGRSRRRLSLHSRLVLRTSFLLIGFGALGLAMTEWLNKGGVFIEMTWSERWMTALF
FT                   ESVTARTAGFTTIPLSLENITESGLLLLMTLMFIGASPGGTGGGIKTTTVAALMAATRS
FT                   TLRGRDAVVIRNREIADKVVLRAVGITVASLLFVLGMALLISIGSNLNGEDPFTFLEML
FT                   FTCISAFATVGLDLGVTAELSRFGQGVLLVGMFVGRLGILLLLSAIWEAATREQIHIQR
FT                   QNRVGYPREDLYV"
FT   gene            complement(393876..395681)
FT                   /locus_tag="Syncc9902_0381"
FT   CDS_pept        complement(393876..395681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0381"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25351"
FT                   /db_xref="GOA:Q3AZX6"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25351.1"
FT                   /translation="MTELISALQTPHALITLSVLGLAVILFITGALAPELTGLLSLGLL
FT                   LACGVLSPQEALAGFGSPALITLLGLFPVSAALFKSGALDRLRGLIASERIRSPRRLIA
FT                   LMAFVIAPVSGVVPNTPVVASLLPLVENWCHRHGISPSRVLLPLSFSTVLGGTLTLLGS
FT                   SVNLLVSDISQQLGYGSFELFTFTLISLPIWLVGALYLVLAPRSLLPDRGNDLDDLSPQ
FT                   RSGYCTEVTIPDTSELVGRSLLNSRLQRRFDVDVLEIQRGGERLLPPLADRRLEAGDHL
FT                   LLRVTRDDLLRLQQDHTVQLTTQGQNAGSSLNTSQVSGQKTVEVLLPAGSTLAGASLRE
FT                   LRFRQRHNATVLALRRGQETVQERLGQVVLREGDVLLLQAPFDSIRGLQASNDLLVLDR
FT                   LEDDLPTVGRKPVAVSIAIAMLLLPTITPIPLVAAVLLAMVSVVATGCLRLGELQRSIR
FT                   LDVILLLGSLTSFSVALQTTGLADALAAGVQQWLNGWPTYYALVAIFLGTTLLTQVMSN
FT                   AASVALLAPVAVQLAPALGLSPFALLITVLFGASQSFLTPVGYQTNLMVFGPGRYRFLD
FT                   VTRYGLGLTLIMTALIPALILWHYG"
FT   gene            complement(395678..397345)
FT                   /locus_tag="Syncc9902_0382"
FT   CDS_pept        complement(395678..397345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0382"
FT                   /product="putative GTP-binding protein, transporter
FT                   associated"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25352"
FT                   /db_xref="GOA:Q3AZX5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25352.1"
FT                   /translation="MKQAHLGGRTKGLRRSQERQLDRLSQRRHPEDGLELLTLERLSEL
FT                   VLELKTPLHLIIDGRGLCRLLWLGPLSGSDSPLNHLPQAPRRQSGGWRLVSCPFCRDGL
FT                   NSDPADAVVALDIGPRQWLRFAPKPGADGIRTAELLYPDSNESDGWFHQESGDLRDLCE
FT                   RELEDERSQPIAEAAKGMERVLLLTLIGHDSCESERELAELEGLVRSAGGQPVAVMSQK
FT                   SGSTNPQTLWGKGKLQEAALEVRRNGASLVITDRELTPVQARNIERLVNCPVSDRSELI
FT                   LDIFAQRAGSAAGRLQVELAQLRYRLPRLLGRGQSMSRQGGGIGTRGPGETQLEKDRRA
FT                   ISRRIERLLRDQQQLQAHRSRLRDQRRGLPRVALVGYTNAGKSSLLNALCGQRESDRVL
FT                   AENKLFATLDPTTRKLDLPRPGERPQRMLLTDTVGFIRDLPKPLVEAFRATLEEALDAD
FT                   LLLIVVDLADPDWVGQLSTVHRLLDSLGSSALRRVVANQIDRCELEAIHSIRDQEPDAL
FT                   FLSAVRGDGLQGLQDWLRSQFFDSDAESSAMTTSDLAQ"
FT   gene            complement(397342..398490)
FT                   /locus_tag="Syncc9902_0383"
FT   CDS_pept        complement(397342..398490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0383"
FT                   /product="putative NADH dehydrogenase, transport
FT                   associated"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25353"
FT                   /db_xref="GOA:Q3AZX4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25353.1"
FT                   /translation="MTSPTSSADAVVIVGGGFGGWFAALAIQKRLPHCRVVLIEPRREF
FT                   LFQPLLYELLSHELQEWEVAPQYNELVSHHGICWLQDEVISIDRSNHSLQTRSGDCIPW
FT                   RQLVLATGSQPNDFGIPGVKEHSRGFRNLSDVRELRQRIQDLLHQRRANAALAIVGAGP
FT                   TGVELSCKLADLLNGSARIHLIEKGDSILPNSSAFNRERATAALERKDVCLHLNANVAR
FT                   VEADRVVFAEGEEIEHQGLIWTAGSQAKVPSVQPLPQLHRGHLAVRADLRLQDSFDVFA
FT                   IGDTAMNGEDPAPANAQVAMQQGEAVGDAIAALRAGEEPQTFEFKDRGEMLSLGIGDAT
FT                   LTGLGITLAGPLAFQLRRAAYLTRMPGLSVGVRSAGAWLLNR"
FT   gene            398557..399357
FT                   /locus_tag="Syncc9902_0384"
FT   CDS_pept        398557..399357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0384"
FT                   /product="phosphoadenylylsulfate reductase (thioredoxin)"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25354"
FT                   /db_xref="GOA:Q3AZX3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25354.1"
FT                   /translation="MTEGPDGMVRTSAEVEAAQQADLRSELLQQNRLALDGLAPQERLA
FT                   WAHQTFGEQFALTTSFGIQSSVLLHMLSQLPGGHAVPVIWVDTGYLPAETYAYVEQLMG
FT                   LVDIRLVVAQSVMSPARMEALHGRLWETGAVADMELYHRIRKVDPLEESLDQLDIKCWA
FT                   SGVRRGQTDHRRSMTSLDPIRDRLSLRPVLDWTKKDVFYYMNDNDLPQHPLFEQGYSTV
FT                   GDWHSSGPDGGDLNGRDTRFGGLKQECGIHLPQEEVEGLLGEGI"
FT   gene            399300..400058
FT                   /locus_tag="Syncc9902_0385"
FT   CDS_pept        399300..400058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0385"
FT                   /product="putative transcriptional acitvator, Baf"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25355"
FT                   /db_xref="GOA:Q3AZX2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25355.1"
FT                   /translation="MWHSPASGGGGRTFGRRHLTLTPQHCKQVLLIGNSRWHWGERDAF
FT                   GMRFHHGLPDLARLDGELGGWAAVGAVPAQLMSAALERRITLSDVPLKGCPPWLGVDRA
FT                   IGAWAGWTRSLDLSLDLSSGLLLVDAGTVLSITVLSPDGEFVGGQLIPGYRLQLLAMTQ
FT                   GTEALPEMVFAAPGQERFPKDTVAAMRRGVLQSMVSLVQEAQRACGGRLWLCGGDAELL
FT                   ATELRSSSPQLQLDPELQLRGLFDLLDASG"
FT   gene            complement(400055..400522)
FT                   /locus_tag="Syncc9902_0386"
FT   CDS_pept        complement(400055..400522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0386"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25356"
FT                   /db_xref="GOA:Q3AZX1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25356.1"
FT                   /translation="MALQVGDPAPDFTLPNQDGESVQLSSLKGKRVILYFYPKDDTPGC
FT                   TKEACNFRDRWGRFEEHNIKVFGISKDNAASHTKFISKHSLPFTLLTDEEPCAVASLYN
FT                   SYGLKKFMGREYMGMMRHTVVIDAEGRIERLYLKVKAATMADTLLSDLGLD"
FT   gene            400685..401416
FT                   /locus_tag="Syncc9902_0387"
FT   CDS_pept        400685..401416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0387"
FT                   /product="possible protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25357"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25357.1"
FT                   /translation="MCSKSLTDQRLLAIFLLTASFLNDIPYLSSVFTRLAAGILAGASL
FT                   AALAAPAEAGTSRPVRWNTGGAVWTTTSSEFKTFFETGEVTDRALDAGINNSGWTAEEI
FT                   QEGMTKSYSVDIIGVSRFLNSDDGVKFLKDQTASYFPYWRMKKTAVVALRSAIIADSID
FT                   GEISSASIMAALPVDFRLADTCGTYTGAQNVCAPDKCEGDAQCTSLLSWYVFLPACVQA
FT                   NSQLPEAPVRTVAPAPARPLW"
FT   gene            complement(401466..403667)
FT                   /locus_tag="Syncc9902_0388"
FT   CDS_pept        complement(401466..403667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0388"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25358"
FT                   /db_xref="GOA:Q3AZW9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25358.1"
FT                   /translation="MVNQDLFAFHGEQQRRRLAPLADRMRPRTLEEFEGQQGILAEGRL
FT                   LQRAIKADRVGNLILHGPPGVGKTTLARIVANHTRAHFSNLNAVLAGVKDLRAEVDAAQ
FT                   QRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRS
FT                   RLFRLLPLEPKDLHQLLQRALTDQDRGYGERSVVLDTDAANHLVDVAGGDARSLLNALE
FT                   LAVESSEPTTDGTIAINLATAEESIQQRAVLYDKQGDAHYDTISAFIKSLRGSDADAAL
FT                   FWLARMVEAGENPRFIFRRMLIAAGEDIGLADPQAMVVVEACAAAFERVGLPEGLYPLA
FT                   QAALYLAGTEKSNSILGFFDALKSVRDANRQDVPPHLRDANRDGDAFGDGVGYRYPHAY
FT                   ADHWVEQQYLPTALQGEVFWQPGALGWEGQRRERMGARRAAQLAAAAELASDQPLLLSS
FT                   GPDSPGLERWIQRQLGQEGERLHQLRKRLWEGVSWQRHDRVLILGARSLIWALDPLQAV
FT                   PEGGVTMLCNSTDDRHRIEAQIQLLDPELRPQLLSGGLETLQANQAFEWIGGRFSTTDL
FT                   QQLNWTDLEHQIQNHSHGDTTLRLLTTRAEAGPAGALLQASSSDAELETLLQKEQLWLA
FT                   AQTQAHHVFEAEGWSGSQDSWLETLNLPWGPDLADRWLAEGSSYRVAMGTIDPTVLTLL
FT                   RQRLEGIGRSGLRLPMRHELFIGRRNASVNQRNASTEKA"
FT   gene            403855..404997
FT                   /locus_tag="Syncc9902_0389"
FT   CDS_pept        403855..404997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0389"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25359"
FT                   /db_xref="GOA:Q3AZW8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25359.1"
FT                   /translation="MRHPQRLIFSIAALITVGACKAEGPAAPPPPKVQAVSTRMAEFTE
FT                   GVDTVSTLEASNLVELAAQSAGRILELKIRQGDEVEPGQLLVVLDQAQLQAQLAEERAK
FT                   AETAKTNWERYEYLARVGASSQKQLDTYRTQYFSAMERVKATEANVSYSNLKSPSAGTV
FT                   ADVKAKVGDVLQQGQVFTSLVQNNELEARVEVPAVFASRLALGQPVLLSAPGKDAVIAT
FT                   GQVQSIDPRINSQTQGLLVKAVFANTDGTLRDGQRLRTRVQIEAKQDLSVPFAAVTQTS
FT                   GQSFVFRLGSLDELKANPGKADLDVLDKATKAGKLPPNAQFALQTPVVVGELENDLYPI
FT                   NKGLKPNQKVVTTNLLNLKHGMPVQVQPAAGASATPSQAN"
FT   gene            405007..408465
FT                   /locus_tag="Syncc9902_0390"
FT   CDS_pept        405007..408465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0390"
FT                   /product="Hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25360"
FT                   /db_xref="GOA:Q3AZW7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25360.1"
FT                   /translation="MSASNNFITRPVLSTVCSLLIVIVGLIAIPILPIENLPDIAPPTV
FT                   KVQSTYVGADAVAVEQGVTSVLEQQINGVEKMDYITSTSSSDGVSSISVSFDSGTDGNI
FT                   NQVNVQNRVSLAEPQLPEEVRKSGVTVNKASNSILLVYNFVNENPDQAQYSVETISGYL
FT                   DKNLTDNVKRVKGVGDVTYFGNRKIAFRLWLDPDKLAANNLSAIDIVNQLKSQNRLVPA
FT                   GKIGGSPAPEGQEFTFTVQLQGRLTTTQEFENIVLRSTGDGGLVRLKDVGRVELGGETY
FT                   GIDAMDINGTPSVGIAIYQLSGSNAIEVSNGVKDVLEEFEKTLPVGLGVQKIYDTTDFI
FT                   SQSIKGVTNSLRDAVILVVLILFLFLQNWKATLVPAIAIPVALIGTFALVLAFGFSLNQ
FT                   LTLFGLVLATGLVVDDAITVVEDTSAKKAEGMTSVQAAIETMDELFGAVIATSLVKMAV
FT                   FLPVLFFPGATGTIYKQFAATILFSIGISTFNALTFSPMLSALLLSRETKELTRHQYAI
FT                   AGVTLGFVYGLLSAGNGAIAALIPMAVGALVGFIASKITGLPLRLPVAAGGAAVGLMST
FT                   GVIVSSPIPVVLFTVIGFVVGGFVPVIFTNFNRFYSGFEKRYATVLDMVLKARPIVMAA
FT                   LGVGILLTGFAFTRIPGGFVPIEDQGYAIGFVQAPDGVSNEKTLAINRQVAEVMRSEED
FT                   ISSAALFSGASLDGNAPNKGLFFIGMKHWDERPGKDHSVAAIVKRLNQKMYGAIDAGRV
FT                   FVVEPPSIPGYGTGGGFEFQLLDQSSGVYSLNEFFGTAQQIMQAGNSNPILSRVYSLFS
FT                   PQAPQYKIDVDRDQMASVGVDFGTAMSAFSVNFGGAYVNDTFQEGKVRRVYVQANDVSR
FT                   ATPQKLSSIYVGNSKGEQVPLSEFFTVKQTVGPSVIPHFNLYRSIKVEGTPNAGNSSGQ
FT                   AIGAMKQIFNQGNFQGLGFDWTGISREEVKAGSLAVVIFALGILAVFLVLSAQYESYSD
FT                   PIIILLTVPTALLGALVFLGAAGQVLNIYAQVGLVMLIGLAGGNAILIVDLANQKMGEG
FT                   ESALEAAKFSAKSRLRPILMTAISSLTGFLPLMLASGAGAQSQSSLGLVVFGGLLVATF
FT                   LSTLVVPVFYVVMKSLLGQADAKPPEGGDGDGGQTVQVQSTPLPS"
FT   gene            408465..408755
FT                   /locus_tag="Syncc9902_0391"
FT   CDS_pept        408465..408755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25361"
FT                   /db_xref="GOA:Q3AZW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25361.1"
FT                   /translation="MPTSKSEFETRKPFSGSRALVALAIGCTLGAAVAYFLKVLIENTP
FT                   AEIDILRLRLFYLMVITSGGLGGFAIESMRQLQEDATDPMYRHQKAQRVKR"
FT   gene            complement(408822..410480)
FT                   /locus_tag="Syncc9902_0392"
FT   CDS_pept        complement(408822..410480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0392"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25362"
FT                   /db_xref="GOA:Q3AZW5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25362.1"
FT                   /translation="MTSSTPAEPTQRQVRLDKPFTDQKPGTSGLRKSSKQFEQPNYLES
FT                   FIEAALRTLPGTDGGTLIVGGDGRYGNVRAIDVILRMAAAHGLGKVIVTTGGILSTPAA
FT                   SHLIRSKNAIGGIILSASHNPGGPDGDFGVKVNGANGGPTPASYTDAVFECTKTLSHYS
FT                   IVDATPVSLDGPMQHSIGAMSVEVIDGVDDFVALMQQLFNFDEIKALLRNNFPLAFDAM
FT                   HAVTGPYATRILEGLLDAPAGSVRNGVPLEDFGKGHPDPNLTYAHDLAELLLQGDGYRF
FT                   GAACDGDGDRNMILGHHCFVNPSDSLAVLTANATLAPAYAKGLAGVARSMPTSAAVDVV
FT                   AKELGINCYETPTGWKFFGNLLDAGQITLCGEESFGTGSDHVREKDGLWAVLFWLQILA
FT                   KRQCSVAEIMADHWKRFGRHYYSRHDYEAVDSKAAHGLYDRLEAMLPSLKGQPFAGGTI
FT                   RDADNFSYTDPIDNSVTQGQGLRILLEDGSRVVIRLSGTGTKGATIRVYLESYVANNGD
FT                   LNQDPQVALGEMIRAINALAEIEERTGMKQPTVIT"
FT   gene            410590..410943
FT                   /locus_tag="Syncc9902_0393"
FT   CDS_pept        410590..410943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25363"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25363.1"
FT                   /translation="MSRSLLMLLLGCVVAGSAVQASSQSWKRVIPFEQASSDAATAANA
FT                   VLKQAGTEECLRGKLSNAIVQLSNSCDVAGLSSSVCLMASSIAGEENELSMGEMMTTSK
FT                   QLLLMLEPSTTTP"
FT   gene            complement(411080..411454)
FT                   /locus_tag="Syncc9902_0394"
FT   CDS_pept        complement(411080..411454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25364"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25364.1"
FT                   /translation="MNVMIPTRTLLLLALAAPLPAASTYVPWPSQDTFSTLQKEAFLCS
FT                   LNNSTDPCDRTRKRADELMDHPRLPAICKDVLWSLVGEARVAATNSFRRRDAIDQPARR
FT                   LMRVCSEPVKPTKKKAPTRT"
FT   gene            complement(411827..412564)
FT                   /locus_tag="Syncc9902_0395"
FT   CDS_pept        complement(411827..412564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25365"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25365.1"
FT                   /translation="MSRHSVRRLTALKELTSSSRYLEVGVSQGHTFNHVDFPKKHAVDP
FT                   NFRFETKDHERKGISFFQQTSDDYFTKVVDIPDFDLIFLDGLHAYEQTYRDFVNAILHS
FT                   HEKTIFLIDDTRPSDVYSAMRNQNFAVTTRRTLTTSDSRDWHGDVFKILFLLKLFHVKY
FT                   EYATVCEDNPQTIVWSKSLTSGQSREKNPKPFKTFKDMRYLRSCFENLGSIDYHWTMNE
FT                   CSDIFQVAKEDDLLTYLKKSISR"
FT   gene            complement(413012..414430)
FT                   /locus_tag="Syncc9902_0396"
FT   CDS_pept        complement(413012..414430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0396"
FT                   /product="Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25366"
FT                   /db_xref="GOA:Q3AZW1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25366.1"
FT                   /translation="MVCLEDVLKLSPLLLGLVVFCGCSQRGELVGAASVDQLDVPDQIA
FT                   VGFNHHQRNRYQSPLSGEWRDGDDIEQMLVQAIELAQHEILVAVQELSTPTIAEALIAA
FT                   QHRGVTVQVILENNYSTPWTEQTPSQLKSHQRQRWHQLEQLADQNRDGTTTPEEAKRGD
FT                   AIGLLRDHHIPIIDDTEDGSRGSGLMHHKFVVIDRTIVLTGSANFTSSGIHGDANRPRT
FT                   RGNVNHILRFQSDALAALFRQEFGTMWGDGPGGKQNSRFGLQKESTGVSTVMVGESRVD
FT                   VLFTPHRKHNPKHGLNWVEKQLDEAGKSIDMALFVFTAQQLADALQRRVNAGVQIRLIA
FT                   DPSFASRSFSEVLDLLGVALPDRNCKLEQDNQPFNKGHKGVGTPRLARGDKLHHKFAVI
FT                   DNKIVLTGSFNWSPSAAHTNDETLLVIHSDLLAKHFTREMDRLWDTAELGITPHIQRKL
FT                   DRQRIRCGDGVERG"
FT   gene            complement(414466..414675)
FT                   /locus_tag="Syncc9902_0397"
FT   CDS_pept        complement(414466..414675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25367"
FT                   /db_xref="GOA:Q3AZW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25367.1"
FT                   /translation="MVLNNSSDPKAPSGLRWFVALTPLAGAMIFPILVPIVMTRVGIGA
FT                   GVGVALALSSLWFIAMLKTSEMPH"
FT   gene            complement(414666..415757)
FT                   /locus_tag="Syncc9902_0398"
FT   CDS_pept        complement(414666..415757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25368"
FT                   /db_xref="GOA:Q3AZV9"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25368.1"
FT                   /translation="MSPTISSLARLTLRQLRQIASDLGVPLYSRKSKETLVDEVAVRQE
FT                   KRGGDLKAIEAELNAPAISTTETRVVFLPRDPQWAYVFWEISDSDRQRAQKEGANRLCL
FT                   RLADVTGMQDGNAHPHTLQEVPVDSHSTEWYLPVPLCDRDYRVELGYRIASSWMSLAYS
FT                   SIARVPALHPSEQILDQFVPFSLDASPAPAPSAAPMPTAPANETSDSGLHERLYQSATV
FT                   HFRRRRVGSEEFQEAFHDASDSSRSGLNDSGIGLWASGRNESGLGGVASRQRSFWLVAD
FT                   AELIVYGATDPSARLTIGGEEVPLSSDGTFRIQVPFRDGEQLYPIEATAADGDQKRNIT
FT                   LNFERQTPDDNSNPASEARAEWF"
FT   gene            complement(415927..416715)
FT                   /locus_tag="Syncc9902_0399"
FT   CDS_pept        complement(415927..416715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0399"
FT                   /product="phycobilisome rod-core linker polypeptide cpcG"
FT                   /note="L-RC 28.5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25369"
FT                   /db_xref="GOA:Q3AZV8"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25369.1"
FT                   /translation="MDVEARVAIPLLEYAPITQNSLRTGVPNIRVGSDEGSRAYSFAIA
FT                   DDRDNLDTVIESAYRQIYFHAFKSDRDANLESQLKDGQITVRDFIRGLLLSDTFKRSFY
FT                   GFNSNYKVVRHLTERILGRKVNGKGEELSWSIVIATKGLVGLVDVLLDSTEYLDAFGYD
FT                   TVPFQRNRVLPGRALGDTPFNITSPRYDEYYRGILGFPQVVFMGGPGKALPARAKIKRG
FT                   GSPSDYLDWLKDMPIPNTRGNVSSTEMDYMAKVPFRSIGR"
FT   gene            complement(416805..417401)
FT                   /locus_tag="Syncc9902_0400"
FT   CDS_pept        complement(416805..417401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25370"
FT                   /db_xref="GOA:Q3AZV7"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25370.1"
FT                   /translation="MTLEISDALNFFRLSCGRWKSQRSQHHLLHRRAEAGASFIVVEEL
FT                   LKGDERLAEIAIRNGEDVSKIIGGCWVRWSGSMAWDRAGESHEDQTMFGLIPSDDAGRQ
FT                   GLLLRDRGYAEKAPVAGQFRMDDENGLILTTDYEMMSSLERFWFAGPNLRLRTSTVQGL
FT                   SNNASFCMETRQLDDELPKTSRVATTATQLAPFGW"
FT   gene            complement(417447..417782)
FT                   /locus_tag="Syncc9902_0401"
FT   CDS_pept        complement(417447..417782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25371"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25371.1"
FT                   /translation="MNIDAETIARIDATLLPQLDRHHLRLLAHCLASFRMMAPDLDGAL
FT                   PNAALRRQWCEQQPVVADDPQFLTLLLDQLNNAAQQLEEVADTCSKAPLALSLDDLIAA
FT                   AERRCRS"
FT   gene            complement(417779..418423)
FT                   /locus_tag="Syncc9902_0402"
FT   CDS_pept        complement(417779..418423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0402"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25372"
FT                   /db_xref="GOA:Q3AZV5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014075"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25372.1"
FT                   /translation="MSASAQPSTRDAVLSLLLERGEMDAGDLAETQQISVQAMRRHLRA
FT                   LADEGLVASITCTSGPGRPSNRWFLTEGGRERFPDGSGGFALGLLDSLRSSLSEEAFQQ
FT                   LLQRQAEGKAQQYRLQLGDAPLEDRLHQLAGLRREEGYVTVCSLDEDGHSWNLQEAHCS
FT                   VQRIAEEFPTICDQELLLIRRTVPDCRVERVHWRLEGGHTCGFRITPIETA"
FT   gene            418563..418919
FT                   /locus_tag="Syncc9902_0403"
FT   CDS_pept        418563..418919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0403"
FT                   /product="ferredoxin thioredoxin reductase, catalytic beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25373"
FT                   /db_xref="GOA:Q3AZV4"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="InterPro:IPR024707"
FT                   /db_xref="InterPro:IPR036644"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25373.1"
FT                   /translation="MSDTAQEPTAESLEVIRKFAETYAKRTGTYFCSEPSVTSVVLKGL
FT                   ARHKDDLGGALCPCRHYEDKEAEVSQAFWNCPCVPMRERKECHCMLFLTEDNAFACPEK
FT                   TQTITTETIQATAG"
FT   gene            418925..420364
FT                   /locus_tag="Syncc9902_0404"
FT   CDS_pept        418925..420364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0404"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25374"
FT                   /db_xref="GOA:Q3AZV3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25374.1"
FT                   /translation="MTSTSTRDLVSQPYKYGFVTEIETDKIDKGLSEEVVRLISSKKDE
FT                   PEFLLNFRLKAFRHWLTLEEPDWAALGYEPIDYQDIIYYAAPKQQAKKSSLDEVDPKLL
FT                   ETFDKLGIPLSEQKRLSNVAVDAVFDSVSIATTYKEKLAEHGVVFCSFTEAVKDHPELI
FT                   EKYLGSVVASNDNYFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTL
FT                   IVAEEGASVSYLEGCTAPMFDTNQLHAAVVELVVLDDASIKYSTVQNWYAGDENGVGGI
FT                   YNFVTKRGQCRGARSRISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNCQQAD
FT                   TGTKMIHVGPRTRSTIVSKGISAGRSSNSYRGLVQMSPGAKGARNYSQCDSMLIGDQAA
FT                   ANTYPYIRSQQPQAAIEHEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQL
FT                   PMEFAAEADKLLALKLEGSVG"
FT   gene            420410..421198
FT                   /locus_tag="Syncc9902_0405"
FT   CDS_pept        420410..421198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0405"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25375"
FT                   /db_xref="GOA:Q3AZV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25375.1"
FT                   /translation="MIRPDAELLLDITDLHASVEDQPILKGVNLQVRSGEIHAVMGRNG
FT                   SGKSTLSKVLAGHPAYRVTSGTVRYRGENLFELEAEERARLGVFLGFQYPVEIPGVSNL
FT                   EFLRVATNARRLKQNLEELDTFDFEDHVHERLKVVQMDPAFLERSVNEGFSGGEKKRNE
FT                   ILQMALLEPVVAILDETDSGLDIDALRIVAGGVNQLANADNATLLITHYQRLLDEITPD
FT                   YVHVMAAGRILRTGGRELALELEQIGYDWVDKELAAQGVA"
FT   gene            421201..422394
FT                   /locus_tag="Syncc9902_0406"
FT   CDS_pept        421201..422394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0406"
FT                   /product="ABC transporter, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25376"
FT                   /db_xref="GOA:Q3AZV1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25376.1"
FT                   /translation="MAAVSTGEHVLAPVQQRGQAALGRLGLPTRKQEAWRLTNLSRLEA
FT                   VARMPVNGVATASDAPPCLDGVVRLVLDGVNDPLEGVTLPEGLTHLEPKELELALGHTL
FT                   DRCGSSDDWLVEFNHASAQQLLALRVRGTVPPLEITMAAASGLIPTRVLLVVEEKAQLE
FT                   LLQVFSGRGEAAHSHLMEVHLGQEAQFNHGVLACADGVAALFAQLAVEQEPRSTYNFTS
FT                   VIQGWSLGRIEPRVVQVDGQASTTLKGLAVADLEQQLAVHTSVCFEGPDGELDQLQKCL
FT                   AAGRSHTIFNGAINVPRKAQRTNAAQLSRNLLLSDRARVDTKPELEIVADDVRCAHGAT
FT                   VSQLQEDELFYLRSRGIGASDAAALLLRGACQEVVDRLPTHALAWRPLERVLAGLAS"
FT   gene            422391..423677
FT                   /locus_tag="Syncc9902_0407"
FT   CDS_pept        422391..423677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0407"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25377"
FT                   /db_xref="GOA:Q3AZV0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25377.1"
FT                   /translation="MTTLNPLIARSSANSGNLSSRFRADFPILAQKTPDDRPLIYLDHA
FT                   ATSQKPQQVIDAMQRYYSCDNANVHRGAHQLSARATESFESARTTAAGFVGAHSPREIV
FT                   FTRNASEAINLVARSWGDSTLHEGDEVLLTVMEHHSNLVPWQLLAQRTGCVLRHVGITD
FT                   DGRLDLEDFQEKLSERTRLVSLVHISNTLGCCNPLESVIPAAHAVGALVLVDACQSLAH
FT                   QSIDVVALEADFLVGSSHKLCGPTGMGFLWARETLLEAMPPFLGGGEMIQDVFLDHSTW
FT                   AVLPHKFEAGTPAIGEAVGMGAALHYLQEIGLDAIQAWEAQLTQHLFARLQAIDGLRIL
FT                   GPTPEQQPGRGALATFLVEGVHANDIAALIDASGICIRSGHHCCQPLHRLYGVSASARA
FT                   SLSFTSTMEEIDAFAEELSSTVSFLREHS"
FT   gene            complement(423674..425593)
FT                   /locus_tag="Syncc9902_0408"
FT   CDS_pept        complement(423674..425593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0408"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25378"
FT                   /db_xref="GOA:Q3AZU9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25378.1"
FT                   /translation="MGPTPLSAQTAVGRLPGLKEPKLVQGPGNILWLIWLEQRPQEKGR
FT                   TTAIMRRFGEPTSPQIELTPAPINLRSRVHDYGGGVLATATDDHHLHLVWIDAGCLWQQ
FT                   RLCWGEAGPGTNVPEAETPPQRLTCPGPWELADGLLNLQHNQWIGIREQQGKDQLVSVN
FT                   LQRTDQEPELLHQPADFAGYASLNPKGDRLAWVEWTQPSMPWDSSSLWCAELTKTGQLI
FT                   RPTQRAGGPDISVFQPQWLPNGRLLVAEDSSGWWNLMLEDPATESWERPWPMAAETAMP
FT                   QWIYGMSTTAWDGERLLAATCSDGTWTLQRLGLDGTVLKLEQPFDDLAGLRACNGRAVA
FT                   VASNSRCGAGLLELDLRPNTPAWIHTPAVPLPLPDREISVAQPLWFEGHQQQRTHAWYY
FT                   PPIGAGDGPAPLLVKSHSGPTAMARRGLSLAIQYWTSRGWGVVDVNYGGSTGFGRAYRE
FT                   RLNHGWGVVDVADCAAAAQALIASGHSHPDQVAIEGGSAGGFTTLAALCFTDVFRAGAC
FT                   RYAVCDLTAMATDTHRFEARYLDNLVGAWPEERSTYNERSPLQHAGRIRCPVLFFQGLQ
FT                   DKVVPAEQTEQMAAALRHNGITVDVRLFEDEGHGFRNQATQITVLEETEAFFRLHLGLG
FT                   TNSC"
FT   gene            425643..426248
FT                   /locus_tag="Syncc9902_0409"
FT   CDS_pept        425643..426248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0409"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25379"
FT                   /db_xref="GOA:Q3AZU8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25379.1"
FT                   /translation="MAGSFAQLARAADKARDTMLVPKTALETPPLEIHTLGADALRQPA
FT                   QRIGKVNDQVRELARDMLRSMYTAKGIGLAAPQVAVYQQLLVIDLDLENAATPPLVLIN
FT                   PEITAASAGLDTYEEGCLSIPGVYLDVVRPTAIELSYRDEMGRPRKMKADGLMARCIQH
FT                   EMDHLNGVLFVDRVTDQAGLQKELKENGFQSKHVQSVS"
FT   gene            426252..426449
FT                   /locus_tag="Syncc9902_0410"
FT   CDS_pept        426252..426449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25380"
FT                   /db_xref="GOA:Q3AZU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25380.1"
FT                   /translation="MPMKPLAGLFLALACILGIASTGCVFELAYGDPDLGVSTTSWILA
FT                   VAAPATVGTLLVAIRLNKPA"
FT   gene            426471..427061
FT                   /locus_tag="Syncc9902_0411"
FT   CDS_pept        426471..427061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25381"
FT                   /db_xref="InterPro:IPR022222"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25381.1"
FT                   /translation="MTFTIPVTQLSAVIPRFLPTAAGLAVALTGTVPVMAQGSLFTAVP
FT                   VEEANFILVSAPIGQGERSQLNIYEQRTNKRPCFAVSAGMPAAVDPLLSSFDFTGVCNR
FT                   YIDGNGYSLRLGGDDLGTRYRFTVVKTGSDIELLAAPTRNPSAPVYLVAKAGGVASGFV
FT                   QLNLQPGWTLMRRAYGTKTLGHLYVYRDTAPAE"
FT   gene            complement(427034..428605)
FT                   /locus_tag="Syncc9902_0412"
FT   CDS_pept        complement(427034..428605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0412"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25382"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25382.1"
FT                   /translation="MLARCLSASLHGLEAKPVTVEVDLAPGLPGIQLVGLADKAIQESR
FT                   ERVRSALRNSGFRGPLVRVVINLAPADRRKEGPAFDLPIALGLLVASGQLDRPKLDGLW
FT                   CAGELGLDGSLHPCRGVIAFADLARQKGARALIVSPGNAPEAALIPNLTIWTANNLKEL
FT                   VQQLKGECPVVRVEHNPSPQPAIPAAMTLKPLGLGIEGIDRAAHALALAAAGGHHLLMV
FT                   GPPGCGKTHLARQLPLLLPPLTTSESLTITRIHSVAGEFDTSEPLLHQRPFRCAHHSCS
FT                   GAALLGGGHTPKPGEISLAHGGVLFLDELAEFPRRVLDLLRQPLEDGNVRLSRSRETTV
FT                   FPAAVTLVAATNPCPCGWHGDSDQVCRCTSAQRQRYWQRLSGPLLDRIDLQLRLERRSS
FT                   RQMRSYLEATPSPQTHSPWLEPSRVKAARVRMRTRNPRGCSNRFLTTADLRRYGQFKAD
FT                   GLTLWERVIEQRRLTTRSSLQLLRVARTIADLNGQETVQAEAIADASGYRCTDLMGDHS
FT                   AGAVSR"
FT   gene            428696..429037
FT                   /locus_tag="Syncc9902_0413"
FT   CDS_pept        428696..429037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0413"
FT                   /product="HIT (histidine triad) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25383"
FT                   /db_xref="GOA:Q3AZU4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25383.1"
FT                   /translation="MADDTIFGKILRGEIPCDEVYSDELCLAFRDVAPQAPTHVLVIPR
FT                   QPIESLRSAGDSDEVLLGHLLLVAARVAKQEGLNDWRTVINSGAGAGQTVFHLHVHVIG
FT                   GRPLAWPPG"
FT   gene            429062..431068
FT                   /locus_tag="Syncc9902_0414"
FT   CDS_pept        429062..431068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0414"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25384"
FT                   /db_xref="GOA:Q3AZU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25384.1"
FT                   /translation="MTTPSRRPLQGFGQQLGRLQRLAQPYFLPVEESRSWQFLLLVVAL
FT                   LVVVVGVTLLLLTAAVQISGALIPNLQERFLPGIPERVDAIWSGWIGPLVSGFTLVGGG
FT                   CFVAFRSKLRQGRWLPWLLLGVIALLILVINGINVGISFIARNIENALVGYDESSFWKI
FT                   VAIYAFCLVLALPIRAIQSYLIPKVGLMWRRWLSSRLLGRYLSNRAYYVLNPNDENASD
FT                   IDNPDQRISDDTRSFTITSLSVLVEVISALLTFLSFIIVLWTINGRLALLLLVYSVVGT
FT                   GLIVFASRKLVSLNYQQLKLEADFRYGLVHIRDNAESIAFYGGEGQEGKEANRRLDGAI
FT                   QNYNRLIVWEALISVIQRSYDYFSRFLPWLVIAPIYFAKEVDFGVFGQASIAFSQVLFS
FT                   VSYIVNNIDRLAAFSASISRLEGFQGRVDEISAQRDDGPQTTGSAAQITESNRLLLKGV
FT                   DLVPPFSDRVLIQDLNLSLEPRQRLLVVGPSGCGKTSFLRLVSGLWPVQGDGQIQRPAT
FT                   GDLLFIPQKPYMLLGSLREQLAYPLESDRFADDQFRAVLAEACLPDLLNRYPDLDVKQD
FT                   WPRLLSLGEQQRLAFARLLLNAPQMVVLDEATSALDVATERHLYELLCRREMSFISVGH
FT                   RPTLTEFHDTVLELDGKGGWRLLPAAGYEFGRV"
FT   gene            430170..430246
FT                   /gene="tRNA-Met1"
FT                   /locus_tag="Syncc9902_R0003"
FT   tRNA            430170..430246
FT                   /gene="tRNA-Met1"
FT                   /locus_tag="Syncc9902_R0003"
FT                   /product="tRNA-Met"
FT   gene            431077..431286
FT                   /locus_tag="Syncc9902_0415"
FT   CDS_pept        431077..431286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0415"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25385"
FT                   /db_xref="GOA:Q3AZU2"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25385.1"
FT                   /translation="MTSETTSAADASQEQARSATATTTDAPAFGWSSYAERVNGRFAMV
FT                   GFVAVVLVEVLSGDTFLSWAGLLP"
FT   gene            complement(431287..431727)
FT                   /locus_tag="Syncc9902_0416"
FT   CDS_pept        complement(431287..431727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25386"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25386.1"
FT                   /translation="MAGCSGERPRPRPELNGLLRQSVSSRRDPSLAQVWLASLGTRGGR
FT                   ERIELIDLRTRRPVPLPGLNRADSQPISLSVSGDGGRIAVVQQREDRTELFLYRRNAAA
FT                   LQRLPLDPPGVPRSVSLDGSGRLLAVQVSRNGRWDVDLIRLP"
FT   gene            complement(431763..432260)
FT                   /locus_tag="Syncc9902_0417"
FT   CDS_pept        complement(431763..432260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25387"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25387.1"
FT                   /translation="MGLVGCSGRVDRASGGLLAKSQQDPALSGNGQWLAVISDLRGRQT
FT                   VQLRNVSNGSIQALPQLKRHQPHSSPSLSWNGRYLALITQQGRRRMAVIADRLNGRLHP
FT                   IQLPGGRDPIQVSLSPDAQTMALQVTDQGLWRVEIFDLSDVLEIDRPAGQALSTPPLSP
FT                   TP"
FT   gene            complement(432299..433321)
FT                   /locus_tag="Syncc9902_0418"
FT   CDS_pept        complement(432299..433321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25388"
FT                   /db_xref="GOA:Q3AZT9"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25388.1"
FT                   /translation="MVNASLNWASIVGIVLAVGGALLYFMRTFKPALARDYDVFFAAIG
FT                   LLCGGILFFQGWRLDPILQFGQFLLAGTTVFFAYESVRLRGVATEQARRSAYFDDEPAA
FT                   PRGESGSGGLRGGWDEDYDRFDEPQTVQRRFGGRNTGTEDRPEDDFYRPRRTSRAAIPE
FT                   EAASRRGRGRDQDTQGWDQPDERSRRMARFRAGEARDERRPNFGERRSDREEQRRGSRP
FT                   TGRQERPTGSPVRPEAEDAAFSTSRSGRTTASASAPQSKSPFPNSGRERGGEATSRPMS
FT                   SRPRSNNPSANAPTSQFQSNAESGRSAPRSSRPRDNSQRDSSARDNSPRARDNSSRFDD
FT                   "
FT   gene            complement(433371..433493)
FT                   /locus_tag="Syncc9902_0419"
FT   CDS_pept        complement(433371..433493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0419"
FT                   /product="photosystem II PsbX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25389"
FT                   /db_xref="GOA:Q3AZT8"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023431"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25389.1"
FT                   /translation="MTSSLSNFLSSLVWGAVIIVVPATIALILVSQTDRLDRKL"
FT   gene            433573..433905
FT                   /locus_tag="Syncc9902_0420"
FT   CDS_pept        433573..433905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0420"
FT                   /product="YGGT family, conserved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25390"
FT                   /db_xref="GOA:Q3AZT7"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25390.1"
FT                   /translation="MRFVTPLLLQALPIIHVLLGVLLAAWTLAFLLRIVLTWYPQVDMT
FT                   KGAWPLIAWPTEPVLGLTRKVVAPIGGVDVTPVIWVGLISLFRELLVGQQGVLSQILLR
FT                   SAQAVA"
FT   gene            complement(433902..435248)
FT                   /locus_tag="Syncc9902_0421"
FT   CDS_pept        complement(433902..435248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0421"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25391"
FT                   /db_xref="GOA:Q3AZT6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25391.1"
FT                   /translation="MPIGKVLIANRGEIALRILRSCRELGIATVAVYSSVDKDALHVQL
FT                   ADEAVCVGEAQSNKSYLNVPNILAAATSRGADAIHPGYGFLAENDKFAEMCNEHGLTFV
FT                   GPSPHAIRSMGDKSTAKTTMQKVGVPTVPGSEGLLSNPQEAAQLAAEMGYPVMIKATAG
FT                   GGGRGMRLVPSPDQLESLYKAAQGEAEAAFGNPGLYMEKFIDRPRHVEVQVLADRHGNV
FT                   VHLGERDCSIQRRHQKLLEEAPSPALDPELRRKMGEAAIAAARSINYEGAGTVEFLLDR
FT                   SGGFYFMEMNTRIQVEHPVTEMVTGVDLIAEQLRIAGGEPISIRQDEIQLNGHAIECRI
FT                   NAEDARHNFRPAPGRITGWLPPGGPGVRVDSHVYTGYDIPPFYDSLIGKVIVWGKDRQH
FT                   AMTRMKRALNECAVTGIPTTVEFHLEMLDRPEFINGDIHTKFVEQEMLP"
FT   gene            435471..436742
FT                   /locus_tag="Syncc9902_0422"
FT   CDS_pept        435471..436742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25392"
FT                   /db_xref="GOA:Q3AZT5"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25392.1"
FT                   /translation="MASPQNADPGLAIVLVSNGPGELSTWVRPLAERLHSLQPLRPRVP
FT                   SSPASLQLVLVPCPNATGQEHRAAQPWQLFDRIVPARSFWSLLLRPQRFGLWPQKGIVV
FT                   FLGGDQFWTVLLSARLGYRHITYAEWVARWPQWNDSIAAMSDAVRRQLPVRYQGRCRVV
FT                   GDLMADLSSFARREAPLSDGEWVALLPGSKAAKLSVGMPFFLETADLIAQERPECRFLL
FT                   PLAPTTSVEELLLFAGPTNPIAARYRSAVVDVDHDVLITKAGTRIQLIQEHPAHGPLSQ
FT                   CDLALTTVGANTAELGALAVPMIVMVPTQHLDKMQAWDGGFGLLARIPGLRRLLGALLT
FT                   FWRLRNNGFVAWPNITAGRGVVPERIGEITPQQIATEAIEWLSSPERLEGQRDDLQALR
FT                   GEPGAVMALAAEVRDLLPRTLPSA"
FT   gene            436769..437170
FT                   /locus_tag="Syncc9902_0423"
FT   CDS_pept        436769..437170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0423"
FT                   /product="Methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25393"
FT                   /db_xref="GOA:Q3AZT4"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25393.1"
FT                   /translation="MPSLDRIDRSTDEWKQSLSPEQYQVARCGGTERAFTGKYWDNKAT
FT                   GVYHCVCCGTPLFSSTTKFESGTGWPSFWDGISPEAITTKQDVTHGMVRTEITCSRCDG
FT                   HLGHVFSDGPAPTGQRYCVNSASLDFKAA"
FT   gene            complement(437280..438362)
FT                   /locus_tag="Syncc9902_0424"
FT   CDS_pept        complement(437280..438362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25394"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25394.1"
FT                   /translation="MTPTPSANDTLTGVPSDRLWLRSELMGTQVITRDSGRRLGVVGEV
FT                   IVDIDRREVVAVGLRDNPLTRFLPGLPRWMPLDRIRQVGDVILVDSADSLSEGFNPERY
FT                   SRVINCQVITESGDQLGRVLGFAFDIETGELSTLVMGALGVPLLGEGVLSTWEMPVEEI
FT                   VSSGPDRIIVYEGAEDKLKQLNSGVLEKLGVGGPSWEEQERERYRVNLVPVENQLSSGQ
FT                   PVEQQQRQLQASEAQRFEAEEEMEYVELEDQRRDAQPQRRYLEEQPTDSFESPRYDNGR
FT                   YRDEPRFNAASNDEPNFEEPRFTESRLTEPRIQEQSFDDSSLNDEPAPRRAMPASRRPV
FT                   QKISEPLDVEPIQDDLDDPW"
FT   gene            complement(438438..442052)
FT                   /locus_tag="Syncc9902_0425"
FT   CDS_pept        complement(438438..442052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0425"
FT                   /product="condensin subunit Smc"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25395"
FT                   /db_xref="GOA:Q3AZT2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25395.1"
FT                   /translation="MVYINQVGLKHFKSFGGAMTIPLEEGFTVVTGPNGSGKSNILDGV
FT                   LFCLGLANSRGMRADRLPDLINSGVLKTGKAAETSVSVRFDLNDWAPDTAEDGLEAPAE
FT                   GPWIQPGQKEWTVTRKLRVMPGGSYSSSYSADGVPCNLQQLQTQLRRLRIDPEGSNVVM
FT                   QGDVTRIVSMSNRDRRGLIDELAGVALFDTRIEQTRRKLDDVQERQDRCRIIEQELLAS
FT                   RQRLEKDCAKARQYQDLRERLKLGRQQEMVLAFEAAEQALKDLSTRQQALEAQEQRDGV
FT                   AIANGREALSKASAELQILQDQVKALGEDQLLAVQAELAGLDTSSRELERQASQHQEEG
FT                   QRLQGLRHDLTVRRQEWQHQSKTQEKDPHQDALAAAEDTCRASESAVEVSRRRLADVAG
FT                   RSGAWLDEQKRRSARRQELQSSVNPKLEEQQQLQERLRQESERLQELHLEQQQDGADEQ
FT                   DVQQQLTTLEESWQTLIHGLSEGKQALQQTVDSLAIQQRTRSRLEQEQTRLEREIARLE
FT                   SRRDALQESRGTGALRLLLEAGLDGIHGPVAQLGEVQDQHRLALEVAAGARLSQVVVDD
FT                   DRIAARAIELLKSRRAGRLTFLPLNKIRAPGGGSGSTAAAFARGARPSGDTGGGLIGRA
FT                   VELVRFEPVYDQVFAYVFGDTLVFADLATARQQLGRSRAVTLDGELLEKSGAMTGGSLS
FT                   QRSGGLSFGRSQDQDEAEPHRRRLLEIGESLAACRREESKLTQLLEQQKPQLREMEQRQ
FT                   AGLIAERNAAQRNHGPLLERNRQRAERLLRLQNEQTTQRQRLEVIDAALKPLQAELAQL
FT                   NEAERNSGDHDDAAAWQQLQHDLEAADHRLEAARHERDLLLNAQRERQLALERLGDQEK
FT                   ALAAEETRLQEAVQALAKAHGAWRDQQSELQNKRTSLEAQQQDLQERFGTQRRARDAAE
FT                   AEVARQRQALQQAEWNLERLKEDREGLIEEQRSGAIRLREMAEALPDPRPEIPESMRLE
FT                   GLEVLQGELQAIQRRMEALEPVNMLALEELQALEQRLGDLNERLDVLNSEREELLLRIE
FT                   TVATLRQDAFMEAFTAVDGHFREIFASLSEGDGHLQLENADEPLEGGLTLVAHPKGKTV
FT                   RRLASMSGGEKSLTALSFLFALQRFRPSPFYALDEVDSFLDGVNVERLAALIARQAKDA
FT                   QFMVVSHRRPMIGASERTIGVTQARGAHTQVVGLPDAA"
FT   gene            complement(442103..442462)
FT                   /locus_tag="Syncc9902_0426"
FT   CDS_pept        complement(442103..442462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25396"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25396.1"
FT                   /translation="MPRYALLRHTGAPDDPSGCHFDLLLEDGASCRTWRLADIPILNAA
FT                   EQDAIPLPAHRLIWLEPRSAAVSGGRGWAERIRAGRYQGSLPSVANEPLEITLMNGDLS
FT                   GQLKIVQGRCRLSKP"
FT   gene            442525..442947
FT                   /locus_tag="Syncc9902_0427"
FT   CDS_pept        442525..442947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25397"
FT                   /db_xref="GOA:Q3AZT0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25397.1"
FT                   /translation="MDSTTPQPNGNFEHHFRDRFESLLPTIQRRWPELAHHTLEATRGS
FT                   VEELVRLIERNTGLTPQGAREQLEELMHSAGDRSKHLADTLDPLEEQLEQLLDELNSTL
FT                   RPRIERPVRQRPLLAVGVALGVGVLVGAMLRGGRHS"
FT   gene            442947..443333
FT                   /locus_tag="Syncc9902_0428"
FT   CDS_pept        442947..443333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25398"
FT                   /db_xref="GOA:Q3AZS9"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25398.1"
FT                   /translation="MAESQSPRGFGAAGRVTALAASVMDLHVRIALQEVDREKRRLISG
FT                   GLFLAMGGTAMLLALLAGEGALLLWIQQRWSLDLSQALIALAVGNLLFAGISLRIGGQV
FT                   LKGPFLPQTLEGVMKTVRALIGRA"
FT   gene            complement(443341..444483)
FT                   /locus_tag="Syncc9902_0429"
FT   CDS_pept        complement(443341..444483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0429"
FT                   /product="putative RNA methylase family UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25399"
FT                   /db_xref="GOA:Q3AZS8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25399.1"
FT                   /translation="MGRENRLSAVAVLPQGLEAAGCDELSKLGAHDVQPLRRAAEFQAD
FT                   MACLYRLHLQARLPFRLLREMASFPCQGRDDLYDGVRRALNWERWLHPSMSFRVDVTGS
FT                   APGLNHSHYSALQVKNALVDQQRDIWGQRSSIDLEAPDLSLHLHLNRETAVLSLDGSGG
FT                   SLHRRGYRAAMGIAPLKENLAAGLIQLSGWDGSVPLVDPCCGSGILLIEAALMALQQAP
FT                   GLGRNFGLEGWADFQSELWQEECERAQQRRRRNLNLPPLLGIEQDPLVAEQARVNIAAA
FT                   GLEGVIEIRDGSFTEHHLPEGPGVLVCNPPYGQRIGEEEELDHLYSALGGFVREQASGW
FT                   QLWLLSGNPKLTGGLRMKASRRIPVSNGGIDCRWLHYAIR"
FT   gene            444980..445855
FT                   /locus_tag="Syncc9902_0430"
FT   CDS_pept        444980..445855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0430"
FT                   /product="Site-specific recombinase XerD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25400"
FT                   /db_xref="GOA:Q3AZS7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25400.1"
FT                   /translation="MLLRRFLGQCSRTNSQETRDGYMRDLRHLTRWRDRHYPDLLIREL
FT                   DPPMVQNWIDDLRGQVDAGEIKPRTFNRRLSVVSALFRWASEPSRSGVTGIGRNPVPGK
FT                   SHLVGGKEGKAMSEDDLSKLLGVVASSRDRSARNNRDFVLIRGSYLLGARVSEVARLQW
FT                   CDVEPLADGGQIHLLGKGSKARTVRVSADTLQLFESLGRAGESDYLFPSSRTKSHLTRQ
FT                   AINYTMRKWGEKAGVDVHPHKLRHSHATHAIRRGTNVFCLQHTLGHSSTDTTSGYVKQN
FT                   PDDSSSLALG"
FT   gene            446346..446711
FT                   /locus_tag="Syncc9902_0431"
FT   CDS_pept        446346..446711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25401.1"
FT                   /translation="MARATAAETSDRIDALQGMILAGTPNTECLAFARKEWGISRARGY
FT                   ELMKRAWIQIKDDVDETGIDRLELLAWSIQTLMAAAGQAKQQKNPGAVVACIKQLDWMT
FT                   GLGINSTAGQRGQRGHR"
FT   gene            446858..447487
FT                   /locus_tag="Syncc9902_0432"
FT   CDS_pept        446858..447487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25402"
FT                   /db_xref="InterPro:IPR016878"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25402.1"
FT                   /translation="MLLVTQLLMFKASAFLATTGLLLCSIPGTPSLAKPQIMQETITVG
FT                   DVKAAQDGWCNAVTALSKTYAESGFEASKRLASEVVDSAYGYQFGPVSFKPTWAYGETT
FT                   FRPTKEGAVSYFVGGNPKYRDPGFTIASPGDGNYPNLQNRSQWVKCTPEIVTIQVFGNT
FT                   ATAMGWVRFEAADGYQSKVDKTFGYVRDDSGNLRIVVHHSSTPYKW"
FT   gene            447547..447717
FT                   /locus_tag="Syncc9902_0433"
FT   CDS_pept        447547..447717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25403"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25403.1"
FT                   /translation="MGCFGGPYLIQTLMSAAGQAKQQKNPGAVVACIKQLDWMTGLGTN
FT                   SVSGSSSQRRR"
FT   gene            complement(452046..452795)
FT                   /locus_tag="Syncc9902_0436"
FT   CDS_pept        complement(452046..452795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0436"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25404"
FT                   /db_xref="GOA:Q3AZS3"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25404.1"
FT                   /translation="MSKSLLGITVLAVGGIVILSSVFVVPAGKVGVVTTLGKVSKTPRL
FT                   PGLNLKLPFIQSSHLFSVRTKVVPEKFSTLTKDLQVIEATATVKFAVKPDEAPRIYNTI
FT                   ASNDDSIYGRVIQPSLLKSLKSVFSKYELNTIATDWNTISTLVEKSVAKELNKFDYVAV
FT                   KGLDLTGLKIAEEYRSAIEQKQIAEQQLLRAKTEVKIAEQEALKFETLNRGLNNQVLYK
FT                   LFLDKWDGTTKVVPGIQGGTPPVIVGN"
FT   gene            complement(452900..453238)
FT                   /locus_tag="Syncc9902_0437"
FT   CDS_pept        complement(452900..453238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25405"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25405.1"
FT                   /translation="MRQWPYGRSASIASAFPFWEQRSELVSHMGHTGSIQRTPMKHLLL
FT                   ITLVLGAHSLLDTTKADAAYVSEKVFNETFDKAHAKCANVDLNFLNEFRWCLNRELEEI
FT                   YIDSREIH"
FT   gene            complement(453593..453877)
FT                   /locus_tag="Syncc9902_0438"
FT   CDS_pept        complement(453593..453877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25406"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25406.1"
FT                   /translation="MPAIFNGTVLAFSDDIVMVDGNPYFPHASMATDFFRESDLTTVCG
FT                   WKGTARYWNVVVGDQEISNAVWAYDTPKPDAESIRERFAFYRGKGVELR"
FT   gene            454702..455325
FT                   /locus_tag="Syncc9902_0439"
FT   CDS_pept        454702..455325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0439"
FT                   /product="plastoquinol terminal oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25407"
FT                   /db_xref="GOA:Q3AZS0"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25407.1"
FT                   /translation="METQTRKAEVAHKIIETGEGLLNIFWYEADERRAASLEIIARTAY
FT                   TAEESACHYLETIGLDRQGRIRETLELARYQDTNEQTHEDIFARDLNGLKNWGDRFLAR
FT                   HIAVIIYWVFAITTLIDHELAALLGEAVEVEAVKTYRRMLVEQSDEWLNQPAVPTALRY
FT                   WNKPNSMWRVRGDQQPHSMREVVEAIVKDESDHVHANAQKAIAF"
FT   gene            complement(455585..456139)
FT                   /locus_tag="Syncc9902_0440"
FT   CDS_pept        complement(455585..456139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25408"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25408.1"
FT                   /translation="MRLNSNGIEDDRFLTSLDVQEQNGVIESCLTYKRTGQQRSMNFET
FT                   VPFTMQVSAAGAWSLGPSSVTPFGWVGELSVVSGEERRRIVARYGHHGVDQVVYIIETK
FT                   GGGEAIPPSQPIQCEAVPCGNWLIWMPEPGVEVLLDARDRQMNDCTACGLRWLDANGQQ
FT                   QQIMRRYDNTGQLESLSDLWP"
FT   gene            456889..457137
FT                   /locus_tag="Syncc9902_0441"
FT   CDS_pept        456889..457137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25409.1"
FT                   /translation="MSSFGGIDFCLSFAAEIASFACSNKLACLKDVNLLTESDMDIVDR
FT                   LTDLINFNLNSSLYDRCDSGVENIFVDNHKNNYELFQ"
FT   gene            458163..458444
FT                   /locus_tag="Syncc9902_0442"
FT   CDS_pept        458163..458444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25410"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25410.1"
FT                   /translation="MIRLIDEAPIRPENSNYFLVMTNHHLSVEQRFHLEAAFREIDACD
FT                   DIEKLRSLTKQIITAQENDKAFAREAMVQVRKEMEAAASQRFGFNWGQ"
FT   gene            459039..459416
FT                   /locus_tag="Syncc9902_0443"
FT   CDS_pept        459039..459416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25411"
FT                   /db_xref="InterPro:IPR022224"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25411.1"
FT                   /translation="MIADHYWCVVLRGCKAKPHHTFDRWEVWQHPYQNDSSWGYLHKNL
FT                   LPPYQGVGSGPSRLVRQWLDKEALFIAGRIESSPSNYPLIQQYAYWPGPNSNTFAQWVV
FT                   RDQMTLGSRAIGRGFPVPNSG"
FT   gene            461014..461910
FT                   /locus_tag="Syncc9902_0444"
FT   CDS_pept        461014..461910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25412"
FT                   /db_xref="GOA:Q3AZR5"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25412.1"
FT                   /translation="MISSQSIITKFGGERTTGHPAKFDRKSPIKVASTSAEFLQASCEK
FT                   MSLPMGPRLHEECETKVPRGELADSSTEACQKAIEAAYAHVYGNAHLMDYERSVELESQ
FT                   LLNGEIAIKDFVKGIAKSEFYQRNFYTNCSPMRTIELDFKHLLGRVPYSQSEISSLIAL
FT                   QAESGHGAVIDAMVDSAEYLETFGKHTVPYMRSWKSSAGAPQVTFNRTAAMSLGYAYSD
FT                   KAIGAASQLNQSFSSQPNNIIVFPNGSDLEYMEMSMAWSGGRPPKIATKIATVLTIAGL
FT                   IEVTRVVAIVAFSAVAS"
FT   gene            462216..462461
FT                   /locus_tag="Syncc9902_0445"
FT   CDS_pept        462216..462461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25413"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25413.1"
FT                   /translation="MMHSQKLDSTKYSKDDFQMIEEIKLPCSELPIQQTQDGKFLVCLS
FT                   EGVCLEFLGLWEAQDHLRSLELCGLTIKRWTTEPSW"
FT   gene            462487..462759
FT                   /locus_tag="Syncc9902_0446"
FT   CDS_pept        462487..462759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25414"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25414.1"
FT                   /translation="MSYAVIKVVSLHEEGILGVTMVIGDLRPSYFPFDMFHLRMQRTRK
FT                   RMEWLVLTVENESSHRFSIHRVKLHRNFCSTFICSNQIDPVTADD"
FT   gene            462952..463425
FT                   /locus_tag="Syncc9902_0447"
FT   CDS_pept        462952..463425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0447"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25415"
FT                   /db_xref="GOA:Q3AZR2"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25415.1"
FT                   /translation="MLKSKIAIGLFILVVCPLQLEASTLLRVIDGDSVIARIHGKQTKI
FT                   RLACIDAPEIGQSPYGRIARNTLIGLLPSHSIIKVQPINYDKYGRLVANIFTIGGINIG
FT                   EELIRLGLVFVYQANESHCDGPKLLLIEDQARQSRIGIWKDAPQGITRPWLYR"
FT   gene            complement(464789..466165)
FT                   /locus_tag="Syncc9902_0448"
FT   CDS_pept        complement(464789..466165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0448"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25416"
FT                   /db_xref="GOA:Q3AZR1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25416.1"
FT                   /translation="MGVVSAKDHSPIISNLKNDNNNTLTFEQLELCAETVRSIKESGYL
FT                   SPTPIQALTIPEVLQGKDIMASAQTGTGKTAAFILPIIELLRAEDKPKRYQVHSLVLTP
FT                   TRELAAQVEASAKAYTKYLALRSDAVFGGVSIRPQVKRLQGGVDILVATPGRLLDLINQ
FT                   KMIRFDNLKVLVLDEADRMLDMGFIRDIKKVIEYLPKNRQNMMFSATFSTPIKKLALGL
FT                   LNDPVEIKASVQNQAAPTIEHLVHPCDMARKVDLLCHLIKTNKWKQVLVFARTKHGADK
FT                   VVKILCHQHMRASAIHGNKSQGARTRALEGFKNGDIKILVATDIAARGIDIHQLPYVIN
FT                   LDLPNVAEDYVHRIGRTGRAGEAGHAISLVAAEEALLLKAIEKFIGNPLPKVDVVGFEQ
FT                   KILKAEPLKQGGQRQRRPSQSARPGQKAKTNHASSQQRRSDWRKSSNRSTQGERRTRQR
FT                   "
FT   gene            466949..467221
FT                   /locus_tag="Syncc9902_0449"
FT   CDS_pept        466949..467221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25417"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25417.1"
FT                   /translation="MWKQSEDPSKAADPQDGEGWLVNEQQGLVCEFSADAPSAQAPWVT
FT                   IRTFRWRKPDYPIPQARRRMLRDSAVMEWKTMQAAGWRRCLPPVR"
FT   gene            complement(467875..468243)
FT                   /locus_tag="Syncc9902_0450"
FT   CDS_pept        complement(467875..468243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25418.1"
FT                   /translation="MISAWSTEIRLIAENYKDNGRDAQGEVSITKSFCSGSLLFQHFPS
FT                   HISCTTKKNKGQNSLDEAEGNPNHKDPNTKANTSFFDHCLTLISHGGPLGERHAEDKQR
FT                   DHCPILSNLRVKSQSLQH"
FT   gene            468224..468394
FT                   /locus_tag="Syncc9902_0451"
FT   CDS_pept        468224..468394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25419"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25419.1"
FT                   /translation="MDQAEINNWARIAVDLEVAGEIDSVLYERARAIALGQVGPRPNYP
FT                   LVLSDELPLAA"
FT   gene            complement(468391..468534)
FT                   /locus_tag="Syncc9902_0452"
FT   CDS_pept        complement(468391..468534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25420"
FT                   /db_xref="GOA:Q3AZQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25420.1"
FT                   /translation="MGKAKKLSTETNDQLITSLIGLAAIFVSCAIWWSIAPQWLTSTWQ
FT                   TF"
FT   gene            468861..469139
FT                   /locus_tag="Syncc9902_0453"
FT   CDS_pept        468861..469139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25421"
FT                   /db_xref="GOA:Q3AZQ6"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25421.1"
FT                   /translation="MSLWPSGRGDPMLSFLFPIVFAAVFVFLLVQAFRMMTLGFNMNGA
FT                   ASVSRRQDRTGLLTTHPELLDQNGDITSEDLLVVKFPEIGESEAAPA"
FT   gene            469244..469534
FT                   /locus_tag="Syncc9902_0454"
FT   CDS_pept        469244..469534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25422"
FT                   /db_xref="InterPro:IPR019882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25422.1"
FT                   /translation="MLQCSSFIHHFLILAFLTENLQPAIIDRVIEMAWEDRTSFEAIHY
FT                   QFGLSEKEVIELMRKEMQSSSFRMWRKRVSGRKTKHAATNPSYRFRAHCHK"
FT   gene            complement(469635..470486)
FT                   /locus_tag="Syncc9902_0455"
FT   CDS_pept        complement(469635..470486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0455"
FT                   /product="putative sulfotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25423"
FT                   /db_xref="GOA:Q3AZQ4"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25423.1"
FT                   /translation="MFSIAETEGWISDLRCYRAIKSSIDGRHDHIAKAYQQQWPNFIII
FT                   GSAKSATTTLATVLGKHPEIQISASMEPKFFGRNYRRGWEWYGQQFPGGEHYLLRGEAS
FT                   TMYTSSYRSYQHTPQLIRHHLGIIPLIYLVRHPLKRIESHWRHWRGRINNCPPFHQLLK
FT                   SKVLKQRVVEGSLYYKQLMRYRQWFPAESVHCLSTEELTAHPIKSLNDVLTFLGQPANA
FT                   SSLLFKGSLPLTNPAGSKGRRNVEPPQWTAELKKRTIELIQPDSEEFLKTIHWPKNTWQ
FT                   WD"
FT   gene            complement(470470..471246)
FT                   /locus_tag="Syncc9902_0456"
FT   CDS_pept        complement(470470..471246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25424"
FT                   /db_xref="GOA:Q3AZQ3"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25424.1"
FT                   /translation="MAQPHHFIRMKQCKLLYGRVPKAANSSIKAALCRLLSERPPKGTK
FT                   TTSDKFWQHETNNETELITLRKARKYRRSHFSFSFVRNPFDRLIAAYNNKVIEIEEPPL
FT                   PMQHMGIHHDMSFESFLDVLIDTPIHRYDVHVLPQSHLLCLGRQVIPKFIGRVEQIDEH
FT                   WSILRDILLRQGIDVMESLPQKNVRRSEKSGLQKYFHNDALIDKVLRLYGDDVNLFYND
FT                   TSIDNLINNSPLPHITPLQSRSLKLSSWLRTYVFDS"
FT   gene            complement(471250..472164)
FT                   /locus_tag="Syncc9902_0457"
FT   CDS_pept        complement(471250..472164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25425.1"
FT                   /translation="MSQLKPKQIILHCGLHKTGSTYLQRNFKNKRETLLSHGILYLGPT
FT                   TFKKQFRYLWKHLQWEKSKKEPSQKLTDSTLKALIQEAGPAPERIHTIFISFEAIFGTL
FT                   RAGLIQKNRKKNSNRENKLGLYRYSKRRIKRLMRWLECTLGTEEIDWTICFASRQRVDF
FT                   IRSCHIQLIKEGHEITNLSNEEFMQTSNFSYADPSKLIDELSSLKKNKKINILPFSYDH
FT                   NSDRSDPTIYLNNFINLVLPEQAEQIRSTLISETNSKNLHKDINPGISERGIEIARQAR
FT                   PLFTKQEWKLFRRFLEKNFIKSI"
FT   gene            complement(472161..474449)
FT                   /locus_tag="Syncc9902_0458"
FT   CDS_pept        complement(472161..474449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0458"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25426"
FT                   /db_xref="GOA:Q3AZQ1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25426.1"
FT                   /translation="MKGILIERNFTQFVVFAEDSILSALSKITANQSRLIFVVSESGIL
FT                   QGVLTDGDFRRWIATCGEIDLNRPVTAAMNPSCRSASEGSSTAELGALLNSRIIALPLL
FT                   DSHGRIVAVARLGTGALQLGKHPIGAEHPCFVIAEIGNNHNGDINTALQLIDAAHAAGA
FT                   DCAKFQMRDMGQLYSNSGKSSDMASDLGTQYTLDLLERFQLSDDELFHCFDYSASKGLV
FT                   PLCTPWDQTSLQKLNQWGMEGFKVASADFTNHALITQLAATGKPLICSTGMASELEIRS
FT                   GIRHLQKAGANYVLLHCNSTYPTPFKDVNLRYLERLRELADAPVGYSGHERGIEIPLAA
FT                   AALGAVVIEKHITLDRGMEGNDHKVSLLPDEFSQMILGIRRVEESMGQGGERSISQGEM
FT                   MNREVLAKSLVASCDIDAGTTITEAMVRIQSPGQGLQPNRLHELVGQKLPISKKKGDIF
FT                   FPSDLEEQAATPRAFNFVQPFGLPVRYHDISTFSEVSNLDLVEIHLSYKDLEVDLDIVI
FT                   PEKQPMGLVIHAPELFAGDHTLDLSTADDNYRNHSIQELQRVIDISKDLRKRFKCDEPV
FT                   LLVTNVGGFSEHHHLDDQEKRPLRDRLIQSLNKISTNNEVEIIPQTMPPFPWHFGGQRY
FT                   HNLFVDADFIRAFHNDTGMRVCLDVSHSKLACTHLDASFSVFLKKILPFTAHLHLADAQ
FT                   GVDGEGLQIKEGEIDWIELFNLINIYCPKASFIPEIWQGHKNRGEGAWLALERLEHYSS
FT                   ASKNSVSVA"
FT   gene            complement(474490..475791)
FT                   /locus_tag="Syncc9902_0459"
FT   CDS_pept        complement(474490..475791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25427.1"
FT                   /translation="MNRPLKILLIADSDSQLLACEALCRCQTARPVEFTINVIPRDGTP
FT                   QHILQRMGHLGALWRQNLARLLNNPKLLQFDAVGVFLTGSKLNDIRIALERHQQRPKLF
FT                   CGFNGVVLEHFVEGISWRLGYDLICLSGPRDRDALNQLVAKTPFAHQQTVLTGLQRNGT
FT                   IKALSPAGQRPKRLVFAEQVVMPSSSRDRAEMVKILAELATRSPNWEVLIKPRITPGDA
FT                   TFHDVDTHIGTTLSQTLGVPPVNLKLDYRPLPDLLRKAPLMATISSTAFFDALDFGCRP
FT                   IAMNDLGLHASHGSHVFAGSGVWRSLRDVPNLDELEQELPEPNPEWLDWMGYGERYGAG
FT                   DLFEALENLKPASTTGITHCGYPTNTQSSFNQLRVGAEAAICTGDWRGAADLLTQAAQM
FT                   RPQHRGVARRVAAVSCRNPLLRRIGLILSYRDLG"
FT   gene            complement(475788..476711)
FT                   /locus_tag="Syncc9902_0460"
FT   CDS_pept        complement(475788..476711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25428"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25428.1"
FT                   /translation="MADHQPLPHRSCDLTINPKELLGNTVLENASAIGLFLRNPADIEA
FT                   IAAGYRALRRSRGLWTAPIFSGPLMPLAGDELIDAFLRRLSCDLMIVSGDDQLRQLEAM
FT                   TSLWPAELKKPRLIATGFWFPAIPPTPPSPKPMLVALLQREIPTHLGAKEQLIRLLQRW
FT                   AREQTDWTVVLQPDHPWSSARSFAENQINNPTNVVDAAPEQMLGLLSRCTACLSVSSPW
FT                   SLAAMMWGRIPIVVGDYGIQAEQHTTNFFGCGAMHRLRDLGGLHKLQELPLVNQDWLEA
FT                   IGGGIQDGPLRLLISLDSISSGSTAP"
FT   gene            complement(476820..478124)
FT                   /locus_tag="Syncc9902_0461"
FT   CDS_pept        complement(476820..478124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25429.1"
FT                   /translation="MAPVAPKRLEGRKVAAVTCFDSFGKLAMTLLAACRREGAETTLHL
FT                   LELNNRALSRRQRLEIRRIDPRTPIEKHNWSDLHNLCSPMAGDVDALILGLDGQRSRDA
FT                   LLQLHGAWGHSTTRPRLISAYPGILFRFALEGMLDRSGADLLCLNSQQDLSTYQKGCAA
FT                   LGLDSSNAVVTGLPILWRTHPRAEFPENPSIVFFEQPSIPVHPLQRRFVCEQLRDLSAA
FT                   WPNHPVIFKPRTSSIESTLHRRHGEMASVIDTMSHQQTNLKLSFKPATQLLRKCGCAIT
FT                   VSSTAALESMAMGISTRIVGDLGVTETLGNHFFADSGAIANFAAIRDNPFEVLHNNRWL
FT                   QAQGWNPEGDSRFIEALASRLQIAPTPLSNSDLGPTSWGSEAWQRTALSNGGRRMLSSG
FT                   GARSSQRKRHHTRRIIRTVRDSVVGFGWLSKLLRK"
FT   gene            complement(478028..478113)
FT                   /gene="tRNA-Leu5"
FT                   /locus_tag="Syncc9902_R0042"
FT   tRNA            complement(478028..478113)
FT                   /gene="tRNA-Leu5"
FT                   /locus_tag="Syncc9902_R0042"
FT                   /product="tRNA-Leu"
FT   gene            complement(478152..478844)
FT                   /locus_tag="Syncc9902_0462"
FT   CDS_pept        complement(478152..478844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0462"
FT                   /product="putative acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25430"
FT                   /db_xref="GOA:Q3AZP7"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25430.1"
FT                   /translation="MAAHAAALALIPARGGSKGIPGKNLQEVGGLPLVVRSIHAAQASD
FT                   RVTRVVVSTDDEAIAELSRDAGADVVQRPQSIAGDSASSESALLHALDALACPSQSPNG
FT                   LQANLVFLQCTSPFTTGAEIDKVLAALDQPEINSSFAVAPWHGFLWRADGKGINHDPNA
FT                   PRQRRQDLNPSYLETGAIYAMRTANFRALGQRFCPPWQPVVLADPGPEIDTPNDLALCR
FT                   SLASGLSG"
FT   gene            478877..480874
FT                   /locus_tag="Syncc9902_0463"
FT   CDS_pept        478877..480874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0463"
FT                   /product="possible polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25431"
FT                   /db_xref="GOA:Q3AZP6"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25431.1"
FT                   /translation="MTRLVAARLGVPARGMLVHQTLPCLLAPAQLLPGRRRDVDALLAW
FT                   GRRPSARRVERLGQHWGLPVWHIEDGFLRSFGKGRADPPLALLIDDLGVHFDATAPSRL
FT                   EHLIATPLSLEQRCRAQQVQALWCEQRLSKVNPAQESPVPEERFVLVVDQSAGDYSIPL
FT                   GGASPDCFGQMLQEALADHPACTVVLKVHPDVIHGRARGHFSAKDLVHPRIRVSADGLH
FT                   PAGLLQRAEAVYAVTSQMGFEALLWGRPVHCFGMPFYAGWGLTHDRLAAPDRRQQGVSL
FT                   EALVHGALIAYPHCIDPHQHEPCSIETLMRAIGLQRRMHALAPRSVQAFGFTPWKQRNL
FT                   RRFLAGSEVRYPMPWMTPDTNIDAVAVWGRRGKPRVLSAADRRRLPTLHVEDGFLRSVG
FT                   LGADLIDPISWVVDGRGMYYDATGPSDLEILLAHGDWSVLQLERAAQLRHRLVRAAITK
FT                   YNLQSTPWQRPTGIQRVVLVVGQVESDASIRFGAPGVCTNLGLLQAVRAAEPEAYLVYK
FT                   PHPDVSAGLCRAGEGEEIAQECCDEVLTSGSIDQLFTQVDALHVLTSLAGFEGILRGVE
FT                   VHCWGLPFYAGWGLTRDRETCSRRGRCLELDALLHAALIEYPRYVSRGSGWFITPEQAI
FT                   DELIAWKDGPPPRRTLVQGLFRHWGRLRRR"
FT   gene            480918..482936
FT                   /locus_tag="Syncc9902_0464"
FT   CDS_pept        480918..482936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0464"
FT                   /product="capsule polysaccharide protein KpsS-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25432"
FT                   /db_xref="GOA:Q3AZP5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25432.1"
FT                   /translation="MGRGRAPALVQVRIDGPVLLLMGPIGLFFARFCNYLRGCGIPVTK
FT                   VAFPLREFGFSSEVTVPFRGDMEAWRPFVRRLLQDRGIRHIFMYGDFIIPHRIAIEEAQ
FT                   SLGIEAWVFELGYLRPNYITLERDRVNARSNLNKPVSFYQNLLPVDQLPQNIVLDPGSR
FT                   WRKAWKAPTFIQHAFTDYPIIEGEHKLQPSPRFLWCQVRGSWRYWLYRWTEREVKRRLL
FT                   EHESFFLSVLQVSSDSQIQMGSPYRGMHDFIEDVIRSFSEHAHASDRLAFKHHPRDRGY
FT                   NHYGLLIALLSRRYGVVGRVHYFHDGPLSRYLRTCRGVITVNSTVGLQALFHAVPTKTM
FT                   GNTFYNLEGLTDQKPLDDFWRDPQPSDRPLFYRFYNHLVMSTQVNGNFDGDFPFRTTFP
FT                   IGPEARQLESPSPLPALKAPLIRNPLALGARMVSRMAWAGLGFGLYGLQLPAVLLGRPD
FT                   WAAQLMTLASAVALRALGVQVVVDDSQPSENPGTPLVHIFNHRSPCDGLVIQAVLKIPG
FT                   LTTAQLHLKWVLPGYAAAARNAGSAVLDHRQPQSRLAGLMSASTLLRDHGEIMIAPNGS
FT                   LVTPIEERVSSSAWMLAQHYGGSIVPWVFRYEGLDGAVGARYKPLRLLLRRLTAPLGTI
FT                   HCRRGRSSDLQLPPDPRDRDGFSRAVQQYYRAQQESG"
FT   gene            complement(482887..484158)
FT                   /locus_tag="Syncc9902_0465"
FT   CDS_pept        complement(482887..484158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0465"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25433"
FT                   /db_xref="GOA:Q3AZP4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25433.1"
FT                   /translation="MPKTPERSAIVGWGSVTPLGSNPHTTWQGALGGRSGIQALHDPWS
FT                   SDLATRIAGRVEDAAFTPLEPILRRRADRCAQLALLAARQAWGMALERAPGLDPDRVAV
FT                   VIGTGIGGLSTMHEQHMQLSEGGPSRVNPLTVPMLIPDAPAGQVAIDLGLHGGAHAPVS
FT                   ACASGAEAMMLAQMLLNDDRADLVLAGGTEAPVNRLGLVGFSAMRALSSRNDAPEQASR
FT                   PYSTDRDGFVLSEGAGVLAMMRDCDVPTGAALGWQLASGSSSDGHHIVAPEPQGIQASR
FT                   AIDDALRRADVDPADLCAVQAHATGTNLGDLAEARALRRSLGPVADFLPVYAPKGQLGH
FT                   LLGAAGSVEAILGFQALREGILPQSINADPLDPGVDLAVTTSGPVKLPDHPSERFMLKN
FT                   AFGFGGHNISLILAVPCSTAARLD"
FT   gene            complement(484142..484423)
FT                   /locus_tag="Syncc9902_0466"
FT   CDS_pept        complement(484142..484423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0466"
FT                   /product="possible acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25434"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25434.1"
FT                   /translation="MAEVLPDKHALEGRLVEILHRISGADPALITADARLMEDIGIDSL
FT                   GFYEILIEADTCFGIRIPEETLLQFRTVGDIQAHLESLELTQANAENT"
FT   gene            complement(484471..485412)
FT                   /locus_tag="Syncc9902_0467"
FT   CDS_pept        complement(484471..485412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25435"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25435.1"
FT                   /translation="MALTGSATQDDVLLPRGWNGSDPDSSRLFTLDGLELHLIAGSQFG
FT                   PVAEAVGTLRESTYRQQLSGSGSSLDLDGRDPFYDHLLLLDVESGALAGSARLQFIPFG
FT                   APSSDLPQSEASYLEHVYPGIKALLAQRQHHVEIGRVALAQRFQRQPHSLMALFRGGLL
FT                   IASLSGYSTLHGLVSYNHFAFSDSVNNAFLSALMQPPYRRTDLALPVPRHPVPSIQSSD
FT                   QTHPIDNVQALELALRNDYDKDFRLPVLLRQYFNLMGAQVCDLSLAKDFNQITEILMAA
FT                   ELNSLPKERLNYFIDVPHQPVYQHFSWYRGQG"
FT   gene            485487..486650
FT                   /locus_tag="Syncc9902_0468"
FT   CDS_pept        485487..486650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0468"
FT                   /product="polysaccharide export outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25436"
FT                   /db_xref="GOA:Q3AZP1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25436.1"
FT                   /translation="MLFILRSGLSAGIAAVWMLTLSLTWSGSVRAEERRNWLKVPSRPA
FT                   PTALPKTRSVSVSPFPETSYRYRLGPGDKLVMSVFKIDGYEASVQVLSDGTINLPRLGT
FT                   MDVWGLTMDEARQRITDGYQQILRRPIVYLDLVEQRPVRVTVTGQVGRPGVFTLPVNSP
FT                   GSIPKDGELGSGGGWPTMVDVIQRAGGVSAMGDLSRLELLRPSHQRGASAKRYVFDYLT
FT                   VLKQGGFAPNPLIYDGDSIRVLKADAPINADLITTASSNFAPSTIAVKVIGEVVLPGLV
FT                   EIPSNAPLSQAILASGGLSNRASVSRVDLIRMDGEGRTTIKQMSYKPGSELSSTNNPPL
FT                   RSGDVVVVDRNVLAKFSDGMNLALEPLDPIVDAASVLRILGLPGVGN"
FT   gene            complement(486647..487942)
FT                   /locus_tag="Syncc9902_0469"
FT   CDS_pept        complement(486647..487942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0469"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25437"
FT                   /db_xref="GOA:Q3AZP0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25437.1"
FT                   /translation="MIERYTLPEMGAIWSEQAKFQSWLDVEIAATEANCRLGRVPEEAL
FT                   ETIKNKASFSVKRILEIEAEVRHDVIAFLTNVNEHVGDAGRHIHVGMTSSDVLDTGLAL
FT                   QMKRSVVLLRIELDALADALRTLARAHKSTEMIGRSHAIHGEPITFGFKVAGWLAETER
FT                   NRSRLERLEADVAVGQISGAMGTYANTDPQVEAISCDILGLTPDTASTQVISRDRHADY
FT                   VQTLALVAASLERFSTEIRNLQRTDVLEVEENFAKGQKGSSAMPHKRNPIRSERISGLA
FT                   RVIRSYTIAALENVTLWHERDISHSSTERMMLPDCSVTLHFMLREMTAVVQGLGVYPDN
FT                   MRRNMNVYGGVVFSQRVLLALVSTGMSREEAYRLVQRNAHTAWNTEGGDFRANLENDAD
FT                   VKAHLSGDGLAACFSTDVHQDNLNVIWQRLGI"
FT   gene            complement(488166..488504)
FT                   /locus_tag="Syncc9902_0470"
FT   CDS_pept        complement(488166..488504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0470"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="GlnB; GlnK"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25438"
FT                   /db_xref="GOA:Q3AZN9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25438.1"
FT                   /translation="MKKVEAIIRPFKLEDVKVALVEAGIIGMTVSEVRGFGRQKGQVER
FT                   YRGSEFTVEFLQKLKIEVVVESNRVDEVVTAIADAARTGEIGDGKIFISSVESVVRIRT
FT                   GDRDGTAL"
FT   gene            488624..489037
FT                   /locus_tag="Syncc9902_0471"
FT   CDS_pept        488624..489037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25439"
FT                   /db_xref="GOA:Q3AZN8"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25439.1"
FT                   /translation="MTGAASQQQTETPLYGERAIDEAELICFDNPRPGRAYEVSIELPE
FT                   FTCKCPFSGYPDFAVLRLIYQPGPRVVELKAIKLYVNSYRDRSISHEEVSNRIVDDLVA
FT                   ACDPVWLQLEADFNPRGNVHTVVRVSHGTRQPC"
FT   gene            complement(489025..490305)
FT                   /locus_tag="Syncc9902_0472"
FT   CDS_pept        complement(489025..490305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0472"
FT                   /product="putative C-type cytochrome biogenesis protein
FT                   Ccs1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25440"
FT                   /db_xref="GOA:Q3AZN7"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="InterPro:IPR023494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25440.1"
FT                   /translation="MKRLIAWLSDLRVAIVLLFLIALASAVGTAIPQGDAPRSYVEAYA
FT                   TRPWLGLLNGEQVLQLQLDHVYSSVWFLSLLAWLGLALILCSWRRQWPALQAARRWIDY
FT                   SNPRQLSKLAIAESLPCTDSNSALQAFSTVLSQQGWRLERKDNRLAARKGTAGRVGPLL
FT                   VHTGLILLMLGAVWGVLAGNRLERFLAPGRTLDLLSRDGDSQVSILLEAFQVDRDPAGR
FT                   AEQFRSQLHLEENGNSLDREISVNHPLRHRGITIYQADWSLAAITLQIGRSPQLQLALR
FT                   SFPELGEQVWGLVLPTRPDGSEPVFLSVENEQGPINIFDTDGTLLTLLRPGGPAVDVKG
FT                   LPMRVNSVLPASGLLLKRDPGVPLVYLGFAVMLIGGGLSLIATRQLWAIASEGQLHVGG
FT                   LCNRNLTAFSKELPSLLRQTALAHQQG"
FT   gene            complement(490305..491009)
FT                   /locus_tag="Syncc9902_0473"
FT   CDS_pept        complement(490305..491009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0473"
FT                   /product="putative c-type cytochrome biogenesis protein
FT                   CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25441"
FT                   /db_xref="GOA:Q3AZN6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25441.1"
FT                   /translation="MLLSEMAQRSEALLSSALANPGPLTIALVFGGGALTSLGPCSLSL
FT                   LPVTLAYLAGFEDGRTPWQRSLAFCCGIVGALVVLGSLSGLLGKIYGQMPALVPSLVAI
FT                   LAVAMGLNLLGLLRIPLPAGPDPNSWRNKVPAPFAPVAAGLAFGVAASPCTTPVVAVLL
FT                   GWIAQSGRPLVGVALLTSFGIGQVLPLLVAGTFAASVPNLLKLRPIGRWVPPISGVVLL
FT                   TTGLLTLLARWS"
FT   gene            complement(491113..492330)
FT                   /locus_tag="Syncc9902_0474"
FT   CDS_pept        complement(491113..492330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0474"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25442"
FT                   /db_xref="GOA:Q3AZN5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25442.1"
FT                   /translation="MLNASASRRRSVSRQRVKQEQVGLFQRLMPLPWQLWPAEARLLVG
FT                   LAAFWSVAGLVVLASASWWVALREMGDGAFYVKRQTIWLLASWSLLGLTVSIDLRRLLK
FT                   WAGPGLWMGCILIAATLVMGTTVNGASRWLVVGPLQIQPSELVKPFVVLQAANLFAPWT
FT                   RMNIDQKLLWLASFGGLLLLILKQPNLSTAALMGLTLWMVALAAGLRWRSLLGTAFAGG
FT                   ALGTASILINEYQRLRVVSFLDPWNDPMGDGYQLVQSLLAIGSGGVMGQGYGLSTQKLQ
FT                   YLPIQSTDFIYAVFAEEFGFVGSLMLLLFLMLVAWVGLRVALRCRSNQARLVAIGCCTI
FT                   LVGQSILNIAVASGAMPTTGLPLPMISYGGNSLMSSLVIMGLLIRCSLESTELIGRRSN
FT                   GPLRTI"
FT   gene            complement(492448..492648)
FT                   /locus_tag="Syncc9902_0475"
FT   CDS_pept        complement(492448..492648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25443.1"
FT                   /translation="MSNHPLQLAQVVPLLRPGTFVTLENQPADLPPFQVLHCRGGRCWV
FT                   RQQAWGRHIQWEVEHGRLNAA"
FT   gene            492703..493548
FT                   /locus_tag="Syncc9902_0476"
FT   CDS_pept        492703..493548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0476"
FT                   /product="Hemolysin A"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25444"
FT                   /db_xref="GOA:Q3AZN3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25444.1"
FT                   /translation="MSCFLWDRVCFYDGMASKQRLDLELVARGLVASRQQAQQLIRAGK
FT                   VRDGAGTVLDKPGHDVKDTLQLQVEHPPRFVSRGGEKLLAGLAAFPISVQERICLDGGI
FT                   STGGFTDCLLQHGAKRVYGVDVGYGQTAWSLRTDDRVVLRERTNLRHLQPEALYGEADP
FT                   WPTLAVTDVSFISLRLILPALRRLLHGSDAEALVLVKPQFEVGRDRVGRGGVVRDPVAH
FT                   CDAIEMVITAAEELDWFAQGIVASPITGPAGNHEYVLWLGANRTAPEYDLQRLVKSTLQ
FT                   "
FT   gene            complement(493637..493837)
FT                   /locus_tag="Syncc9902_0477"
FT   CDS_pept        complement(493637..493837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0477"
FT                   /product="linker polypeptide, allophycocyanin-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25445"
FT                   /db_xref="GOA:Q3AZN2"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR011064"
FT                   /db_xref="InterPro:IPR011134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25445.1"
FT                   /translation="MRLFKVTACIPSPEKVRAQRELQNTFFTKWVPYDSWFAEQQRIQK
FT                   QGGRIIKVELCTGGRQVNVGN"
FT   gene            complement(493843..494331)
FT                   /locus_tag="Syncc9902_0478"
FT   CDS_pept        complement(493843..494331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0478"
FT                   /product="Allophycocyanin, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25446"
FT                   /db_xref="GOA:Q3AZN1"
FT                   /db_xref="InterPro:IPR006245"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25446.1"
FT                   /translation="MQDAITNVINKSDVQGLYLDTASMTNLESYFASGELRVRAAATIS
FT                   ANASAIIRDAVAKALLYSDITRPGGNMYTTRRYAACIRDLDYYLRYSTYAMLAGDTSIL
FT                   DERVLNGLKETYNSLGVPIGATVQAIQAMKEVTAGLVGPDAGKEMGVYFDYICSGLGN"
FT   gene            complement(494371..494856)
FT                   /locus_tag="Syncc9902_0479"
FT   CDS_pept        complement(494371..494856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0479"
FT                   /product="allophycocyanin alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25447"
FT                   /db_xref="GOA:Q3AZN0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25447.1"
FT                   /translation="MSIVSNSIINADAEARYLSPGELDQIKAFVTGGQRRLRVAQVLCE
FT                   SRERIVKQAGGQLFQKRPDVISPGGNAYGEEMTATCLRDMDYYLRLVTYGIVAGDVTPI
FT                   EEIGVIGAKELYRSLGTPLEAMAEAVREMKNVAMGLLTGSDADEAGTYFDYVVGALA"
FT   gene            complement(495268..498186)
FT                   /locus_tag="Syncc9902_0480"
FT   CDS_pept        complement(495268..498186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0480"
FT                   /product="anchor polypeptide LCM"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25448"
FT                   /db_xref="GOA:Q3AZM9"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25448.1"
FT                   /translation="MTVTASSGSPRVSPQLFDTLPLSSVRQAEQQDRFPDSVELSTLVT
FT                   FFRSGQDRLEAARIMAANAEAIVARAANRIFVGGTPLSFLDSPLTTGEAIRTTDATPLA
FT                   SDQAAFQDSVRTFTGDSDSTKSGNFLSRLLDGAGGDADVRVVLPTGFNAISVAKYGPAF
FT                   MRKSVRDMGWFLRYLGYALVAGDPSILAVNTRGLRDILQANCSLAATNVALQEMRAASA
FT                   LLLKDRPEARQLAIDCFNVLLKELSIATPSTRQRLGSKVQQGLQLPAIYALASEGSQRF
FT                   EMRPGLSGAEKAEIIRAAFRQVFERDIAKGYSQNPCSVEASQVVQGQISMREYVRALGR
FT                   SKEYRQQFHDRFVNSRVVELAYRHFLGRGISSIEEFRKSFAILSAQGLNGLVDVLVNSA
FT                   EYAQNFGEEMVPYLRELGEEAQESAGWGSNRKLFNFSAPFEGAPQYITLYASYRQPFAD
FT                   QHVYGGSNDPVGNQYGAIFPSGTASVRTRPAPYGYDSRRLLVSNGMASPGQMNSTQFRN
FT                   SRPRKVGPRVMRLQQIATGGSVNPKRGGQPSVRNTESSTQAVINAVYVQVLGNAGYAGE
FT                   RLTSAEARLENGDICLREFVRSVARSDAFRRRYWSGLYIIKAIEVMHRRLLGRPTFGRW
FT                   EIDALFDTAARHGFYGVVDALVNGEEYKDCFGEDTVPYERFITPKDLNVRRTATLTRDV
FT                   KQFGYDSSSFVLGSRPDASTTQVFRGSGDVTRRNLASAAKSSSADWTSLARNFRQGEDL
FT                   QSSLRLIRLGEPIGGGRSTRGFGLSKTRSTSSAPPLTPMTGALSAISGADGYRLRSSLP
FT                   TNLRLNRPCSESDLRSIIDATYKQVLNRVPLQDERLIEAESRLRNSDTSLNQFVEEIAM
FT                   SDAFQTRLFNMAPLRAASAATLALLGRAAAPAEVSRFLTIRAQAGQPAAVKELLEKRPD
FT                   GDTVPRMDGMNTRAGVSQATLQRTAALYRGNAAINPSTEDAI"
FT   gene            498305..499501
FT                   /locus_tag="Syncc9902_0481"
FT   CDS_pept        498305..499501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25449"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25449.1"
FT                   /translation="MLGSIAEWLMKEVQPSDAATPVVSAFYDRFPFPGDPLQDGPPPGY
FT                   NWRWCHRSVLASVHGVIPAGQQQPRILDAGCGTGVSTDYLCHLNPGAEVVAVDISDGAL
FT                   AVARERLERSEARQGVRSLRQEQRSLLDLGDETPFDYINSVGVLHHLREPEAGLAALAD
FT                   LLAPQGLLHLFLYADAGRWEIHRTQKALTLLQAGTGGDGLRLGRNLFETLPESNRLRRH
FT                   HEQRWSVDCAPDANFADMYLHPQETSYNLERLFAFIETAGLQFAGFSNPELWDPARLLN
FT                   GELLERAQALPVSQQWCLIEQLDPDISHFEFFLSKAPITKSSRTDDELAAAKGLRQPCL
FT                   WGEPDPILGRNMEPIQLSDAAKDLLRCVDAQPDAALGSMGSPDLLRDLVDRQILLLRE"
FT   gene            499515..499883
FT                   /locus_tag="Syncc9902_0482"
FT   CDS_pept        499515..499883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0482"
FT                   /product="possible ATP synthase protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25450"
FT                   /db_xref="GOA:Q3AZM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25450.1"
FT                   /translation="MIDSARHFRCRLEDFYRLQRRLLLATVLVSLVTVPIVAFTMNLSV
FT                   ASSVLVGACAGLLYVRLLARSVARLSDQSRGLGRFQLIVPILLVVGAAKLPQLDLLPAF
FT                   LGFLLYKPALILQHVFDS"
FT   gene            499908..500633
FT                   /locus_tag="Syncc9902_0483"
FT   CDS_pept        499908..500633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0483"
FT                   /product="H+-transporting two-sector ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25451"
FT                   /db_xref="GOA:Q3AZM6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25451.1"
FT                   /translation="MALMPLSLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLA
FT                   FVLVGTRGMKRDPIGLQNLLEFLWDFIRDLARDQIGEKYYRDWLPFIGTLFLFIFVSNW
FT                   GGALIPWKIIELPEGELGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTP
FT                   IMLPFKIIEEFTKPLSLSFRLFGNILADELAVGVLVYLVPLIVPLPVMLLGLFTSAIQA
FT                   LIFATLAAFYIGEGLHEAH"
FT   gene            500803..501048
FT                   /locus_tag="Syncc9902_0484"
FT   CDS_pept        500803..501048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0484"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25452"
FT                   /db_xref="GOA:Q3AZM5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25452.1"
FT                   /translation="MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEA
FT                   EGKIRGTLLLSLAFMESLTIYGLVVALVLLFANPFA"
FT   gene            501118..501582
FT                   /locus_tag="Syncc9902_0485"
FT   CDS_pept        501118..501582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0485"
FT                   /product="putative ATP synthase subunit B'"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25453"
FT                   /db_xref="GOA:Q3AZM4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="InterPro:IPR034679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25453.1"
FT                   /translation="MTWLLLAEAGVPEGGLFDLDATLPLMAVQVVLLTFLLNALFFRPV
FT                   GKVVEDREGFISTSRADAKQKLAQVERLEADLAEQLKGARQAVQSVIVDAEQEVDGLYR
FT                   EALAQAEAEANRTKEESRRGIEAERESARAQLKGKVDQLSTTIIDRLLAA"
FT   gene            501582..502064
FT                   /locus_tag="Syncc9902_0486"
FT   CDS_pept        501582..502064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0486"
FT                   /product="putative ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25454"
FT                   /db_xref="GOA:Q3AZM3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25454.1"
FT                   /translation="MNLNFNPLETNLVNLAIVIGVLFWFLRGFLGGILERRRSAILQDL
FT                   QDAEARLKTASEELTKAQSELAAAQQKAEQIRIDGQKRAAAIRAEGEKRTISVMAAIKQ
FT                   GAAADADAEASRIKDALRREAAMAAIDKVLTDLPGRLDDAAQSRLIDSTIRNLENA"
FT   gene            502064..502612
FT                   /locus_tag="Syncc9902_0487"
FT   CDS_pept        502064..502612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0487"
FT                   /product="H+-transporting two-sector ATPase, delta (OSCP)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25455"
FT                   /db_xref="GOA:Q3AZM2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25455.1"
FT                   /translation="MPLLNSLATPYAEALLQVTEARSESQTVAEQCKQLLSVWDSSAEF
FT                   RDAMVSPVLEPSSKKKALQGLLAEQVTPSLMNLLKVLADRQRLQAFEAVMNRFLELYRE
FT                   QQGITLAQVRSAKPLSEAQQAALSKKVQAMAGTSKVDIDLSVDPALIGGFVVSLGSQVI
FT                   DASLAGQVRRLGLALAKAS"
FT   gene            502670..504190
FT                   /locus_tag="Syncc9902_0488"
FT   CDS_pept        502670..504190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0488"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25456"
FT                   /db_xref="GOA:Q3AZM1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25456.1"
FT                   /translation="MVSIRPDEISAILKQQIEDYDKSVSVSNVGSVLQVGDGIARVYGL
FT                   QQAMAGELLEFEDGTEGIALNLEDDNVGAVLMGEGLGIQEGSTVKATGKIASVPVGDAM
FT                   LGRVINSLGRPIDGKGDIAASETRLIESMAPGIIQRKSVHEPMQTGITAIDAMIPVGRG
FT                   QRELIIGDRQTGKTAIAIDTILNQADQDMICVYVAIGQKAASVANVVEVLRERGALGYT
FT                   VIVAASASEPAALQYLAPYTGASIAEYFMYKGKATLVIYDDLSKQAAAYRQMSLLLRRP
FT                   PGREAYPGDVFYCHSRLLERAAKLSDAMGKGSMTALPIIETQAGDVSAYIPTNVISITD
FT                   GQIFLSSDLFNSGLRPAINVGISVSRVGGAAQTKAIKKIAGTLKLELAQFDELAAFSQF
FT                   ASDLDAATQQQLSRGKRLRELLKQPQFSPLILAEQVAIVYAGVKGLIDAVPVDQVVNFS
FT                   RELREYLKSNKPEFINEIQEKKVLSPEAESVLKAAISEVVSTMVASAN"
FT   gene            504204..505157
FT                   /locus_tag="Syncc9902_0489"
FT   CDS_pept        504204..505157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0489"
FT                   /product="H+-transporting two-sector ATPase, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25457"
FT                   /db_xref="GOA:Q3AZM0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25457.1"
FT                   /translation="MANLKDIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPF
FT                   ADRLSRILENLQSRMRFEEADAPLMEQRTVETITLVAITGDRGLCGGYNANIIKRTEQR
FT                   FAELKGKGFNVKLVVIGSKAISYFSNRDYPIQAKITGLEQVPTADEANTIATDMLAEFM
FT                   AAGTDRVEMVFTKFINLVSCKPVLQTLLPLDPQDIADPEDEIFNLTTDQGRLTVEPGTS
FT                   SANTAPKIPSDIVFEQSPDQLLNALLPLYLQNQLLRCLQESAASELASRMTAMNNASDN
FT                   AKELAKTLTLDYNKARQAAITQEILEVVGGSAAAGG"
FT   gene            505225..505926
FT                   /locus_tag="Syncc9902_0490"
FT   CDS_pept        505225..505926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25458"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25458.1"
FT                   /translation="MQLHQLFPTAIATVQLALDPLDVAGQLQVLFALRGDATGNPADGC
FT                   AWTGDLHGAWQLHQHPDFAALTQQVVDQVWTYLEAVGFERSQVALHLQRCWPVLSDWDQ
FT                   VVGRHHHPNAHLSAVLYLTGSGSGEEGVLRLQAPHRINELVPGLAVGHGGPIAEGHPLN
FT                   ADHWDLAPRAGLLVLFPSRLDHSVLPNTDPEALRCSISFDFVLTAPDGDDPAEYLAPHP
FT                   NVWVQQIPPAA"
FT   gene            505959..506300
FT                   /locus_tag="Syncc9902_0491"
FT   CDS_pept        505959..506300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0491"
FT                   /product="Ferredoxin (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25459"
FT                   /db_xref="GOA:Q3AZL8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25459.1"
FT                   /translation="MSDPSAAVATYSVSAEIEGEVHQFKCRADQTVLNAAEAAGINLPS
FT                   SCCTGVCTTCAAVISAGSVDQPDAMGVRSDLQEKGYALLCVSFPRADLTLKTGQEDALY
FT                   EAQFGQYQK"
FT   gene            506297..506488
FT                   /locus_tag="Syncc9902_0492"
FT   CDS_pept        506297..506488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25460"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25460.1"
FT                   /translation="MKLLRLQRQLSWPEHVSTTELRAWVRSELASDPDVELLRWAITGL
FT                   TTAADGARCLQVEGVCIG"
FT   gene            506485..507540
FT                   /locus_tag="Syncc9902_0493"
FT   CDS_pept        506485..507540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25461"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25461.1"
FT                   /translation="MSAAPLPTLMVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHP
FT                   NVMNGAALYWSDPRIHYVEGYGLDRFAAGDWALRPVRRQRIGLLLDAGIEAELAQRQIQ
FT                   VAEACRATLGLDIGPVLRSDQSLGVSLDRGPSGASWGSLERPDALLRAGERLRDAGATA
FT                   IAVVARFPEDPGSDALTSYRQGSGVDALAGAEAVISHLLVRQLQIPCAHAPALAPLPLD
FT                   PHLDPRAAAEELGYTFLACVLVGLSRAPDLIDTTAALTGDVHASQIGAAVVPEGALGGE
FT                   AVLACVERGIPVISVANPSLLSVTPEVLGLSSGVFQASSYAEAAGLVVALRAGISPAAL
FT                   GRPLPPLQEIQ"
FT   gene            507540..507992
FT                   /locus_tag="Syncc9902_0494"
FT   CDS_pept        507540..507992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25462"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25462.1"
FT                   /translation="MPKGKGFALSTDQGPCPCGGGAYRSCCGPLHRGDQRAETAEQLMR
FT                   SRYSAFVKGELEYLLVTHPEAHVPEAERRQQLRRSSRATRWMGLRILSCTDGGVGDMAG
FT                   TVVFEARHREGVLRETSLFQRRGGRTDGDWQYIKALAPLSQGHDIV"
FT   gene            complement(508100..509776)
FT                   /locus_tag="Syncc9902_0495"
FT   CDS_pept        complement(508100..509776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0495"
FT                   /product="NAD+ synthase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25463"
FT                   /db_xref="GOA:Q3AZL4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25463.1"
FT                   /translation="MRLALAQINPLVGDLQGNAERILVAASEAQRDGADVLLTPELSLW
FT                   GYPPRDLLLQPARIAAQAELLQWMSQQLDSDLIVLVGVALPTDDDRAPGLTNSIALVDR
FT                   RGWRAVAHKQLLPSYDVFDERRYFRPGTGPNLLQLPNGQRLGLTICEDLWVDDNLQRER
FT                   LAGPDPIEQLISEQPDVVINLAASPFDADKPLLRQKLAATAARRLNCPVVYLNQVGGND
FT                   ELVFDGGSFVMSASGDPLLELPCCCDQVSLWDSEAEPANRDQGPDDPLDRLFRALVLGV
FT                   RDYARKCGFQKALLGLSGGIDSGLVAVIATAALGADQVSTLLMPSPWSSAGSIDDAIAL
FT                   AKRLGLKTTTLPIRPLMDGFDTTLNPALGADPNGVTAENLQSRIRGTLLMAVANQEGQL
FT                   LLTTGNKSELAVGYCTLYGDMNGGLAVIGDLYKTSVFALCDWLDSPASRHCRGDYHLPE
FT                   HGELVGDAIRRKPPSAELRPDQKDSDSLPDYSALDALLKDLIQERRHGEDLIAAGHNPA
FT                   LVSRVEQLLKRAEFKRRQAAPLLKVSPQAFGSGWRLPIACG"
FT   gene            complement(509776..510357)
FT                   /locus_tag="Syncc9902_0496"
FT   CDS_pept        complement(509776..510357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0496"
FT                   /product="Cytidyltransferase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25464"
FT                   /db_xref="GOA:Q3AZL3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25464.1"
FT                   /translation="MVQQRIALFGTSADPPTRGHQALLEQLLHRYDRVATWASDNPMKQ
FT                   HGAALSVRAMLLKALVEQLNSSNLDLAQDLSSPFTMVTLQRAHQRWPQHNLVFVVGSDL
FT                   AAQIPHWKQADQWLSQCHMAIAPRQGWPLTAMALADLTRCGASVEVLDVEIPASASSEQ
FT                   RRAPQPELVPSAVWPLLLEHNLYGLNPTPC"
FT   gene            complement(510359..511621)
FT                   /locus_tag="Syncc9902_0497"
FT   CDS_pept        complement(510359..511621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0497"
FT                   /product="possible GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25465"
FT                   /db_xref="GOA:Q3AZL2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25465.1"
FT                   /translation="MVRCRELLDQWRQSLRLSQREQGLLGGELVQLDRQLQRLQQHTLR
FT                   IAVFGRVGVGKSSLINALIGEPLLATDVAHGSTRSQRGVVWPVSIADLNRVELVDTPGI
FT                   DEINAAGRARLASRVAMGADLVLLVIDSDLTRTDREALQTLLSCGKPLHVVLNRSDRWP
FT                   EQERSALFNSIRSRLPGDLPLTVVAAAPRQAKLQPDGRVRSARTPAQVDALEQELKSQL
FT                   SREGVLLLALQALRQADKFQRNCQQLRLQHHRRSAQGLIGRYAAAKATGVAINPVLALD
FT                   LAGGMACDTALVVQLSRLYGLPLTPKAARQLLTHLSGNNALLGGIQLGLSALKQMLLLL
FT                   VPISGGTSLAPAAPVAFAQAALAVHASRRTGQLVAQHLLHPSGGQPGALLERLARRDPV
FT                   VRHWLHRWPLRAQQDLRPLLP"
FT   gene            511843..512070
FT                   /locus_tag="Syncc9902_0498"
FT   CDS_pept        511843..512070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25466"
FT                   /db_xref="GOA:Q3AZL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25466.1"
FT                   /translation="MVSWPRYAEGWSGQSARGESVIRILLFSLIIVFTIRQIKKIFAEA
FT                   TVGQQDVSADVAIVDVDVIVDDQKDHHSSR"
FT   gene            complement(512723..513718)
FT                   /locus_tag="Syncc9902_0499"
FT   CDS_pept        complement(512723..513718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25467"
FT                   /db_xref="GOA:Q3AZL0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25467.1"
FT                   /translation="MSSDLLLLIVLVLVVLLGSALCSGVEAALLTVNPIRVQELAARES
FT                   PVAGARRLAKLRKHLGRTLSALVITNNGFNIFGSLMLGGYAAWVFEQRGVNSAALPLFS
FT                   IGLTILVILLGEILPKALGSRLALPVALASAPLLHWLGILLRPLVVLLERILPALTAEA
FT                   EISTNEDEIRLLARLGSQKGEIEADEAAMIGKVFQLNDLTARDLMTPRVAAPTLDGSLS
FT                   IESQRTRLMENNSPWWVVLGDQVDKVLGVASREHLLTALLENRGLLTPVDLCEQVDYVP
FT                   EMIRADRLLTGFRKDSGGVRVVVDEFGGFVGVIGAEAVLAVLAGWWRKPA"
FT   gene            513806..515131
FT                   /locus_tag="Syncc9902_0500"
FT   CDS_pept        513806..515131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0500"
FT                   /product="putative aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25468"
FT                   /db_xref="GOA:Q3AZK9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25468.1"
FT                   /translation="MTAFDPGIHALRRGRFIEQLGAAAAVIPAAALTTHHADCEWPFRQ
FT                   DSDFFYLTGFDEPDAVALLLPHRPEGERFILFVQPKDPAAEVWTGFRWGTEGAVERYGA
FT                   DVAHPLDQLQERLPGYLNGAEAIAFRIGRHPAVEPLVLAAWGRQLDTYARSGEAALGLV
FT                   APTPILHRLRLRKDPHELERLREACRISAEAHELAREMTNPGMRESEVQAAIEAHFRAS
FT                   GARGPAYGSIVAGGDNACVLHYTANTAPLQDGDLLLIDAGCSVEDYYNGDITRTFPVNG
FT                   RFSAEQRELYSLVLAAQESAIAMVRPGGTAEDVHNTALRTLVEGLVDLGLLIGDPDGLI
FT                   ERGDYRHLYMHRTGHWLGLDVHDVGAYRLGERPSALETGFVLTVEPGLYISDRLAVPEG
FT                   QPEIDDRWKGIGIRIEDDVAVTEQGHEVLTHLAQKSVAEMER"
FT   gene            complement(515128..515808)
FT                   /locus_tag="Syncc9902_0501"
FT   CDS_pept        complement(515128..515808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0501"
FT                   /product="HAD-superfamily subfamily IA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25469"
FT                   /db_xref="GOA:Q3AZK8"
FT                   /db_xref="InterPro:IPR006438"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25469.1"
FT                   /translation="MAGSYRRALQDTVAHYSGWRPSAEDIDALKGEGLWNNDWDASLEF
FT                   LRRRGEQPPDRNDLISVFSDFYFGGDPNGDPSQWKGWIGNEPLLVDSAFFASLSSQGWR
FT                   WGFVSGAEPPSARFVLQQRLGLIDPPLIAMGDAPDKPDPTGLIRLAEQLAAGEQPQRIA
FT                   YIGDTVADVTTVINARTVRPDLPWQSLAVSPPHVENVTAYQLSLRRAGADRVLNRTLDL
FT                   LALL"
FT   gene            515925..516479
FT                   /locus_tag="Syncc9902_0502"
FT   CDS_pept        515925..516479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25470"
FT                   /db_xref="GOA:Q3AZK7"
FT                   /db_xref="InterPro:IPR006924"
FT                   /db_xref="InterPro:IPR038447"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25470.1"
FT                   /translation="MTATEGAATTDQEVATPAAAAVEDATQAAESTEKTAEPSAEAAGA
FT                   STPTPTKAEGRPVLTGAAAALASATIDADGVPSGYTPKADEGRFLLKILWLPDNVALAV
FT                   DQIVGGGPSPLTSYFFWPREDAWETLKTELEGKSWITDNERVEVLNQATEVINYWQEEG
FT                   KGKSLDEAKLKFPDVTFCGTA"
FT   gene            complement(516663..517073)
FT                   /locus_tag="Syncc9902_0503"
FT   CDS_pept        complement(516663..517073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0503"
FT                   /product="H+-transporting two-sector ATPase, delta/epsilon
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25471"
FT                   /db_xref="GOA:Q3AZK6"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25471.1"
FT                   /translation="MSLTLRVLAPDQNVFDGSADEVILPSTTGQLGILTGHISMLTAID
FT                   VGVLRVRANGSWNSIALMGGFAEVDSDEVTVLVNKAELGSSIDANAAEADFQKATTAVA
FT                   GMEGQPASPEKVKAQQQLNEARARMQASKSAD"
FT   gene            complement(517148..518611)
FT                   /locus_tag="Syncc9902_0504"
FT   CDS_pept        complement(517148..518611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0504"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25472"
FT                   /db_xref="GOA:Q3AZK5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25472.1"
FT                   /translation="MVASAPASAGTKGVIRQVIGPVLDVEFPAGKLPKIYNALRVEAKN
FT                   TSGQDVALTAEVQQLLGDHRVRAVAMSGTDGLVRGMEAVDTGAPISVPVGEATLGRIFN
FT                   VLGEPVDEQGPVKTKTTAPIHREAPKLTELETKPKVFETGIKVIDLLAPYRQGGKVGLF
FT                   GGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLSKS
FT                   KVALCYGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALL
FT                   GRMPSAVGYQPTLGTDVGTLQERVASTVEGSITSIQAVYVPADDLTDPAPATTFAHLDA
FT                   TTVLNRALASKGIYPAVDPLDSSSTMLQPAVVGDEHYRTARAVQSTLQRYKELQDIIAI
FT                   LGLDELSEDDRQTVDRARKVEKFLSQPFFVAEIFTGMPGKYVKLDETIAGFNQILAGEL
FT                   DDLPEQAFYLVGSIEEVKAKAQKMAAESK"
FT   gene            518854..519165
FT                   /locus_tag="Syncc9902_0505"
FT   CDS_pept        518854..519165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0505"
FT                   /product="Co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25473"
FT                   /db_xref="GOA:Q3AZK4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25473.1"
FT                   /translation="MAAVSLSVSTVKPLGDRVFVKVSESEEKTAGGILLPDTAKEKPQV
FT                   GEVVQVGPGKPNEDGSRQAPEVGIGDKVLYSKYAGTDIKLGSDEYVLLSEKDILAIVN"
FT   gene            519237..520871
FT                   /locus_tag="Syncc9902_0506"
FT   CDS_pept        519237..520871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0506"
FT                   /product="Chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25474"
FT                   /db_xref="GOA:Q3AZK3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25474.1"
FT                   /translation="MAKRIIYNENARRALEKGIDILAESVAVTLGPKGRNVVLEKKFGS
FT                   PQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLR
FT                   NVAAGANAITLKKGIDKASDFLVGKIKDMAKPIADSNAIAQVGTISAGNDEEVGKMIAD
FT                   AMDKVGKEGVISLEEGKSMETELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLT
FT                   DKKIGLVQDLVPVLEQIARTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFG
FT                   DRRKAMLEDMAVLTNGQLITEDAGLKLENAKLEMLGTARRITINKDTTTIVAEGNEAAV
FT                   GARCEQIKKQMDETDSTYDKEKLQERLAKLAGGVAVVKVGAATETEMKDKKLRLEDAIN
FT                   ATKAAVEEGIVPGGGTTLAHLAPALEEWANGNLSGEELIGANIVAAALTAPLMRIAENA
FT                   GANGAVVAENVKSRSNNEGYNAANGDYVDMLAAGIVDPAKVTRSGLQNAASIAGMVLTT
FT                   ECIVADLPEKKDAAPAGGGMGGGDFDY"
FT   gene            complement(520998..522044)
FT                   /locus_tag="Syncc9902_0507"
FT   CDS_pept        complement(520998..522044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25475"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25475.1"
FT                   /translation="MTKICFLHLGFHKTATTSIQLTCRNNSTLLEKNGVETPNFLNERN
FT                   QISANHTGQLRDIFSPSNKNLYNKVKHNQCKPDQGNSLEGYIYEFQRLLNSTGHIFLSG
FT                   EGIPLIPKVSLVRMVDEIEAQGFKIHPFALVRTPYAYLNSALQQTIKGGKHHPFIGLSE
FT                   STFQSMEHNDASSKLPSTVPAITRLLNIFGDSIHFYPFKIATSYPGGPVSFVLRTVLNQ
FT                   NNINEFKLSAANQSLSNLTTRVKNMLNKEMKHTDSGALKKLIYELDPSKNPEKFLLTRY
FT                   EFESVEESFKEIQAGTEQLLGAQFIEEKIQFSDSRSLNEINQQLVDLTRNLYRLAASKP
FT                   IKKNKEKD"
FT   gene            complement(522147..523160)
FT                   /locus_tag="Syncc9902_0508"
FT   CDS_pept        complement(522147..523160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25476.1"
FT                   /translation="MKTCYLHLGFHKTATTSFQLSCGNNREKLIEEGIYYPKFEYQDRK
FT                   GNRWNHSGNIRFLCQPIKRKKLKNIKLFNKLEYEKSLQQTHDLLLSGEGFSCMKREELE
FT                   TLKKDLLDNGFVIKAFGLVRSPYSFACSALQQTIKNGKFHSLIGLGDAYSPHIAGNNKN
FT                   YLPERSQQIELLFDVFRDNLQLYSFKQAISHIDGPVSFLLSQIKPSLSSHLKKDFKNSS
FT                   PSLTNLQARLMNATNRCILNKLKKGEKISKKVFGAQMLAIREQTKQITGEKFFLTEKEF
FT                   KLVESQYNKISRRMEQALGHSFVQENIQFSDPNIDPNYLAKAFAGCVSSLTIAQIK"
FT   gene            523292..524293
FT                   /locus_tag="Syncc9902_0509"
FT   CDS_pept        523292..524293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25477.1"
FT                   /translation="MKTCYLHLGLHKTASSSFQQTCAANIALLQQERLHYPIFSCPSAR
FT                   PSRLKISNHSVPLRSLYEHNPGEYHINKRWKIIDIDNANCQYQMQWDQALDSDSSLIIS
FT                   GEGISLLPVAALERLMAAITSKGFAIQAMALVRSPLDYAHSIAQQLIRGGQYLEVVGFG
FT                   DLRRPTTMPRLTIPDGCREISKLLTVFGGTIRFAPFYEACQHPMGPVAYLLEEFCGCQS
FT                   TRDYTFKQTQESKSNLWVRYQNQLNARWPRFDRKKRLNTDYIQLPDHYNSSGKFLLTRS
FT                   EILLIQSQIDSSNHNMSGLLGDKFVMAQPDFSEELTSNDLINLMTGLAKTNR"
FT   gene            complement(524294..525460)
FT                   /locus_tag="Syncc9902_0510"
FT   CDS_pept        complement(524294..525460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25478"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25478.1"
FT                   /translation="MLPKPQFYLHIGHGKTGTTAIQSAFAIAQEDLLRHKIEYPIPIVE
FT                   REKASQFAITSGNWKHNPEESLAKELFRLSQEKTNNNSILLSSESLFWHLDSLFEQEIY
FT                   RLKELNLHVLLAVRDIEEMLSSEYQQRVKRHGEKRPFEQFLRSRHFISSHHKKASDVIN
FT                   LLKKNQIKTTIINYSKHKSKITELIFEALQAPDAYPRNSMRGVVVNRSMSQKELSILTL
FT                   VNALFYTKFPWISARLSDALVKQLPTVQSQKCRLSEGSKLKLYEVNNDYIQNINDNLDP
FT                   DSYLLDQSTIVTDNAQIDRSVIQQIRKEEQLSIDVISSTLLTAIQSESVHNRLSNTTID
FT                   QLIKMSQAADIEADTRVELLELAVANRPQGQRLIKLLEQAKTSINHQE"
FT   gene            525830..526702
FT                   /locus_tag="Syncc9902_0511"
FT   CDS_pept        525830..526702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25479.1"
FT                   /translation="MLGNRPALVQAIARRAVKHHGFEHIVVVGYTRLQSSYHVSAFKQW
FT                   FFRDRKKLREDIAVLKNYDLSWRKFSALERSLLALALVGKDRSWHANYKKFAAGCTGLS
FT                   PQMTLASNHIPTKQNPYMLLEDFFKLSGFECRDDLSVFDVRKNVSFHPAVVHALSSHFS
FT                   SLGPRLSCFPGPHEGNRWLFRVCKRLGDACVNLPRENDVFAEELCESIVHYLDRRNYPA
FT                   NQDYCQLMSVNQSYFEPVNNVKAMSSADDLVRKARDIESKRSQKDIDDFLLLSENAFMN
FT                   AARSEIIST"
FT   gene            complement(526722..526955)
FT                   /locus_tag="Syncc9902_0512"
FT   CDS_pept        complement(526722..526955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0512"
FT                   /product="Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25480"
FT                   /db_xref="GOA:Q3AZJ7"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25480.1"
FT                   /translation="MMLNSILSWTWIGSGVLLIALVLLHSPKGDGMGGLAASGSSMFSS
FT                   ASSAEATLNRFTWTCLAIFLSLAVILSAGWLN"
FT   gene            complement(526955..528592)
FT                   /locus_tag="Syncc9902_0513"
FT   CDS_pept        complement(526955..528592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0513"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25481"
FT                   /db_xref="GOA:Q3AZJ6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25481.1"
FT                   /translation="MNVGSSTSKGSARTGSIAPVVLTILDGWGHRDEEENNAIRQGDTP
FT                   VMEALWHAYPHTLIQASGSHVGLPDQQMGNSEVGHLTIGAGRIIRQELVRIGETVRNDQ
FT                   LKSTPELQKLAERVKAAGSTLHLLGLCSDGGVHSHVDHLCGVIQWAAEAGITKVAVHVI
FT                   TDGRDTPTQSAPGYVKAVQDSLQSTGIGTIASLCGRYWAMDRDQRWERTDKAYRLYTDP
FT                   DIDVDERQPETILSDSYGEGITDEFLEPARLQDTVMQDGDALLMFNFRPDRARQIIQAL
FT                   CLDDFEGFEREHTPTLDVLTFTQLEQNLPVSVAFPPEPLNNLLGQVVAEAGLLQYRTAE
FT                   TEKYPHVTYFMNGGIEQPLPGEERHLVPSPRVATYDLSPAMSADELTASCIKAIETRKY
FT                   ALIVINYANPDMVGHTGMMDAAKEAIQTVDACIGRLLNAIGREGGTMLITADHGNAELM
FT                   RGADGQAWTAHTTNPVPVILVEGEQRKIPGHGNAITLRDNGGLADIAPTLLQILDLQQP
FT                   SAMTGDSLIAPMSNVDPSPLSARLPQPV"
FT   gene            528691..529242
FT                   /locus_tag="Syncc9902_0514"
FT   CDS_pept        528691..529242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0514"
FT                   /product="possible pyrimidine operon regulatory protein
FT                   PyrR/uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25482"
FT                   /db_xref="GOA:Q3AZJ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25482.1"
FT                   /translation="MADQDRVEILSDRELGRTLVRLATQVLEQVDDSRRLMLLGIPTRG
FT                   VELSRVLAQELERLSGHPIAQGSIDPTFHRDDLERIGTRLAQTTTLPCNLEDRQVLLVD
FT                   DVIFTGRTVRAAMEALHGWGRAQRVMLLVMVDRGHRELPIQPDFCGRTVPSRRSETIEL
FT                   RLRDVDGEEGVFLKRSIPLT"
FT   gene            complement(529226..529480)
FT                   /locus_tag="Syncc9902_0515"
FT   CDS_pept        complement(529226..529480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0515"
FT                   /product="putative ferredoxin-thioredoxin reductase,
FT                   variable chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25483"
FT                   /db_xref="GOA:Q3AZJ4"
FT                   /db_xref="InterPro:IPR004207"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25483.1"
FT                   /translation="MTKWIQDCFGAMQTGDKVQVNTSVVVYNHPEHRGEAFDMQGQNGE
FT                   IVTVLNDWKGRTISPTLPVIVAFGRYKAHFHAEELMSAG"
FT   gene            complement(529477..530319)
FT                   /locus_tag="Syncc9902_0516"
FT   CDS_pept        complement(529477..530319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25484"
FT                   /db_xref="GOA:Q3AZJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25484.1"
FT                   /translation="MAVHRHLLQLWVLATLSMVLAIAGGAFWWEKQLPAHLRSAIANQD
FT                   YEGCIRASDQLAALQWLGQSAPAELALCRQRHAEELWAQGATSQALDLQYKLVVSKQGD
FT                   LDKHRARLNQWQQAIQERAIRLFRQGQLKPSLALLKPLELQQREPIRDLRKTFQEIWNR
FT                   NSVEHTRLERLVQQERWWEALDSLNRLDHPWWQSKAEVLKKGIETGLAGFDSGTEHNQH
FT                   AAEPSNVISGEELEQAVQRQLIQGIEPWDAFQAGCQSLGGRVKEDGPESFCQRPATGP"
FT   gene            complement(530395..531969)
FT                   /locus_tag="Syncc9902_0517"
FT   CDS_pept        complement(530395..531969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0517"
FT                   /product="putative DnaK-type molecular chaperone (HSP70
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25485"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25485.1"
FT                   /translation="MGEEKLQHSTGRGGTLAIDLGSTTTVVAFQSPDTPTAQLVELAPI
FT                   SRRPGEVPSLVWDNGDQPLIGRQVIEAGLDDSDDPKLHRDFKRLIGPEDTPEHNRACWA
FT                   GQQLLREVWQRLPQDLNIERLVLSAPVESYRTYRSWLLQASDALPVQEIALVDEPTAAA
FT                   LGAGLPPGSRMLVVDLGGSTLDLALVSLEGGEGKAAPIAQLLRLGGRSLGDTSGQKLRT
FT                   AKVLGKAGMRLGGRDIDRWIVNACCPNQPVTSTLLDAAERLKCRLSSSDVPDRDQLLEI
FT                   TADEQQHSLRLSRRELDQLLEQHDFDTVLAELMETTLAGGRRNNCHLEDLAGVVAVGGG
FT                   AQLPWLRRWLADNTAPAPLLTPPPVDAVALGALKLTPGVAIRDVLNNGVSVRTWDQRTN
FT                   RHHWHPLFVAGQPWPSSEPLELILAASQTGQRSIELVLAEPLTQGRHSVVFVNGLPTVR
FT                   ELETSESDHLPWPSDPLVLPLSPPGEIGQDCLHLRWSIDAEARLQLTIRDLRSQKQLPT
FT                   VILGTVR"
FT   gene            532032..532316
FT                   /locus_tag="Syncc9902_0518"
FT   CDS_pept        532032..532316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25486"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25486.1"
FT                   /translation="MDRLQRLIFSYYREEPALQQLLQPLHSCRMRRSWGSVRIECRDDG
FT                   HLEDVSALLGYVREPLAALDLGRQIVLRGSGSRQRSYPMHVPFPSDQLA"
FT   gene            532347..532595
FT                   /locus_tag="Syncc9902_0519"
FT   CDS_pept        532347..532595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0519"
FT                   /product="putative DNA-directed RNA polymerase (omega
FT                   chain)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25487"
FT                   /db_xref="GOA:Q3AZJ0"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25487.1"
FT                   /translation="MIECSWLVISAGVDSSDLAKRGESLIRQSSNRYLTTVRIAFRAKQ
FT                   RRFDDFDGLLEESSVKPVQRAIVELSDEQDQPDLLPG"
FT   gene            532602..532961
FT                   /locus_tag="Syncc9902_0520"
FT   CDS_pept        532602..532961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25488"
FT                   /db_xref="GOA:Q3AZI9"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="InterPro:IPR014947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25488.1"
FT                   /translation="MILQEGPGWRLARDSLRGEFNILVGGEGWAFELTSPEWKEFVDLL
FT                   STLEAQHSALKDQLMAEEAIELELDRGVWWGCLAGDCQSWSLAIVLTPEEGRGVEGFWP
FT                   APTAAALVAAVRTLG"
FT   gene            533285..533533
FT                   /locus_tag="Syncc9902_0521"
FT   CDS_pept        533285..533533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25489"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25489.1"
FT                   /translation="MQSGLEQVVEGGDNVVSFQSELPLALQQAMVQFIERHPNWDQYRL
FT                   VQAALAGFLVQNGIESREITRVYVGNMFRRESLLHGA"
FT   gene            complement(533485..534108)
FT                   /locus_tag="Syncc9902_0522"
FT   CDS_pept        complement(533485..534108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25490"
FT                   /db_xref="GOA:Q3AZI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25490.1"
FT                   /translation="MCAIGPAVVAQDLRAISTPGVARFGDIAVLISLGLPMVPLLGLLR
FT                   FADQLLPAPLEPKPPQRLTALLCHAFALMVIELLLLVAGLTLIQCLSWAVGQVSTTLAG
FT                   LIVILGALILGAGLFTQVMSLPLLVHHRCRALQAMDRSRRLVQNNSLKMLAVLGLLLGI
FT                   NALGLLGATLGLLLSLPFSALILMACCRPQAPWRRDSRRNILPT"
FT   gene            complement(534197..534667)
FT                   /locus_tag="Syncc9902_0523"
FT   CDS_pept        complement(534197..534667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25491"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25491.1"
FT                   /translation="MVSVAFWLMKSEPDAYGIDDLRREESTLWDGIRNYQARNFMRSMS
FT                   VGDQAFFYHSNCKPPGIIGLMEVVETHLVDPTQFDSTAKYFDPKSKQDQPRWDCARLRF
FT                   LGQFDQLLSLDQLRASYNEEQLPVIKRGNRLSILPVPTTTAKDLLDRLGPLH"
FT   gene            complement(534728..536116)
FT                   /locus_tag="Syncc9902_0524"
FT   CDS_pept        complement(534728..536116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0524"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25492"
FT                   /db_xref="GOA:Q3AZI5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25492.1"
FT                   /translation="MTLTIVVGLGRSGLGAARLLHHQGQKVVVLERGTGPDQTSCAATL
FT                   QAEGIQVELGIPLEINSFEPWRSDLDAVVVGPGIPWDHPTLNGLRQEGVQIRGEIELAW
FT                   EALNDIPWVGITGTNGKTTVTHLLSHVLGHAGIVAPMGGNMGVSAADMALKIRRGETPK
FT                   PDWLVMELSSYQIEAGPNLAPSIGIWTTLTPDHLERHGTLEAYRAIKHSLLQRSSLAIF
FT                   NGDDADLSAHRPSLKRGMWVKAAPPCHDDPPADFWIDDAGTVQAREGGAMFPAKVLAMP
FT                   GAHNRQNLLLVTAAAAQIGLNAEQIAQGLESFPGVPHRLENLGSTSSADVFNDSKATNY
FT                   DAAAVGLQAMAGPVVVLAGGQTKRGNATGWLAELKSKACAVVLFGAGAEELDALIRQSN
FT                   YQGQVHRCTDLSAAVAIAVRATSELQASSLLLSPACASFDQYQDFEARGDHFRDLMQPH
FT                   MHVG"
FT   gene            complement(536284..537069)
FT                   /locus_tag="Syncc9902_0525"
FT   CDS_pept        complement(536284..537069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0525"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25493"
FT                   /db_xref="GOA:Q3AZI4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR017506"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25493.1"
FT                   /translation="MTLLKEELLTGADDPAGLRQLIQLADQVVRTWQPAWSPFLDARLQ
FT                   EEALERLSNLSEIGWHRDGGYPGAERCRFLCQRRDPIGDADTCAPVQGLLIEGNFLFDP
FT                   LSPEDIRNALQELGAAPDQIGDLWVRGDRGGQGLCTPESAARLHEQRGRVRDVEIRCEA
FT                   LPIEALHLPAQRTPRILQTVEASCRIDAIASAGFGLSRAKIVGHIKAGRLRVNWHDVRL
FT                   ASRDVGVGDRLQLQDRGALEVLSLTRTKRERWRVELRRS"
FT   gene            complement(537066..537566)
FT                   /locus_tag="Syncc9902_0526"
FT   CDS_pept        complement(537066..537566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25494"
FT                   /db_xref="GOA:Q3AZI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25494.1"
FT                   /translation="MPVCVVVVSNQRAAEGLSQQLKETKLPLTTCITLPPEGDAIDQVE
FT                   LLSPNLTRARRQKAMGRWLMPFGFLAGVTFTQITNLTTFASFGPWGEMLIGGLMGMGSG
FT                   LMGSYAAAASVNSDNDDGVRILRNRREEGSWLVLLETPNGIEPPWQVVQRSNPQQVVRL
FT                   NDL"
FT   gene            537670..539256
FT                   /locus_tag="Syncc9902_0527"
FT   CDS_pept        537670..539256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0527"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25495"
FT                   /db_xref="GOA:Q3AZI2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25495.1"
FT                   /translation="MTKVLVSDPIDQAGLDILNQVAQVDQRIGLSEDELVGIIGEYDGL
FT                   MIRSGTQVTATVIAAAGRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHA
FT                   LAMMLSLSRHVPQANAGMRAGKWDRKKYVGNELYKKTLGVVGLGKIGSHVAKVAQAMGM
FT                   DVIAYDPFIAADRAKQMQVKLIELDELFRTADYVTLHIPRTKDTENLVNADLLRTMKPT
FT                   ARIVNCARGGVVDEAAISEAINQGVIAGAGLDVYASEPLAEDSPLRAVERGLVLTPHLG
FT                   ASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLSAEIMERLKPHLQLSETVGLLVS
FT                   QLAGGHVKEMELRLQGEFASHPSQPLVIAALKGLLSAALGDSINFVNASLEAKARGIQV
FT                   LEVKDESSRDFAGGSLQITTRGDQGDRCVTGAVFADGELRITSIDEYPVNVSPSRHMLF
FT                   TRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKIVRGDAVMVLSIDDPIPADLLQKITAI
FT                   DGIQEAHPVTL"
FT   gene            539256..540143
FT                   /locus_tag="Syncc9902_0528"
FT   CDS_pept        539256..540143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0528"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25496"
FT                   /db_xref="GOA:Q3AZI1"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25496.1"
FT                   /translation="MWWRLSMPCPPELEESLAWKLNDLGLHRFALQHSPDTPHQKTLLV
FT                   WLPQPEWPVAEREQLLASLEPLSQPFGLAFPSGVWDEVADEDWSLSWKQHWQPDPVGQR
FT                   LLILPAWLDVPEEHADRLVIRMDPGSAFGTGSHPTTRLCLEALEACPPQGLLVADLGCG
FT                   SGVLGLASLCLGADAVLAADTDSLAIRATEGNRSLNRCSEQRLQVSLGSVETLQTLLAG
FT                   RRADLLLCNILAPVIEALSPGFESLMAPNGRALLSGLLVDQAPRLKDVLATQGWQVTQE
FT                   LAQGRWGLLEIRHT"
FT   gene            540298..540597
FT                   /locus_tag="Syncc9902_0529"
FT   CDS_pept        540298..540597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0529"
FT                   /product="Ferredoxin (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25497"
FT                   /db_xref="GOA:Q3AZI0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25497.1"
FT                   /translation="MASYKVTLVSESEGLNKTIEVPDDQYILDAAEEQGIDLPYSCRAG
FT                   ACSTCAGKITAGTVDQSDQSFLDDDQIEAGFVLTCVAYPTSDCTIKTHAEEELY"
FT   gene            540701..541090
FT                   /locus_tag="Syncc9902_0530"
FT   CDS_pept        540701..541090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25498.1"
FT                   /translation="MSRPEVHDLLAPGSIHTSPGGQYSFRVIGPCCRLFDREELPWPCC
FT                   RLAWRSKEPSWRRVGRRFVPDLAARRCPSYSVELLQPGSRPTATVLTLFSVRLVRELQE
FT                   WWYSRHPRSMEPDNIEPNLEALIDH"
FT   gene            complement(541359..541871)
FT                   /locus_tag="Syncc9902_0531"
FT   CDS_pept        complement(541359..541871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0531"
FT                   /product="cytochrome c-550"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25499"
FT                   /db_xref="GOA:Q3AZH8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR016003"
FT                   /db_xref="InterPro:IPR017851"
FT                   /db_xref="InterPro:IPR029490"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25499.1"
FT                   /translation="MVSVFSSLRQSFKGLLVLVPVLIGLAFISPAEAVQWDAETLTVPV
FT                   NPDGAEVTFTDREINAGRKVFNTSCGTCHAGGITKTNQNVGLDPETLALATPARDNVDA
FT                   LVDYMKDPTSYDGEYSISDVHPSMRSAELYPAMRDLDDEDLRLMAGYILVSPKVQGSSW
FT                   GGGKIYF"
FT   gene            complement(541946..542905)
FT                   /locus_tag="Syncc9902_0532"
FT   CDS_pept        complement(541946..542905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0532"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25500"
FT                   /db_xref="GOA:Q3AZH7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25500.1"
FT                   /translation="MQVTFLGTSSGVPTRARNVSAVALRLPQRSEMWLFDCGEGTQHQF
FT                   LRSELRLSQLRRVFVTHMHGDHVFGLPGLLASLGLAGNSNEGVDLYGPDPLESYLNGVL
FT                   RTSSTRIGYPLKVHRVHDCAENGTLVYEDDDLMVRCTPLTHRVPAYAYRVDQKPLAGRF
FT                   DIAKAKDLQIPPGPIYAQLKRGDTVTLEDGRVIDGTTLCGPERPGVSVVYCTDTVFCEA
FT                   AVDLAQGADLLIHESTFAHQESEMAYQKQHSTSTMAAQTAAEANVGQLVLTHLSPRYAP
FT                   GNAVTPEDLLKEAQAIFPNTCLAKDFLTLEVKPRCNSL"
FT   gene            542948..544417
FT                   /locus_tag="Syncc9902_0533"
FT   CDS_pept        542948..544417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0533"
FT                   /product="stage II sporulation protein D-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25501"
FT                   /db_xref="GOA:Q3AZH6"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25501.1"
FT                   /translation="MARGGTLKRLWLRMVRIASVVLAGFATAALFGSAQHAMPMEREPQ
FT                   MRVLLHEGPKLLLRADKTQWMQVRGLGGGVRRLRRLQLEQAGGSFIAVLDGNRRRLASG
FT                   TVLTVQNDDPRGIWLDSRRYRGEFQISCRGGRLRVVNALGVETYLTSVVGSEMPHHWPL
FT                   AALKAQAVAARTYALRQRSRGGGWDVKASVASQVYRGVEAETASTRQAVAETRSLVLVH
FT                   RGKLINAVFHSSSGGVTESSGMVWSQQLPYLVSVPDHDQHSPVHRWQERFASSGLRQRL
FT                   PETGGVNRVDVTSRSASGRVRQARLEGPRGSLVLTGRELRQRLGLKSTLVTFEMVSADS
FT                   AKPFQSSTVLARRSASSMGSRSRIDRITASVARSTTTSSFPSTSFLVAPPPLPPVLSSP
FT                   MRSRSFRFRASRSNERRGIAVGGLQLLVRGQGYGHGVGMSQWGAHGLAEQGADFRTILS
FT                   HYYRGADVLPFKSHYDPALAWQPHPASGWWG"
FT   gene            544433..545212
FT                   /locus_tag="Syncc9902_0534"
FT   CDS_pept        544433..545212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0534"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25502"
FT                   /db_xref="GOA:Q3AZH5"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25502.1"
FT                   /translation="MLRFPRQLQRYDSAADCCDRLAQRLETHLRQWLSMPLALRRPLGL
FT                   ATGRTMEPLYAALVQRLMLWSAPDLDELRQRWSSFNLDEYLGLPTGDPRRYSTYMSRHL
FT                   GEPLQLPPETLHLPSGGAADAHGAAQAYAAELNACGGVGVQLLGLGNNGHVGFNEPPTT
FT                   ADQSCHVVDLSDATRRQNSALFGGDPAAVPAQAITLGLQEILAADEIHLVVTGAAKADI
FT                   LKRLLTLPAPQPGLPASWLLNHPCVWLWADADAMDPP"
FT   gene            545240..545503
FT                   /locus_tag="Syncc9902_0535"
FT   CDS_pept        545240..545503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25503"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25503.1"
FT                   /translation="MTIDPVERPLEQSFEVEKLTRLINDCRDLEQLREMALALVQQVAQ
FT                   QKAASAWMANRATESENAKLEMLAEVIRRRAAGGSESTPQTD"
FT   gene            complement(545516..545689)
FT                   /locus_tag="Syncc9902_0536"
FT   CDS_pept        complement(545516..545689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25504"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25504.1"
FT                   /translation="MSMKQLVSFMSRVQSNDSLRSEIQHCGDDNSCVLKVAAKHGHKFS
FT                   SASLSRWQRDHH"
FT   gene            complement(545778..545957)
FT                   /locus_tag="Syncc9902_0537"
FT   CDS_pept        complement(545778..545957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25505"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25505.1"
FT                   /translation="MQNDASLKQNVLSASTADDVAKIGSSIGFEFSGDELLRFSGKKVG
FT                   RVTVSKQETPGEYN"
FT   gene            complement(546064..546261)
FT                   /locus_tag="Syncc9902_0538"
FT   CDS_pept        complement(546064..546261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25506"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25506.1"
FT                   /translation="MTIDNRCREQQKVADRMFMDFKYTAPGSTEQLQALKTLSFLLGMW
FT                   GDFLGHEVKRMDAASSLTSV"
FT   gene            547063..547377
FT                   /locus_tag="Syncc9902_0539"
FT   CDS_pept        547063..547377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25507"
FT                   /db_xref="InterPro:IPR021705"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25507.1"
FT                   /translation="MSDDSLQTHPLYATDRDEVDALLGHQGDPGPEHLTTAGRLLMRYG
FT                   DFPGADDIKQDLGKVISSWGLDRSGLNAKCREIWSSGWRPGQKLDAEVGSGADVDDRDS
FT                   "
FT   gene            548108..548398
FT                   /locus_tag="Syncc9902_0540"
FT   CDS_pept        548108..548398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25508.1"
FT                   /translation="MFADRAERKELRVRIMSFTRNRSQSSHSPNVNPRALQMHLQGAQD
FT                   ALSAFDGYHSSGPALQPSVLERPAGFQRLTVLQQLLQRGRGFISSIVEAFR"
FT   gene            548643..548894
FT                   /locus_tag="Syncc9902_0541"
FT   CDS_pept        548643..548894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25509"
FT                   /db_xref="GOA:Q3AZG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25509.1"
FT                   /translation="MQRKSIFKDLLASILVVLRWLLWVAIGANIAIEIAEVYLQKDVYH
FT                   LAISAIFFLLANMQIGISRLLISMDDEEMSRRFFTCLL"
FT   gene            complement(549483..550229)
FT                   /locus_tag="Syncc9902_0542"
FT   CDS_pept        complement(549483..550229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0542"
FT                   /product="Protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25510"
FT                   /db_xref="GOA:Q3AZG7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25510.1"
FT                   /translation="MAGHSKWSQIKRTKAVVDSKRGALFTRLGREIMVAARAGSDPAGN
FT                   FQLRTAINKARAAAMPASNIDRAIAKGSGQGGEGAQLEDVRYEGYGPGGMAVMVEALTD
FT                   NRNRTAADLRLAFSKNGGNLGENGCVAYLFEHRSEVSIKTEAGSEERLLESLLDLDADG
FT                   YELNDETTATIFGPFAGLEALQDGLRQQGWDVKEWGHQWATTTNVSISDPATAQSCLNL
FT                   LDALESLDDVRSVSANLELDTKLEIN"
FT   gene            complement(550290..551198)
FT                   /locus_tag="Syncc9902_0543"
FT   CDS_pept        complement(550290..551198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0543"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25511"
FT                   /db_xref="GOA:Q3AZG6"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25511.1"
FT                   /translation="MPPLDGPFGFVVIDKPAGLTSHACVSRMRRSYGLRRVGHGGTLDP
FT                   AVTGVLPIALGPATRLLPYLPGEKTYQGSIQLGTRSSSDDLQGEILETQPWPELSNQGC
FT                   LEALAPFRGTIQQRPPQVSAVHVDGERAHARARRGESMDLAAKTVTIERLNLLDWDPTS
FT                   GRLRIEVHCTAGTYIRALARDLGDALGCGGCLADLTRTQALGFHIAQAHPLPESDSNLE
FT                   LPEPLSPLEALQTLPKRTLTDSEEFDWRCGRRLSVGETLQGNVKDGDAVVVCKADGSIA
FT                   GMGLAEANQQLRPKVVFDAAG"
FT   gene            551264..552016
FT                   /locus_tag="Syncc9902_0544"
FT   CDS_pept        551264..552016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25512"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25512.1"
FT                   /translation="MQELRSSRDVNVDGFLKDALQVKAHLARYLSLSLEELETRLPSST
FT                   DDLADLHPGAFRPEDATEFYEDKVGTGHLLELAAWHLSSADYIADTLRLQGMAARGQVL
FT                   DFGGGIGTHALSAAALPTVDHVWFVDLNPHNQVFVQQRAEAMGLSHKLSVHRDLGSTGD
FT                   VSFDAVVCLDVLEHLPDPSAQLREFHQRMAPNAIALLNWYFFKGHNGEYPFHFDEPSLV
FT                   DCFFRTLQGQFLEVFHPLLITARLYEKI"
FT   gene            complement(552111..552377)
FT                   /locus_tag="Syncc9902_0545"
FT   CDS_pept        complement(552111..552377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0545"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25513"
FT                   /db_xref="GOA:Q3AZG4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25513.1"
FT                   /translation="MAHKKGTGSTRNGRDSNSKRLGVKAFGGESVTAGSILIRQRGTSV
FT                   LPGVNVGKGKDDTLFALTDGFVKFESIKRGLRNRKRINITAAV"
FT   gene            complement(552419..552796)
FT                   /locus_tag="Syncc9902_0546"
FT   CDS_pept        complement(552419..552796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0546"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25514"
FT                   /db_xref="GOA:Q3AZG3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25514.1"
FT                   /translation="MADTKPAAKAAPETSDAYAIVEASGTQIWLQTNRYYDLDRLQADV
FT                   DETLKLDNVLLVKDSKGTTLGQPYVKDASVELKVMAHRRGPKVIVYKMRPKKKTRRKNG
FT                   HRQELTRVMVQSISVGGKAIG"
FT   gene            552928..553806
FT                   /locus_tag="Syncc9902_0547"
FT   CDS_pept        552928..553806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0547"
FT                   /product="possible circadian clock protein KaiA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25515"
FT                   /db_xref="GOA:Q3AZG2"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011648"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR020844"
FT                   /db_xref="InterPro:IPR020856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25515.1"
FT                   /translation="MARPALTVALLLSSSALVDTCRQWLPANRYESVVLSVGENEGLAT
FT                   TLAPRHNDFDAVVVEQNLLDSEAREDLLKAGLLFPAVIVGEVKGHVDYHQEELHLPEDQ
FT                   LAQLGYNVDAAISRFLRQGRADGRQEDTATKAVGSLSRRLQERLGYLGVFYKRDPSRFL
FT                   NSLAPDERRELIESLHRTYRDLLLSYFGDPAAANQALESFVNTAFFSDLPITRTVEIHV
FT                   NLIDEYWKKLRLEGHKNDFLQDYRLALLDVMAHLCEMYRRSIPPDIPLPSEASNRLSVA
FT                   VDQPMSSEELL"
FT   gene            553803..554165
FT                   /locus_tag="Syncc9902_0548"
FT   CDS_pept        553803..554165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0548"
FT                   /product="possible circadian oscillation regulator KaiB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25516"
FT                   /db_xref="GOA:Q3AZG1"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR013474"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25516.1"
FT                   /translation="MSPRKTYILKLYVAGNTPNSMRALKTLRNILETEFRGVYALKVID
FT                   VLKNPQLAEDDKILATPTLAKILPPPVRRIIGDLSDRERVLIGLDLLYDELSDNMLTSS
FT                   FLDDSDEESAPATSDS"
FT   gene            554231..555769
FT                   /locus_tag="Syncc9902_0549"
FT   CDS_pept        554231..555769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0549"
FT                   /product="circadian clock protein KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25517"
FT                   /db_xref="GOA:Q3AZG0"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR013503"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25517.1"
FT                   /translation="MQFPPASGQSQMQVQKLATGIEGFDDVCHGGLPIGRSTLISGTSG
FT                   SGKTVLSLHFLHNGIKHFEEPGIFVTFEESPLDILRNAASFGWNLQEMVEQDKLFILDA
FT                   SPDPDGQDVAGSFDLSGLIERINYAIRKYKAKRVVIDSITAVFQQYDAVFVVRREIFRL
FT                   IARLKEIGVTTVMTTERIDEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTVEILKLR
FT                   GTTHMKGEFPFTMGAHGISIFPLGAMRLTQRSSNVRVSSGVPRLDEMCGGGFFKDSIIL
FT                   ATGATGTGKTMLVSKFIEDACRNKERAILFAYEESRAQLMRNGTSWGIDFEQMEQDGLL
FT                   KIICAYPESTGLEDHLQIIKTEISEFKPSRMAIDSLSALARGVSHNAFRQFVIGVTGYA
FT                   KQEEIAGFFTNTSEEFMGSHSITDSHISTITDTILLLQYVEIRGEMARALNVFKMRGSW
FT                   HDKGIREFVITGNGPQIKDSFSNFERIISGVPHRVSTDERSELSRIARSVSSDD"
FT   gene            complement(555810..557900)
FT                   /locus_tag="Syncc9902_0550"
FT   CDS_pept        complement(555810..557900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0550"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25518"
FT                   /db_xref="GOA:Q3AZF9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25518.1"
FT                   /translation="MSSESGAVIADWALPPNGGPPTDDNTLWKRIAAWWAEFTLQTKLL
FT                   AVATLVVSLMMTGITFFALAGIQRDAAMNDTRYARDLGLLLAGNVTELVADGQDRELAN
FT                   VAEKFWRSSRSVRYIFFADPEGVIYLGIPISATPNGEDGELRLNRRLELPDELRRRPQN
FT                   PLVRQHLTPQGTVTDVFVPLIRSGTYYGVLGLGVNPNETALASAALTREVTVAVFISIW
FT                   VLVILGAVFNALTITRPVKELLRGVRSVASGDFQARVDLPMGGELGELLTGFNAMASQL
FT                   EAYDEANIEELTAAQVKQQSLIATMADGAILLDATGRIVLANPTSRRLFRWEGRSLEGQ
FT                   ELVEELPELLSIEVHSALDALLFSSSDSEDLRCSVGEPARTLRIVMQAVRDASGESLKG
FT                   IAVTIQDLTREVELNAAQSRFISNVSHELRTPLFNIKSYVETLHDLGDQLTEDEKKEFL
FT                   GVANDETDRLTRLVNDVLDLSRLESGRTVQFETMNLRPAMEQTLRTYRLNAEDKTVELE
FT                   LDVAPDLPDVLGNWDLLLQVFDNLVGNALKFSRPGGILSMRAYVWPDTCRVEAPISTKS
FT                   EGPTCTLTSPLPRLRVEIADTGYGISAQDQQRIFDRFYRVENAVHTEVGTGLGLSIVRG
FT                   ILDKHGAQVSMVSELDVGTTFWFELPLEQADRDELALQAERRSISAASDDGNIESVAVG
FT                   SD"
FT   gene            complement(557897..559204)
FT                   /locus_tag="Syncc9902_0551"
FT   CDS_pept        complement(557897..559204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0551"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25519"
FT                   /db_xref="GOA:Q3AZF8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25519.1"
FT                   /translation="MAISSTRPQALPPLRRVLIVGGGGREQALAWALSRNETITTVWVA
FT                   PGNGGPEGQAIDIAETDSDALVAFCRQENVDLVVVGPEAPLAAGVGDALRSADIAVFGP
FT                   DAAGAQLEASKAWAKQLMQEAAVPTAGHWSVHSEDEALAVLQKVNRPLVVKADGLAAGK
FT                   GVTVADTVTEAEAAIREAFQGRFGDAGAHLVLEERLEGPEVSVFALCDGERMVLLPPAQ
FT                   DHKRLQEGDQGPNTGGMGAYAPAPLLDQDALLEVEALVLQPTLKALRERGIDYRGVIYA
FT                   GLMLTATGPQVIEFNCRFGDPECQTLMPLMGPELGAVLQACALGRLDLAPTLTISTRCS
FT                   ACVVAAAEGYPNAPRKGDAIHSTHQMNDTHQLFHAGTARQPDGSLTTSGGRVLAVVAQG
FT                   DDFDAAFAAAYSGIAGINFPGITYRRDIGHQVRSNQ"
FT   gene            559262..560155
FT                   /locus_tag="Syncc9902_0552"
FT   CDS_pept        559262..560155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25520.1"
FT                   /translation="MGFVPLPLVLTLLSAVTPSTLPQPWSDARFKELLAEGTITSMEQA
FT                   CLDPMAAGTKLRKQKLRDRLLAIHPVPASFDLTMRNAGALLTCGSPEGTALVLNRFIPA
FT                   RGDERRRWLLIRWQAAAAALDHRQAALALRRLVDGNVATLDDITLAGPRNGLDALAAHE
FT                   ASRGRLQAAALVLLQGDLQGVTGSRRRGQVAEWLAATEPEQADQLLEAALDEAASNQAW
FT                   SLAMELLQLQLQLQLAAGGDGERPRIRLERLAARLDDAYTLLQLNPQSNPLPSLRSPRE
FT                   PGGHAAVGESTTAPSL"
FT   gene            560152..560904
FT                   /locus_tag="Syncc9902_0553"
FT   CDS_pept        560152..560904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0553"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25521"
FT                   /db_xref="GOA:Q3AZF6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25521.1"
FT                   /translation="MTPDHGPLLYEGKAKRVFALAETDRVLVEFKNDATAFNAQKKAQL
FT                   DDKGRLNCQISARLFELLEQHDVPTHYCGLVDDTWMQVRRVEIIPLEVVLRNVATGSLC
FT                   RQTPIAEGTGLNPALFDLYYKDDALGDPLLTEARVQLLGVVKADRLSAIEQLARRVNEI
FT                   LCPFFAAIDLQLIDFKLEFGVTSGGELLLADEISPDTCRLWDRRSSDVNDRILDKDRFR
FT                   KDLGGVMEAYGEVFKRVQSQCPNPRNCL"
FT   gene            560948..563167
FT                   /locus_tag="Syncc9902_0554"
FT   CDS_pept        560948..563167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0554"
FT                   /product="chloroplast outer envelope membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25522"
FT                   /db_xref="GOA:Q3AZF5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25522.1"
FT                   /translation="MTRRTRRSSVAIRRGVLGLVLGVPLISQPLQAQPSEPVGDLAPDE
FT                   TNIEMVDIQPGEMEAPAVEMVQVEQPRVLISEVTIEGLSGHPEEDRLQLSAYDAMQVRP
FT                   GSRVTRDELQNDLNAIQSTGWFSDVRIVPENGPLGVRVIVQVEPFPPLTSVELNPVSEE
FT                   LPTTVLEETFASDYGRTLNLNDLQQRMKTLQDWFAAEGYSLARITGPERVSPDGVVSLK
FT                   LTQGRVADVEVKFLTKDGDDVDENDNPINGKTRDWVITREISIKPGDAFNRNMLERDIK
FT                   RLYGTQLFSDIKVTLKPLPEQPGEVVLVLGIVEQSTGQVSGGLGYSQSQGVFGQVQLQD
FT                   TNLFGRAWNLGLNVTYGQYGGLSNLTFTDPWIYGDNHRTGFRGSLFLSQQVPQVFQSED
FT                   NGNIRTLKDYEDNGGRNAYETGRKYGFSDNDKVPGSVNKADDEYPNKSWFNYEGDSIAL
FT                   RKVGGNFAFTRPLNGGDPFKDVPWRVLAGMSFENVRPINFSADSRPYGVASRKIKSGKV
FT                   KNKDIVCISYNCADSNYLTSFRFAATYNSYNDPSNPTSGSFFTASTQQFIGINEDSPTF
FT                   NKLRTSYTQFFPVDWLKLHKGCRPKPGEAADCPQAIGVQVKAGAAIGDMPPYEAFCLGG
FT                   SNSIRGWYDCDLAVGKAFGEITLEYRFPLISIFSGEVFMDAGTDFDTQKDVQGKPGLLL
FT                   NKDGSGVSVGTGVIVKTPVGPLRLEVATKDFTDDYRFNLGIGWKF"
FT   gene            563167..563994
FT                   /locus_tag="Syncc9902_0555"
FT   CDS_pept        563167..563994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0555"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25523"
FT                   /db_xref="GOA:Q3AZF4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25523.1"
FT                   /translation="MTNWPEDYSGSWTLAGHAERSGVCLHSGHSSVVQLKGSVDPGFYL
FT                   RVEGHDQAFRLSPHQVRDSQLCTTLDLGPCKVATVEHLLAALAGCGLTHVEIQLQGDEI
FT                   PLMDGSALNWVEAIVEAGIQPAVTPRLPTPPLTQPLICSRGGSVITATPATTFRVVGII
FT                   DFPQQAIGQQQLSLDLTPERFVREIAPARTFGFRDQVEQLRAAGLIQGGALDNALVCDG
FT                   DHWVNPPLRFPDEPVRHKLLDLIGDLALVGFPQAQVLVYRGSHGLHTDLAAAL"
FT   gene            563991..564446
FT                   /locus_tag="Syncc9902_0556"
FT   CDS_pept        563991..564446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0556"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25524"
FT                   /db_xref="GOA:Q3AZF3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25524.1"
FT                   /translation="MTDPTPSDVVLTSEQIAGLLPHRYPFALVDRVIAYEPGVSATAIK
FT                   NITMNEPQFQGHFPERPLMPGVLIVEAMAQVGGLIVAQIPDLPKGLFVFAGIDGVRFRR
FT                   PVVPGDQLIIQCELLSLKRKRFGKIKAEATVEGALVCSGELMFSLVD"
FT   gene            564452..565279
FT                   /locus_tag="Syncc9902_0557"
FT   CDS_pept        564452..565279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0557"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25525"
FT                   /db_xref="GOA:Q3AZF2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25525.1"
FT                   /translation="MTVERSTPQIHPQAVVDPKAELGTGVVISSGAVIGPQVVIGDHTW
FT                   IGPNAVLDGRVTLGKDNRVFPGACLGQEPQDLKYRGANTEVVIGDGNTLREFVTINRAT
FT                   EEGEQTRLGDRNLLMAYCHLGHNCLLGNGIVMSNAIQVAGHVVIEDRAVIGGCLGIHQF
FT                   VHIGGLAMVGGMTRVIRDIPPYSMVEGHPGRLRGLNRVGLQRSGLADRHEGRELKQLKD
FT                   IWNLLYRSDVVMAEALVQARSQELFPAADHLCSFLEASTAPGRRGPTPVLSHR"
FT   gene            565279..566460
FT                   /locus_tag="Syncc9902_0558"
FT   CDS_pept        565279..566460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0558"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25526"
FT                   /db_xref="GOA:Q3AZF1"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25526.1"
FT                   /translation="MVRLLISTGEVSGDLQGSLLIHALKAEASRRGIELEILALGGPRM
FT                   KAAGAELIADTAPMGAIGLWEAVPLIVPTLRLQAKVDRLLAQRPPDAVVLIDYVGANAR
FT                   LGTRLRKLRPSLPITYYIAPQEWAWRFGDGSTTQLLDFTDQILAIFPAEAEFYAERGAK
FT                   VAWVGHPLLDSFQDLPERQESRRALGLDPDAPVLLLVPASRPQELRYLMPALARAAAML
FT                   QQRCPGLQVLVPAGLERFEQPLAEALAAAGVRNGRVIPAAAADGMKKQLAASADVALGK
FT                   SGTVNLELALQGVPQVVGYRVSRATAFVARHVLRFKVDHISPVNLLLKERLVPELLQDE
FT                   FTPEALVELAQPLLYVGSPERNAMLHGYGRLRATLGEPGVTTRASQAIFDQLM"
FT   gene            566460..567098
FT                   /locus_tag="Syncc9902_0559"
FT   CDS_pept        566460..567098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0559"
FT                   /product="Methionine sulfoxide reductase A"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25527"
FT                   /db_xref="GOA:Q3AZF0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25527.1"
FT                   /translation="MARVIGVLLSALLVLGGSQSVAAAEQTAVFAGGCFWCLEHDLEHL
FT                   PGVIDAISGYSGGHVDQPTYRQVSGEDTGHQEAVQVRFDPALISYSTLLRSYWRNVDPF
FT                   DGGGQFCDRGDSYRPVIFTADAVQAKAAEMSAAAAAQDLGRPRSAIKVELRGSAPFWPA
FT                   EQYHQNYAELNDLKYSFYRFSCGRDRRLDAVWGAQARTDQSWQKATELE"
FT   gene            complement(567435..567671)
FT                   /locus_tag="Syncc9902_0560"
FT   CDS_pept        complement(567435..567671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25528"
FT                   /db_xref="GOA:Q3AZE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25528.1"
FT                   /translation="MSSSPIRWYLKAQLGVLLLPVGLCLFGEAVSRKVVQMLGQDGGPW
FT                   FWYGTLSLICINAGIGLMVESGLTRGFPGRKRP"
FT   gene            complement(567668..569140)
FT                   /locus_tag="Syncc9902_0561"
FT   CDS_pept        complement(567668..569140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0561"
FT                   /product="leucyl aminopeptidase. Metallo peptidase. MEROPS
FT                   family M17"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25529"
FT                   /db_xref="GOA:Q3AZE8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25529.1"
FT                   /translation="MRLSISSTNVKEWSGDVLVVGLPKGDPSTTAVNLESRFPGVSSAL
FT                   NQQAFEGKTGQKLVLHPLANGNPQRLVLIGLGDADAIDLDGIRAAAAAAAQASIGCKGC
FT                   LGLQLPWDSHHPDHAARISAEAVRLSLYADQRFQKEPEERRLPTALELIGLPASAAAGL
FT                   EPVNATCAGVELARELVAAPPNYVTPAALAETAAALAHDYGMELTILERADCEARGMGA
FT                   FLAVSQGSDLPPKFIHLIYRPEGAVKRRLALVGKGLTFDSGGYNLKVGGAQIDMMKFDM
FT                   GGSASVLGAMRSIGELKPAGVEVHMVVASCENMVNGSAVHPGDIVTAANGTTIEINNTD
FT                   AEGRLTLADALLYACEQKPDAVVDLATLTGACVVALGDEMAGYWSNNEALAEALDTAAD
FT                   AGGEGLWRMPLRQSYKKGLKSLLADMKNTGPRPGGSITAALFLKEFVSQDTAWAHIDIA
FT                   GPVWSDKGKGVNPAGATGYGVRTLVNWVCAQA"
FT   gene            complement(569188..569775)
FT                   /locus_tag="Syncc9902_0562"
FT   CDS_pept        complement(569188..569775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25530.1"
FT                   /translation="MQGDLFSGIPLGSTPTPDLPITAEQLRGWQQRLHDFQSPRFRRDV
FT                   FGSGQGDLLSGNVADAATSIDPTSIDPLALTPLPLSFWRWAESPHRGAAIYFVLDRPPH
FT                   LEHPLLLYVGETKAADRRWKGEHDCKAYLSAYGEALQRCQMAHQLSIRFCTDAPTDTRA
FT                   RRRLEQQLIQHWNPPFNKETRQRWATPFTADL"
FT   gene            complement(569780..570361)
FT                   /locus_tag="Syncc9902_0563"
FT   CDS_pept        complement(569780..570361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25531"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25531.1"
FT                   /translation="MPRSHWLDPLARRVLQATGQLPPARSSATSNNALARPEPALPSNW
FT                   FLDVNRGSQQQWRELPGCTDDMADLLVRLQRGGVQFAAADDLFRLLDLPTDLAQLWAPH
FT                   LVFNWYGDAPLQPVRSCIDVNNASSEELTSLAWPDQRIHGLLRERRLRGFRDLADLQER
FT                   LCLPASSVEALIGRVSFGQRRAGPSLPPRG"
FT   gene            complement(570410..570754)
FT                   /locus_tag="Syncc9902_0564"
FT   CDS_pept        complement(570410..570754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25532"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25532.1"
FT                   /translation="MDHSNRLSKKRSLYAVAVVLIGWTLLGFGSSVAVAQTERTTALVT
FT                   IAQANAKCLIQTGTMGAEQALSLANRFLDAKQVSPDERRTVNNSPGFEDLMKDYINSKG
FT                   GCETIVKDFQ"
FT   gene            complement(570789..571508)
FT                   /locus_tag="Syncc9902_0565"
FT   CDS_pept        complement(570789..571508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0565"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25533"
FT                   /db_xref="GOA:Q3AZE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25533.1"
FT                   /translation="MREIRTRSLPVLRDRRTVIASADRVFITALTHLFEGIGPLVGAAT
FT                   SEQDALNCLTANDVQLLVCTDLLESGSGPALVAAAKAQHPKLRCLMLIQRPLLSTIDAA
FT                   IASGCEGLCSRERLGDGGVLSVLQAMDSDGIHMDPTITGVCQQSRRRPILDGPPLLSDV
FT                   LSLREEDVLRGLCRGLSNQEIADQLHLAIDTIKHAVTSLLRKLEARDRTQAVLIAFQHN
FT                   LVDPPAPIPRWHHKTHR"
FT   gene            571645..571974
FT                   /locus_tag="Syncc9902_0566"
FT   CDS_pept        571645..571974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25534"
FT                   /db_xref="InterPro:IPR014954"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25534.1"
FT                   /translation="MAFFDSDIVQDEAKRLFGDYQQLMQLGSEYGKFDREGKKKFIETM
FT                   EELMGRYRVFMKRFELSEDFQAKLTVEQLRSQLGQFGITPEQMFEQMNTTLERMKAQIE
FT                   LPPSD"
FT   gene            572022..573269
FT                   /locus_tag="Syncc9902_0567"
FT   CDS_pept        572022..573269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0567"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25535"
FT                   /db_xref="GOA:Q3AZE2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25535.1"
FT                   /translation="MPETNPSLPSWLNRGMADLFPAGEPSDVDQSLAARLAAAEAEGRP
FT                   LRVKLGIDPTGSNIHLGHSILFRKLRAFQDAGHIAVLIIGDFTARIGDPTGKSATRVQL
FT                   SKNDVAVNASTYLRQLGQDQPKETALLDFETPGRLEVRYNSEWLEGMDLPAVIGLLGTG
FT                   TVGQMLAKEDFSNRYNSGTPIALHEFLYPLLQGYDSVAVNADVELGGTDQKFNVAMGRD
FT                   LQRHFGRGTQFGLLLPILVGLDGAQKMSKTLGNTVGLEDDPLSMYSKLEKVGDTAINDY
FT                   VTLLTDLNVEALPENPREKQKAMALAVTATRHGTDAAAKAQLDAGNLVGGAGDASADVP
FT                   EASLLAVNFPAKAFYLMSAVGICASSSEARRQIKGGAARLDGEKITDPNQEFASAAELD
FT                   GRVLQLGKKTFRRLTA"
FT   gene            573359..574234
FT                   /locus_tag="Syncc9902_0568"
FT   CDS_pept        573359..574234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0568"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25536"
FT                   /db_xref="GOA:Q3AZE1"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25536.1"
FT                   /translation="MKPHCVLDAQAGLAEGPHWWAEKGIFLWVDIEASRVGLFDPVARS
FT                   NRFLDLPSHVGAVVPTTTGDLVAATAKGFVRLNPQSGVLTALCDPEPGRSEHRFNDGKC
FT                   DSWGRFWAGTMAYDFSPGAGSLWRLNNDFSCSLQWQELTISNGLAWSLDRRFLYLIDSP
FT                   TLTVMAFPLTSTGSLAGHPTACITIPAEWDALPDGMCIDAEGKLWIALFGGGAVTRWDP
FT                   LDGRLMQTVELPCRQVTSCCFGGPDLDQLLITTARRGLDAQALGEQPLAGGLFQLSPGI
FT                   KGCRSEMFRV"
FT   gene            complement(574254..575174)
FT                   /locus_tag="Syncc9902_0569"
FT   CDS_pept        complement(574254..575174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25537"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25537.1"
FT                   /translation="MLRAVIHAGLHKTGTTSFQRSCNNASSELLKAGIYYPKSRKPHHN
FT                   NFANLPDTDWIRMFARKSKKLMRDGCLLVSAENFEYRFHHDYPEKIEHTLYQSGIKNIT
FT                   WVLCFRNPFSSYCSLYSQLSDPRRNFGNTYPILEFASSGRLAAAKGFLDFQNQNLEQRF
FT                   YFNYPSLVNSLRNRLKGQVLGIDFDDFTKNCNTPGDLLIQSISNDGRNLSDCIGQVSGH
FT                   SNVSPSKDAIEHNYLRRFHSKKGIKLPAWFDKAVQDRLESRIAQEPKIEALFQQNFGDW
FT                   RDCLSTPDDFKRQLQKPNFWRRFFI"
FT   gene            575213..575968
FT                   /locus_tag="Syncc9902_0570"
FT   CDS_pept        575213..575968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0570"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25538"
FT                   /db_xref="GOA:Q3AZD9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25538.1"
FT                   /translation="MEVDLSSDVALLHSANPADQIIVALDGMAPDQALAFSVQVEGLRW
FT                   VKVGLELFVQAGPEVVAQLREQDLRVFLDLKFHDIPATMAGACRRAAALGAELITVHAC
FT                   AGSEALNAAQSAAMEGAQSSGQPSPTLLAVTVLTSWEEQRLQRELAISQGIAPRVSALA
FT                   QLSATAGIGGCVCSPWEAAALRAQHPEPFALITPGIRLKGAAVGDQARVMGPAEAMTAG
FT                   ATQLVIGRPITRANDPSAAFNACCRELRT"
FT   gene            complement(575958..577316)
FT                   /locus_tag="Syncc9902_0571"
FT   CDS_pept        complement(575958..577316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0571"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25539"
FT                   /db_xref="GOA:Q3AZD8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25539.1"
FT                   /translation="MLEIVMAHQPAQAESCTVDPFGSEVCLPDSTPEEPDKPKRSNQSK
FT                   KSNKPDKSKRMVIVPSCFGPCTQFPPAPPYRQFQEVMEEAALKATPDATPEPRPAEPLR
FT                   PLWFKSDQLDDVEAETYLERTLDRNDMAQLNAVGIEADTDADGMVITVDGLSYGEVLEP
FT                   HGLLFTNEVNEPGLNAWVRGFGGGSSNGAAGDRYANFSNGGSQIGFDIPINDETRIGLF
FT                   GTYAVMNGTDGARGSWDSDGWGGGAYAEYWTSDFYLRGMVSAGGYDGEHRRKIDGETAK
FT                   GDRSGNSWTGVLNIGAPLQSGDWIIEPQAQLSYTNTSLDKFSEHGANRRDRLRFHEMEV
FT                   DQLGSELSVKFAIPIRDGERSLLLPSLRVGWAADWGMSGDHQKVSYLESGKSQRWDVNG
FT                   NDDHAALVELGLDYTTFNFQDTSMGVYARGGGLLWAGNRGTSWQVQGGLNFKF"
FT   gene            complement(577941..578543)
FT                   /locus_tag="Syncc9902_0572"
FT   CDS_pept        complement(577941..578543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0572"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25540"
FT                   /db_xref="GOA:Q3AZD7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25540.1"
FT                   /translation="MLLSSLLLLALGYLLGSMPNGYLAGRWLKGIDLRQCGSGSTGATN
FT                   VLRNVGKGPALVVFLLDVGKGALAVLLAKSFGLNDWVQVLAGLAALAGHIWPVWLGWKG
FT                   GKAVATGLGMFLGLAWPVGLACLGLFMAVISLSRIVSLSSVVAAIGLPVLMLTSGGSSA
FT                   YVAVSVVASLMVLWRHRSNIERLLAGTEPRIGEKGKS"
FT   gene            complement(578543..579559)
FT                   /locus_tag="Syncc9902_0573"
FT   CDS_pept        complement(578543..579559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25541"
FT                   /db_xref="InterPro:IPR021437"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25541.1"
FT                   /translation="MENQELEAINNGTDQTPEAPPTADAAVDQPDEASDVGAADENQPA
FT                   PDNPVVELALKDLQSRRDELSAEITLLTNRKQQLEAELKTSFAGQSDAIARRVKGFQEY
FT                   LGGALQDLVQSVESLDLVVQPMVVQPSPLDQQATDQQGAEGQNASDTSPPIAVSDTFRP
FT                   DEALIRSALQRFLQQPDVYADPWSLRRSIDARDTALLEDWFFNQGGRGAQPSRGSRPRN
FT                   ILVSAALIAIIGELYGAQFQCLVLAGAPERLGEWRRGLQDALGLGREDFGPSSGIVLFE
FT                   RSEALVERADRLEERGEVPLILIDTAERDVAIPVLQFPLWLAFAAGPNERLDDDDLL"
FT   gene            complement(579701..580111)
FT                   /locus_tag="Syncc9902_0574"
FT   CDS_pept        complement(579701..580111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25542"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25542.1"
FT                   /translation="MTTPLPNVILRPDPRLPLLVVALGAALLPLPGQPWPTLVVVLFGL
FT                   FLLIQTASLRLEFEERALIVWQNGRELRRFPYEHWLAWRLFAPWLPGLFFFRETKSIHF
FT                   LPILFSPSELRAQLEQRVGKLETTQQQSENKP"
FT   gene            complement(580108..580857)
FT                   /locus_tag="Syncc9902_0575"
FT   CDS_pept        complement(580108..580857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0575"
FT                   /product="Protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25543"
FT                   /db_xref="GOA:Q3AZD4"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25543.1"
FT                   /translation="MRMPRSLKRLGSSLLIGGQAVTATMRGRINTVDLSDQLMEAGPGS
FT                   LLIVFIISVAAGSVFNIQVAAELTRQGAGSTVGGILAIGLAREIAPLLTACLLAGKVAT
FT                   AYAAQLGTMKVTEQIDAITMLRTDPVEYLVVPRLIALVVMAPLQCFFFFIVAVWSGQIT
FT                   STALYNIPPSVFWTSVRTWMHPEDLPFMLVKAVVFGLIIATISCGWGLTTKGGPKEVGT
FT                   STTGAVVMILILVCIMDVVLTQVLFGA"
FT   gene            complement(580854..582221)
FT                   /locus_tag="Syncc9902_0576"
FT   CDS_pept        complement(580854..582221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0576"
FT                   /product="putative GPH family sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25544"
FT                   /db_xref="GOA:Q3AZD3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25544.1"
FT                   /translation="MTTSDAQLGGSRRRLMVAYGFGDAGTGLAATILGFYLFPFFTCAA
FT                   GLPAFIAGSLLTVIKVWDAFNDPLIGWMSDHTQSRWGPRLPWMLGASLPLGISLAAMWW
FT                   VPEGTLLQRTIYYVVMAILLMTAYTGVNLPYAALSTELTADTSIRTRLNAARFTGSILA
FT                   GTIGLLVAFLVLREGGGGYILMGQIAGTIAACTTLLCCWGLAPFAKQAQRPSGSDEAPL
FT                   QQFRRIRTNPRFIKVLGLYLLLWFGLQLMQVVALIWLVQVLHVPAGISTLLLLAFNIAA
FT                   LAGLQLWSLLSNRHGRIKALAWGASIWIVACLLSMLLQPVETGSSFNAYLPIVSLIMLV
FT                   GLGAATAYLIPWSLLPDAIDADPTRPAGLYTAWMVFGQKLVIGLSMSVFGLLLSLTGYI
FT                   STTSCDGALNFIEQPNTALLAVRLCMGLIPAILVLMGLGVMRGWPDRHAHLKSSAG"
FT   gene            complement(582384..584462)
FT                   /locus_tag="Syncc9902_0577"
FT   CDS_pept        complement(582384..584462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0577"
FT                   /product="Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25545"
FT                   /db_xref="GOA:Q3AZD2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25545.1"
FT                   /translation="MSGIHSGKPWPLGSSTTTRGVNFSLAAPAADRIELLLYRNGSDGA
FT                   PERVIELDARRHRSGDYWHVEVEGLNEGCCYGYRVFGPLAPGGHGFRPSKVLLDPAARA
FT                   ITGWDVYDRVLATGPSPNAHACLKAVVSERKPFDFESHPRPRHSWQRSVIYELHVGAFT
FT                   RASDSGLDRSDRGCYRGVIEKLPYLKDLGVTAIELLPVFIFDPADAPPGRDNVWGYSPL
FT                   NWFTPHHGYCSVDDPLQGRDEMRQLVAACHDAGIEVLLDVVYNHTTEGNRHGPTLSWRG
FT                   FADDTYYHQNSDGDYLDVSGCGNSIAANDPISTQLILESMRCWALELGIDGFRFDLGIA
FT                   LSRGAQLKPLDHPPLFTAMEADPELSDLKLVSEPWDCGGLYRLNDFPAKRVGTWNGHFR
FT                   DGLRRFWKGDEHTTWALAQRFKGSPDLYDGKAVAMGRSVNLITAHDGFTLADLVSYNRK
FT                   HNLANGEDNRDGENHNNSWNHGIEGPTTDPAVLALRRRQQRNLLSTLLLARGVPMLLMG
FT                   DEVGRSQGGNNNTWCQDSPLGWMVWNEDHCDLELKLFLTRLLKLRQALPQLFNPLIPAR
FT                   ETTKKHPQDQTDLWRQWHGVELSKPDWAAWSRSIATSLHMGSHGALIWMGFNAHKEALN
FT                   FELPVPASPWTRVIDTSLPSPKDLPEQPVPFRGVTIPMQSRSFVLLVAQDEVSNLRL"
FT   gene            584517..585176
FT                   /locus_tag="Syncc9902_0578"
FT   CDS_pept        584517..585176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25546"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25546.1"
FT                   /translation="MTMTTALEAGRPPQQVRNDLWLFPPNRDCQGGSSWWLNIDPEPVL
FT                   IDCPPLTQSTITTLKALAGTRQPRILLTSREGHGRLRRLQEQLDWPVLVQEQEAYLLPN
FT                   VERLECFKDEHTTASGLRLLWTPGPTPGSAVVLAPAPVELLFCGRLLTPLAPGCLGPLR
FT                   HGRTFHWPRQLASLTKLRSWIPPEASPELASGAALGGLRGERLVPFSGWSAQPSTP"
FT   gene            585309..585584
FT                   /locus_tag="Syncc9902_0579"
FT   CDS_pept        585309..585584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0579"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25547"
FT                   /db_xref="GOA:Q3AZD0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25547.1"
FT                   /translation="MNKADLVNLVAARTELTKTDVSMVVDAAIDTIIDSVVEGKKVSIL
FT                   GFGSFEPRERSARQGLNPKTGEKIAIPAKRVPAFTAGKMFKDRVQG"
FT   gene            585642..586523
FT                   /locus_tag="Syncc9902_0580"
FT   CDS_pept        585642..586523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0580"
FT                   /product="glutamyl-tRNA synthetase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25548"
FT                   /db_xref="GOA:Q3AZC9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25548.1"
FT                   /translation="MRCPNHLLLQLDQGHRLRERSGYRGRFAPSPTGVLHFGNLQTALL
FT                   SWLQARCCGGEWFLRIDDLDTPRNRPESLLRIQSDLLWLGLHWDGQPILQSSRLGIYNS
FT                   WLSSLRRSGLVFACRCSRRDLAGESIYPGTCRAIDAGWGWRAQRLPSWRLRVPEHNPFG
FT                   SGDVVVRRADGFIAYQLATVIDELSFGITDVVRGNDLQDALPAQRSLYAALGQKPPRFW
FT                   HGPLLYDDDGQKLSKRESSAGLDVARLNGEDPAHVIGQLAAGLGLVPMGTRLSLDELLS
FT                   DVRDASTLPLNS"
FT   gene            586949..587314
FT                   /locus_tag="Syncc9902_0581"
FT   CDS_pept        586949..587314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25549.1"
FT                   /translation="MPPLIVCTETVVSDTVRLSSACAVIALTVMTFFAPDVSAQGFERL
FT                   NSDAIRCLQTGDRGICQRALNNAEVLQRLASNRQAYPCQTLLLGVQADLILQQLGDGRG
FT                   DRAISDLQEARRGCPGL"
FT   gene            complement(587395..587598)
FT                   /locus_tag="Syncc9902_0582"
FT   CDS_pept        complement(587395..587598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25550.1"
FT                   /translation="MTFEVLFDDGNQSIPVERFETLGDAIACYVSCIINANEGMNAVEI
FT                   VDDYFETIASHSFADFINEKQN"
FT   gene            587878..588432
FT                   /locus_tag="Syncc9902_0583"
FT   CDS_pept        587878..588432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25551"
FT                   /db_xref="GOA:Q3AZC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25551.1"
FT                   /translation="MAIYDGVLNVVLRNPFEDKSKFFKKSQYVFGPRFILGTVFAFVGV
FT                   FGFATSGLVWEFKGIELGLTALITSFIALLFSIVFLFPFSKPKEEQPSRQNNIVKVKTT
FT                   PSQASSEAVAIDSVESVITTAEEIRTQLALSEKEKPEIVMVNFSTNHLLPGSSLLPSKR
FT                   KAGKSLDTFRETAKSLYKSEA"
FT   gene            complement(588484..589209)
FT                   /locus_tag="Syncc9902_0584"
FT   CDS_pept        complement(588484..589209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0584"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25552"
FT                   /db_xref="GOA:Q3AZC5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25552.1"
FT                   /translation="MKLTLRIWRQTTASDLGSYETHILENVSSDLSLLEALDQLNEQLI
FT                   SSGLRPVSFEHDCREGICGSCGFLVNGQGHGPRTATSVCQLYLREFSDGAAITLAPWKA
FT                   NAFPTIQDLMVDRSALDRIIAAGGYCSTGTGQAPDANAQPIGQQQALKAFDTATCIGCG
FT                   ACVASCRNASASLFVAAKLAHLGQLPQGQPERSTRARTMQLRMEQEGFGSCSSNLECEA
FT                   VCPQEISADWISWMHKEKI"
FT   gene            complement(589206..591122)
FT                   /locus_tag="Syncc9902_0585"
FT   CDS_pept        complement(589206..591122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0585"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25553"
FT                   /db_xref="GOA:Q3AZC4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25553.1"
FT                   /translation="MSGLPDPRLPSGPLADAWRRTRETSPLISPLRKSQIDILVVGTGL
FT                   AGASTAATLAQQGYRVTVLSFHDSPRRAHSVAAQGGINAARAVAVDGDSISRLFSDTLK
FT                   GGDFRAREAGCQRLAEISSGIIDQCVAQGVPFAREYGGSLATRSFGGALVSRTFYARGQ
FT                   TGQQLLYGAYQALMRQVELGRVRLLTRRDVLELITIDGMARGVVARHLLTGELEVHTAR
FT                   TVLLCSGGYSNVYFLSTNALKSNASAIWRAHRKGALFANPCFTQIHPTCIPSGDAFQSK
FT                   LTLMSESLRNDGRIWLPKRAGDQRPANEIPEEERDYFLERMYPTYGNMTPRDVASRRAR
FT                   ELCNAGRGVGPGGRSVYLDLNDAIANEGRDTIAARYGNLMTMYERISGDDPYQKPMRIY
FT                   PAPHYTMGGLWVDYQLMSSIPGLFVLGEANYSEHGANRLGASALMQGLADGYFIAPSTV
FT                   TSWLAGHAGEQIQDDHPACREALDCTQSRIDNLLNSQGNTPVDSFHRDLGAIMINHCGI
FT                   SRHEKGLKQGLQAVAALSERFQHEVRVPGEAHGPNAELEKALRVSDFFGLADLMLRDAL
FT                   AREESCGAHFREEHQSAEGEALRDDANFAHIAAWEHNANGTPIRHTEALQFTTLKPSTR
FT                   SYK"
FT   gene            complement(591119..591745)
FT                   /locus_tag="Syncc9902_0586"
FT   CDS_pept        complement(591119..591745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0586"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25554"
FT                   /db_xref="GOA:Q3AZC3"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25554.1"
FT                   /translation="MTLTSTIRNANALSGLLLVLFLVVHLGGLTSVLGAPASFEAYASG
FT                   LHHNLWLRPLELGLGLTSFLHISLSLQKALRNRQAGNTADLVSRRGEPLAAWASRSKTI
FT                   AGVITLGFIGLHLQQLRFPRPLDGHEREALVHVLQQPFSLAMYCLGALAIGLHLVHGAE
FT                   AAHRSLGWLDPSNKSSIRFGGRMLAALVSGGFLLISLGLALDVGA"
FT   gene            591963..592967
FT                   /locus_tag="Syncc9902_0587"
FT   CDS_pept        591963..592967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25555"
FT                   /db_xref="GOA:Q3AZC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25555.1"
FT                   /translation="MAATCVCTLIFGLWKPAAPLPRDVAVAQPIDWELSQAKTVSPELP
FT                   ELNVGVYVTNINNIDLLDDQFSIEMLLWTEWAGDPAINPSDDLMVLNGIYDGDIQRFER
FT                   VSRENRLDTTWSLYRVRSSVVKHWRLQRYPFDTQILHVNIGLENPLQPINLGLTQENSF
FT                   SINPGLLLSGWSLDQPSSYVSSISLMSDLGQPLDESVVIRRQSTVSFDLPIQRRSLLFV
FT                   APDFLGYMLAVGLCCMSLLITHSRDDLILAAVVSAGGNYVFIAGNLPVTAMTGFIGNLQ
FT                   LIIFLGILYVVAADEMIDNQLTHYSQRISRILRVLLLPSYVGITILGIALIIP"
FT   gene            592978..594057
FT                   /locus_tag="Syncc9902_0588"
FT   CDS_pept        592978..594057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25556"
FT                   /db_xref="GOA:Q3AZC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25556.1"
FT                   /translation="MEPSSEKLSADHPHGLWTLVTTAISLVLLLVGGLLIQPRLVERRT
FT                   RIDDQFILTPTEVAALPSETLVVVLDREDGQDQNDFKYKLLQLILQRSGQPYAMGFSTM
FT                   IQSQDEAVEAISHGFDSQRNPMGLTVGVYGAGAALNEHLHPIEIPVAGGVLGLRAGWTY
FT                   REELPVLATIQEISDLQDIVLLQGLGWSDVEIFDAAGLRTYTARPEELFRLVDNRRVQL
FT                   FPRGIAELEDEEPVVRASTSRTVLDPYLLIAYPFAGFFYVAPDNQRLAQAIRSGFERAM
FT                   EDGSYQELIDQTVFTPWLKKYLNLAKRKVIVLNNPNAAEVLSAVNPGHWIVPWHKLLQG
FT                   TMNRGEELCTVQQLKALCD"
FT   gene            complement(594123..594512)
FT                   /locus_tag="Syncc9902_0589"
FT   CDS_pept        complement(594123..594512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25557"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25557.1"
FT                   /translation="MYLVTTKQEAHSIIKDCLAGNSSWVDTFNELGCILAFDLDPMLEG
FT                   SITVDFIIDDLWKKGIRATQDEVVKSICSYAIENNYVWSVETIFDNFDYTAKTLENLGE
FT                   DSKELLRDMAEDTESDVFKQMVTAL"
FT   gene            complement(595021..595323)
FT                   /locus_tag="Syncc9902_0590"
FT   CDS_pept        complement(595021..595323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25558.1"
FT                   /translation="MAVHKAFHNCDGTDPYDGIPLDGEQLMPISRGDRLNSSLTRQKCL
FT                   KRMPTVGHVHQKPIAEFEILSRQTHKAKNEMTSDEYLSHCRAVVSFRQITASDQQ"
FT   gene            complement(595784..597058)
FT                   /locus_tag="Syncc9902_0591"
FT   CDS_pept        complement(595784..597058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25559.1"
FT                   /translation="MKPRLEPLLWLQCLALGAIPLELLLIRLILAGADPGPVPPVERLL
FT                   IWAIGVLAPAAALWKRPADWGSLLLVRVPLKERDQAQQALSAKQGGLISRTSVAVAALG
FT                   SLPLLWWLDDSAVLASEFSPVLGQSRLVTLLISIPVLALMVWQVQQISQALGWLLPIRS
FT                   QLDEAASPGNTAEHNSIAADQQHTSFGLQILRLGQLDWPEPAAKTTPEPPPASEAVSSD
FT                   PVPTKNDPLDADAADQGQTTPTDSFNDPEKYNQPSLDESKSLEDEGLEDNGLEENNTET
FT                   NDVGLDIDPAEEDTSKVNINEANLEQLKDEQAVNDQAVNDEADNNEENIRAGDREITMD
FT                   AASVLETDPPEVAQRQDEDSVGAFGTVDVKEDGEESESPGLDPEVTEFNSVAGGNAEEH
FT                   CEQTESGGSEQGTPNEPPQATPRGE"
FT   gene            complement(597073..600603)
FT                   /locus_tag="Syncc9902_0592"
FT   CDS_pept        complement(597073..600603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0592"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25560"
FT                   /db_xref="GOA:Q3AZB7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25560.1"
FT                   /translation="MTSSGKVRIYELSKDLGLENKDVLDAAEKLSIAAKSHSSSISDSE
FT                   AGKIRSLLGKGASPSQPTAPAAKPAPAKPAAGKSILSVKKAPASPGVTAPVAAAKPQAP
FT                   AQPAASKPLQPSVKAVAPPARPAPAGSTSAGSTPNKPATAPARPTAATTTSTPRPAAAA
FT                   APSRPAPSKPQGAPKPQVVGKPSAPELVSKPTPATKPTGAAKPAIVSKPITAAKPAVVA
FT                   KPAAAKPTIVKPTAPTPRPASSPAAASSAPPPASTPRPAPSRPTPRPAAAPSRPGAPQG
FT                   QKPQIVSRAGAPPRPGTPPRVGAPTKTGTPARPTPRPELVGKPVPRRTGGVGAPQRPGT
FT                   GVPQRQGGPARPGAPTRTGKPGAPTRPGGNTLELVGKPIRRDGSSASGRPGAPTRPGAP
FT                   TRPGMPGGMRKPVAPGELMQLQKPISRPAAPAPRRPDAPNRPTEAAGTATPPVARPTAP
FT                   SAPRRPGFRPGAPGGQRRPGRPDWDDSAKLEALRSRSPQKQRQKVHIIGENDDALAAQT
FT                   GGFAGEQQAMVLSASLARPAKPKAQQRTAPKPVAAVRKRRKETARQRQRRRAMELRAAR
FT                   EAKQVRPEMIVVPEDNLTVQELADMLSIESSEIIKSLFFKGVIATVTQTLDMPTIEAVA
FT                   KEFDVPVLQDDVEEAAKKTVEMIEEADLKHLIRRPPVVTVMGHVDHGKTSLLDAIRQAR
FT                   VAAGEAGGITQHIGAYQVEIQHKDEARKLTFLDTPGHAAFTAMRARGTKVTDVAVLVVA
FT                   ADDGVRPQTLEAISHARAAEVPIVVAINKIDKEGASADRVKQELSEQNLLAEEWGGDVV
FT                   MVPVSAIKGENIDKLLEMLLLVTEVEDLQANPDRPARGTVIEAHLDKAKGPVATLLIQN
FT                   GTLKTGDVLAAGPVLGKVRAMVDDNRQRLKEAGPSFAVEALGFSEVPTAGDEFEVYPDE
FT                   KAARAVVGDRASNARATRLAQQMASRRVSLTAMSGQANEGELKELNLILKADVQGSVEA
FT                   ILGSLEQLPKDEVQVRVLLSAPGEITETDVDLAAASGAVIIGFNTSMASGAKKAADATG
FT                   VDVRDYDVIYKLLEDIQLAMEGLLEPELIEEALGEAEVRAVFTIGKSAVAGCYVNTGKL
FT                   HRNCRVRVHRGKQVVYTGDLDSLRRNKDDVKEVATGFECGVGADRFANWEEGDRIEAFK
FT                   MVTQRRKLTT"
FT   gene            complement(600673..600951)
FT                   /locus_tag="Syncc9902_0593"
FT   CDS_pept        complement(600673..600951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25561"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25561.1"
FT                   /translation="MSAKPILRRCVACRQLQDRRHLWRVIRDHKDGVLLDFGMGRSAYL
FT                   CPKEECLEEARRRKRLQKALRCQVPDAVLTTLNGRLSASTGESAEAN"
FT   gene            complement(600948..602405)
FT                   /locus_tag="Syncc9902_0594"
FT   CDS_pept        complement(600948..602405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0594"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25562"
FT                   /db_xref="GOA:Q3AZB5"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25562.1"
FT                   /translation="MALVLLPGLTNLIDDISEEKKLAPQVVEAALREALLKGYERYRRT
FT                   LYIGISEDPFDEDYFSNFDVGLDLEEEGYRVLASKIIVDEVESEDHQIALAEVMQVAED
FT                   AQSGDTVVLDVTPEKEDFGRMAAATTKQVLAQKLRDQQRRMIQEEFADLEDPVLTARVI
FT                   RFERQSIIMAVSSGLGRPEVEAELPRRDQLPNDNYRANATFKVFLKEVSEVPRRGPQLF
FT                   VSRSNAGLVVYLFENEVPEIQEGSVRIVAVAREANPPSRSVGPRTKVAVDSIEREVDPV
FT                   GACIGARGSRIQQVVNELRGEKIDVIRWSQDPGQYIANSLSPARVEMVRLVDPAGQHAH
FT                   VLVPPDQLSLAIGREGQNVRLAARLTGWKIDIKNSTEYDQPAEDAVVAELISQREEEEA
FT                   LQQEAEERLAVEQAARAEEDARLRELYPLPEDDEDYVEEAELSEEPSAEFVEGDAVIED
FT                   VEGETVAPEETGEASGDAETNMSEDAR"
FT   gene            complement(602445..602945)
FT                   /locus_tag="Syncc9902_0595"
FT   CDS_pept        complement(602445..602945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25563"
FT                   /db_xref="GOA:Q3AZB4"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25563.1"
FT                   /translation="MHVGHGLISVLLPHPLLPELEQLTQRVAGLQGFELCGIQLLTHMN
FT                   PITLQVQIRHTSGSDVNLDDCAGFSGVLGEALEESQQLVEAYVLEISSPGIGEQLSCDR
FT                   DFQTFRGFPVDVTHRDQGNVEHRLEGLLHERNTDSLQINIRGRIKSIPRDQVIEVRLTT
FT                   PGQ"
FT   gene            complement(603021..603218)
FT                   /locus_tag="Syncc9902_0596"
FT   CDS_pept        complement(603021..603218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25564"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25564.1"
FT                   /translation="MPDKVIFSSGPTGTRSKLWSRVCQYHKTAEQRSKCLNQDVELRGP
FT                   EQKGDAFPDAPSIDVNATNS"
FT   gene            complement(603319..604524)
FT                   /locus_tag="Syncc9902_0597"
FT   CDS_pept        complement(603319..604524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0597"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25565"
FT                   /db_xref="GOA:Q3AZB2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25565.1"
FT                   /translation="MVIAASNVRPDFSQFGPIGLVVIQSTSLCNLDCSYCYLPDRQKKR
FT                   VFDLNLIPLLVERILESPYAGPEFSLVWHAGEPLTLPTNWYDDATTLINQSLEHFGAQD
FT                   LEIDQHVQTNATLINNDWCDCFRRNEIVVGISVDGPEDIHDAHRRFRNGRGSHAMAMRG
FT                   IEALHRNQVPFHCISVITADAMEQPERMYRFYRDNGINDVGFNVEEKEGINTSSSMAGS
FT                   NMEAKYKDFLRTFWRLSEQDGYPVVLREFEQVISLIQGDRRMKQNELNRPFSILSVDAQ
FT                   GDFSTFDPELLSVASDRYGTFNLGNLKTHSLEESTRTESFQRLLQDMTQGVETCHKGCE
FT                   HFGLCGGGNGSNKFWEHGTLASSETNACRFGTKIPVEVLLERFEESPPIEVNRTTTASR
FT                   SS"
FT   gene            complement(604518..604907)
FT                   /locus_tag="Syncc9902_0598"
FT   CDS_pept        complement(604518..604907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25566"
FT                   /db_xref="InterPro:IPR026356"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25566.1"
FT                   /translation="MKRSLIAFQALLASSAVLCQSAEATSIFNAPDQTNNTVESRIDAA
FT                   RNGNWESLLKNAEPDEALVAKGKWKNGNGNKWSNGGKSSGKWGNGKGGGKFGNSRNSWG
FT                   NGGYRVGWGNGGGGWRNGGGGFANW"
FT   gene            complement(604957..605814)
FT                   /locus_tag="Syncc9902_0599"
FT   CDS_pept        complement(604957..605814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0599"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25567"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR026358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25567.1"
FT                   /translation="MRALLASTLGVIALGAPLFTTVDAAAGPFAKRTSLKAVIFEDVKP
FT                   LYQKSGDTYEGFGVDMLNLIKDQAGRRTLKFIPTTSAEDGMKAITSGKADIACGVAFDW
FT                   GRAEKVSYTIPFAIGGTRLLTKTTINGTPSSLRGRTVGVVKDSSSAKILETVVPSASLQ
FT                   AYATPAEAFAAYDSGKISTLAGGTLWLAANSDAKNSDLVPIRPYGRTGIGCIVKQNNGK
FT                   LLAAANNAIGQTMQEYVNGNAATREMVNRWIGPGSNVMLPESVITALYSLLLSTTSEMS
FT                   VSPN"
FT   gene            606000..607061
FT                   /locus_tag="Syncc9902_0600"
FT   CDS_pept        606000..607061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0600"
FT                   /product="PDZ/DHR/GLGF"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25568"
FT                   /db_xref="GOA:Q3AZA9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25568.1"
FT                   /translation="MLDTFLLSASPVQAVEHSFVAKSVRRVAPAVVRIDTERTVERQAF
FT                   DPTLIDPLLRDLLGDPQLGPERERGQGSGVVIDSKGLVLTNAHVVDRVESVSVTVADGE
FT                   QLDGHVVGFDPVTDIALVQLEGRNLPPKAPLGDSEVMEVGDWAIALGTPFGLERTVTLG
FT                   IVSSLHRNINSLGFSDKRLDLIQTDAAINPGNSGGPLVNGEGEVIGINTLVRSGPGAGL
FT                   GFAIPINLARRVADQLQEQGEVVHPYIGLQLVGLTPRIARDHNKDPNALVQLPERTGAL
FT                   VQSVLPQGPAEEAGLRRGDLVIAVDEKPVADPQALLEVVDAARLSEPLPLTVLRNGREL
FT                   TLSVKPAPLPGLG"
FT   gene            607099..607818
FT                   /locus_tag="Syncc9902_0601"
FT   CDS_pept        607099..607818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0601"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25569"
FT                   /db_xref="GOA:Q3AZA8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25569.1"
FT                   /translation="MADLQTQMKHAVADAAVEQIKDGMVLGLGSGSTAALMIRALGAKL
FT                   ASGELKNIVGVTTSFQGEVLAAELNIPLLSLNAVDRIDLAIDGADEVDPSFQLIKGGGA
FT                   CHVQEKLVAAMADRFVVVVDSTKLVDRLNLDFLLPVEVLPGAWRQIQKTLAAMGGSAEL
FT                   RMAQRKAGPVVTDQGNLVLDVKLEGGITDPASLEKAINNVPGVLENGLFVNLTDEVLVG
FT                   EISDGVAGVRSLERRLS"
FT   gene            complement(607811..609151)
FT                   /locus_tag="Syncc9902_0602"
FT   CDS_pept        complement(607811..609151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0602"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25570"
FT                   /db_xref="GOA:Q3AZA7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25570.1"
FT                   /translation="MRGMNPNRSLPEKSPAGFSLRIVRDPEQAKGELQRLVQRTAHAQQ
FT                   RDAQSRVDTILSEVRARGDAAVVEFTERFDGFRPNPVAVPQEQLERSWRNLPANLQDAL
FT                   ELAHRRITDFHQRQRPSDIATEGPYGERLGRRWRPVDRAGLYVPGGRASYPSTVLMNAV
FT                   PAKVAGVKEVVICSPAGRDGTVNPVVLAASHLAGVRTVFRLGGAQAIAAMAYGTNSVPK
FT                   VDVISGPGNLYVTLAKQAVYGQVGIDSLAGPSEVLVIADQSAKPDQVAADLLAQAEHDP
FT                   LAAAVLITTNPALAEQIPHEIEQQLEGHPRREICEASISNWGLVVVCDDLESCAELSDS
FT                   FAPEHLELLVERPQALAERIQHAGAIFLGPWSPEAVGDYLAGPNHTLPTCGAARFSGAL
FT                   SVETFMRHTSLIGFNRAALEATGSAVQELATSEGLHSHAESVRRRLN"
FT   gene            609252..609548
FT                   /locus_tag="Syncc9902_0603"
FT   CDS_pept        609252..609548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0603"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25571"
FT                   /db_xref="GOA:Q3AZA6"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25571.1"
FT                   /translation="MANNNSAKKRIEIAERNRLRNRTYKSSMRTLMKRCFSACDAYGSA
FT                   PGEEAKASVQASLREAFSKIDKAVKVGVLHRNNGANQKSRLSSAVRKVLEPTS"
FT   gene            609596..610384
FT                   /locus_tag="Syncc9902_0604"
FT   CDS_pept        609596..610384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0604"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25572"
FT                   /db_xref="GOA:Q3AZA5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033665"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25572.1"
FT                   /translation="MSPTSTLIDSHCHIVFRNFEEDLDEVATRWRDAGVRALLHACVEP
FT                   AEIPAIRALADRFPEMRYSVGVHPLDTQHWCPDTVDVLRQAALDDSRVVAIGELGLDLF
FT                   RDKNLEEQLAVLRPQLDLAVELNLPVIVHCRDAAEPMLDELRTRRSEGLCPTGVMHCWG
FT                   GTPEEMHAFLDLGFYISFSGTVTFPKALATHACAEQVPEDRFLVETDCPFLAPVPRRGK
FT                   RNEPAFVASVASRVADLRGVDVDRVAAVTTSNARRLFKLP"
FT   gene            610672..613965
FT                   /locus_tag="Syncc9902_0605"
FT   CDS_pept        610672..613965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0605"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25573"
FT                   /db_xref="GOA:Q3AZA4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25573.1"
FT                   /translation="MSSSAIQVAKTATFLPDLVEVQRASFKWFLDKGLIEELESFSPIT
FT                   DYTGKLELHFIGSEYRLKRPRHDVEEAKRRDATFASQMYVTCRLVNKETGEIKEQEVFI
FT                   GELPLMTERGTFIINGAERVIVNQIVRSPGVYFKDEMDKNGRRTYNASVIPNRGAWLKF
FT                   ETDKNDLLHVRVDKTRKINAHVLMRAMGLSDNDVLDKLRHPEFYKKSIDAANDEGISSE
FT                   DQALLELYKKLRPGEPPSVSGGQQLLQTRFFDAKRYDLGRVGRYKINKKLRLTIPDTVR
FT                   TLTHEDVLSTLDYLINLELDVGGASLDDIDHLGNRRVRSVGELLQNQVRVGLNRLERII
FT                   KERMTVGETDSLTPAQLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRISALG
FT                   PGGLTRERAGFAVRDIHPSHYGRLCPIETPEGPNAGLINSLATHARVNEYGFIETPFWK
FT                   VENGVVIKSGDPIYLSADREDEVRVAPGDVATEDNGEIKADLIPVRYRQDFEKVPPEQV
FT                   DYVALSPVQVISVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPERALVGTGLETQVA
FT                   RDSGMVPISRVNGTVVYVDANAIVVLDEDGQEHTHFLQKYQRSNQDTCLNQRPIVHQGD
FT                   PVIVGQVLADGSACEGGEIALGQNVLIAYMPWEGYNYEDALLVSERLVTDDLYTSVHIE
FT                   KYEIEARQTKLGPEEITREIPNVAEESLGNLDEMGIIRVGAFVESGDILVGKVTPKGES
FT                   DQPPEEKLLRAIFGEKARDVRDNSLRVPGTERGRVVDVRIYTREQGDELPPGANMVVRV
FT                   YVAQRRKIQVGDKMAGRHGNKGIISRILPREDMPYLPDGTPVDIVLNPLGVPSRMNVGQ
FT                   VFELLMGWAASNLDCRVKIIPFDEMHGAEKSQQTVTTFLTEAAKLSGKDWVYNPENPGK
FT                   LVLRDGRTGLPFDQPVAVGYSHFLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQ
FT                   RLGEMEVWALEAYGAAYTLQELLTVKSDDMQGRNEALNAIVKGKPIPRPGTPESFKVLM
FT                   RELQSLGLDIAVYTEEGKEVDLMQDVNPRRSTPSRPTYESLGVADYDED"
FT   gene            614027..615931
FT                   /locus_tag="Syncc9902_0606"
FT   CDS_pept        614027..615931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0606"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25574"
FT                   /db_xref="GOA:Q3AZA3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR012755"
FT                   /db_xref="InterPro:IPR034678"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25574.1"
FT                   /translation="MTNSNLRTENHFDYVKITLASPERVMEWGQRTLPNGQVVGEVTKP
FT                   ETINYRTLKPEMDGLFCEKIFGPSKDWECHCGKYKRVRHRGIVCERCGVEVTESRVRRH
FT                   RMGFIKLAAPVSHVWYLKGIPSYVAILLDMPLRDVEQIVYFNCYVVLDPGDHKDLKYKQ
FT                   LLTEDEWLEIEDEIYAEESEIENEPVVGIGAEALKQLLEDLSLEEVAQQLREDINGSKG
FT                   QKRAKLIKRLRVIDNFIATGARPDWMVLDVIPVIPPDLRPMVQLDGGRFATSDLNDLYR
FT                   RVINRNNRLARLQEILAPEIIVRNEKRMLQEAVDALIDNGRRGRTVVGANNRPLKSLSD
FT                   IIEGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQ
FT                   NIVNNIKAAKKLIQRADDEVMQVLQEVIDGHPIMLNRAPTLHRLGIQAFEPKLVDGRAI
FT                   QLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGEPIITPSQDM
FT                   VLGSYYLTALQPDATQPEFGDRSATFAGLDDVIHAFDDTRIGLHDWVWVRFNGEVEDDD
FT                   ELQEPLKSETLSDGTRIEQWTYRRDRFDEEGALISRYVLTTVGRVVMNHTIIDAVASA"
FT   gene            615979..620073
FT                   /locus_tag="Syncc9902_0607"
FT   CDS_pept        615979..620073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0607"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25575"
FT                   /db_xref="GOA:Q3AZA2"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012756"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25575.1"
FT                   /translation="MTTSKPRKPSKAKAAKAAKAAKAALEKISKPLSKTPPPFRNHIID
FT                   KKALKNLVAWSFKHHGTAVTSSMADDLKDLGFKYATQAAVSISVDDLKVPAAKKDLLGQ
FT                   AEEQITATEERYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFDENAPLNSVWMMAN
FT                   SGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGARKGLVDT
FT                   ALRTADSGYLTRRLVDVAQDVIVREDDCGTMRHIVVEAEDSKFAKRLVGRLTAAQVVSA
FT                   EGEVLAERDTEIDPALSSKIEKAGITAVSIRSPLTCEANRSVCRKCYGWALAHNELVDL
FT                   GEAVGIIAAQSIGEPGTQLTMRTFHTGGVSTAESGVVRSKVAGDVEFGSKARVRPYRTP
FT                   HGVEAQQAEVDFTLTIKPSGKGRPQKIDITLGSLLFVDNGQAIESDVTVVQIAAGAVQK
FT                   SVEKATKDVICDLAGQVHYEDKIQPREVTDRQGNITLKAQRLGRMWVLAGDVYNLPPNA
FT                   LPVVDGKSTVTEGQVLAEASQRSEFGGDVRLRDSIGDSREVQIVTTAMTLKDFKLLEES
FT                   NHSGELWNLEAKDGTRYRLNTIPGSKIGNGEVIAELADDRFRTGTGGLVKFAPGLAIKK
FT                   ARSAKNGYEVNKGGTLLWVPQETHEINKDISLLMITDGQWIEAGTEVVKDIFSQTAGVV
FT                   TVTQKNDILREIIVRGGDLRLISDNKALERFEGDGQMVNPGDDVAKGVSVDTMKFVQTV
FT                   ETPEGKGLLLRPVEEYTIPNEAQLPELSHLKQANGPHLGIKATQRLAFKDNELIKSVEG
FT                   VELLKTQLLLETFDTTPQMTVDVERAPDKRAKTISRLRLVILESILVRRDTMSDSSHGS
FT                   THTDLQVEDGISVKAGDVVATTQILCKQEGVVQLPEATEAEPVRRLIVERPEDTTTIST
FT                   SGKPSVAVGDRVVDGDLLASGQPSDCCGEVEAVDGSSVTLRLGRPYMVSPDSLLHVRDG
FT                   DLVQRGDGLALLVFERQKTGDIVQGLPRIEELLEARRPRDSAILCRKPGTVEIKQGEDD
FT                   DSLSVNVIESDDAIGEYPILLGRNVMVNDGQQVTAGELLTDGPINPHELLECFFEDFRS
FT                   RKPLMDAAQEAIANLQHRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRVEDAGDTT
FT                   LLPGELIELRQVEDTNQAMAITGGAPSEFTPVLLGITKASLNTDSFISAASFQETTRVL
FT                   TEAAIEGKSDWLRGLKENVIIGRLIPAGTGFSGFEEELQKEAGPHPDILSEDPAGYRRM
FT                   QNLRPDYTVDMPPAASSSALLADPSDADLEATRTRHNIDPSASTNAAFTRPDVDNELKE
FT                   EQVVDAEAVEGLQEEGLLSDD"
FT   gene            620107..620259
FT                   /locus_tag="Syncc9902_0608"
FT   CDS_pept        620107..620259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0608"
FT                   /product="putative high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25576"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25576.1"
FT                   /translation="MIEPTEIPQRRLPRYGFHGHTEKLNGRMAMLGFIALLIVEFKLGH
FT                   GLLNW"
FT   gene            620256..621311
FT                   /locus_tag="Syncc9902_0609"
FT   CDS_pept        620256..621311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0609"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25577"
FT                   /db_xref="GOA:Q3AZA0"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25577.1"
FT                   /translation="MKNVLLGRSAAELEDWAVAQGHKSFRGRQIHDWLYNKGVKSLSEI
FT                   SALPKQWRTELEAQTFRVGRLKLVHQSVAADATTKLLLATDDGETIETVGIPTDQRLTV
FT                   CISSQVGCPMACRFCATGKSGLQRSLATHEIVDQVLSVREAMDRRPSHVVFMGMGEPLL
FT                   NSEAVLETIRCLNTDLGIGQRRITVSTVGVPKTLPQLAELAMEKLGRAQFTLAVSLHAP
FT                   NQQLREELIPTAHAYPYDDLLDDCRHYLDLTGRRVSFEYILLGELNDHPEHAAELADRV
FT                   GGFQSHVNLIAYNPIEEEEFKRPTSQRIEAFRRVLERRGVAVSLRASRGLDQNAACGQL
FT                   RRQHLTGSDLT"
FT   gene            621529..623292
FT                   /locus_tag="Syncc9902_0610"
FT   CDS_pept        621529..623292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0610"
FT                   /product="sodium:solute symporter family, possibly glucose
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25578"
FT                   /db_xref="GOA:Q3AZ99"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25578.1"
FT                   /translation="MAAVDWLLLGLYLLLTFLLGLWLARRNRGQEDYFVAGRRLNGWLA
FT                   GASMAATTFSIDTPLYIAGLVGSRGLAGNWEWWSFGLAHVAMAVVFAPLWRRSGVLTDA
FT                   AFTELRYGGAAAAWLRGIKAFLLALPVNCIGIGYAFLALRKVVEALGIVRGEPSFLGLS
FT                   DTVWLLAIVALLVVSYTVVGGLWAVVMTDLVQLVLALLGALAVAVAALHATGGMASLLD
FT                   QLQALNRPELLSLVPWTWDEKGFTWLDGAGISVPMFTAYIAVQWWSFRRSDGGGEFIQR
FT                   MLATRDEQQARLAGWVFLVVNYLIRSWLWVVVALAALVLLPAQADLELGYPKLAVDLLP
FT                   PVALGLVVVSLVAAFMSTVSTSVNWGASYLTHDLYERFIRPQAGPRELLLVGQATTVLL
FT                   LVLGVMTALVSNSIGSVFRLVIAIGSGPGVVLVLRWFWWRVNAAAELSAMLCGFLVGVL
FT                   TSITPLVRIDDYGVRLAVITGVSAAVWLTVMLCTPPESEAVLERFVRQVRPPGPGWAHL
FT                   RRRFEVTPIESFPVMLQRFVWACGLLFGGLLGTGGFLLHQHITGWCGLSVLVVSFLVLR
FT                   RPALAVQSSSE"
FT   gene            623289..623438
FT                   /locus_tag="Syncc9902_0611"
FT   CDS_pept        623289..623438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25579"
FT                   /db_xref="GOA:Q3AZ98"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25579.1"
FT                   /translation="MNNELGCPLSFFRSTVLPALIVLLFALALFAVSARIWLPGDMLAP
FT                   APVG"
FT   gene            623478..624290
FT                   /locus_tag="Syncc9902_0612"
FT   CDS_pept        623478..624290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0612"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25580"
FT                   /db_xref="GOA:Q3AZ97"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25580.1"
FT                   /translation="MTDDRSQQRDRGPASLSLDPDLLARELAAEESLDPLDAFEPDVAV
FT                   DDASPSIALACDQGLLALRGNHDQRLQGLQVFCEHRDPRALPLLLPLLQRPCPVERMSA
FT                   VYALGRNPSPPAVESLLRLLQVDSNAYVRKAAAWSLGNYPDAPILNPLIHALQTDVAAV
FT                   RLWCPGSLAESGSRSPAKADPAASQLVASLQIDSEPVVRSNCIWALGRLMDHLVEPRQQ
FT                   EIVEVLVESLLYDGESSVQDEARTALEQLEDPMVLERLQTLMNDGFLI"
FT   gene            624353..624556
FT                   /locus_tag="Syncc9902_0613"
FT   CDS_pept        624353..624556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25581"
FT                   /db_xref="InterPro:IPR021375"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25581.1"
FT                   /translation="MPQRTVRFTIRPDGRVEERVEGVTGSACQQLTERLEAALGTVERQ
FT                   EPTAESFQQPNTQSQSLPAQLN"
FT   gene            624556..624948
FT                   /locus_tag="Syncc9902_0614"
FT   CDS_pept        624556..624948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25582"
FT                   /db_xref="InterPro:IPR009666"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25582.1"
FT                   /translation="MSHFSTVKTELRQLDPLVQALKDMGYPPEQGERPVRGYQGQTVTA
FT                   DLAVTMQVGGDLGFRWNAQSGAYELVTDLDLWKQQIPIERFLAKLTQRYALNTVLAATA
FT                   NEGFQVAEQTQAQDGSIELVVTRWDA"
FT   gene            625020..625298
FT                   /locus_tag="Syncc9902_0615"
FT   CDS_pept        625020..625298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0615"
FT                   /product="possible 3Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25583"
FT                   /db_xref="GOA:Q3AZ94"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25583.1"
FT                   /translation="MLGGDLRDQAVWVDEAVCIGCRYCAHVATNTFVVEPHLGRSRAIR
FT                   QDGDSTERIQEAIDTCPVDCIHWVPFESLEALKRDLMRQNLQARPQG"
FT   gene            625298..626500
FT                   /locus_tag="Syncc9902_0616"
FT   CDS_pept        625298..626500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25584"
FT                   /db_xref="GOA:Q3AZ93"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25584.1"
FT                   /translation="MASLPTRRFGRTELDIPLLSLGAMRFQQSWSDLPAEEISETSQSQ
FT                   LQATLNRAVAEGFHHVETARHYGTSERQLGWALPKAPDAKRLLQSKVPPRDDVVAFEAE
FT                   LELSFERLDCDRLDLLAIHGINLPEHLEQTLRPGGCMEVVRRWQAEGRIGSVGFSTHGP
FT                   TELIVDACNTGAFDYINLHWYYIRQDNGPALDAARRQDMGVFIISPTDKGGHLHSPSQK
FT                   LLDLCAPLHPIVFNDLFCLQDERVHTISVGAASPQDFDRHLKAIELLPQAVDLIEPVHQ
FT                   RLERAAVDALGPEWMATWHVGLPSWQDTPGEINLPVLLWLHNLLEAWDLQSFATARYRL
FT                   LGQGGHWFAGSNADSFDDQVSASALQAVLGASPWRTRIPMILAQLKQRLAGDSQKRLTS
FT                   L"
FT   gene            complement(626508..627239)
FT                   /locus_tag="Syncc9902_0617"
FT   CDS_pept        complement(626508..627239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0617"
FT                   /product="Glucose inhibited division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25585"
FT                   /db_xref="GOA:Q3AZ92"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZ92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25585.1"
FT                   /translation="MADATPGAEYWTALGWQPSTEQVDQLATLQTLLREWNEKVNLTRL
FT                   VEGDDYWINQVFDSLWPLAHELKTPHQPRTCIDVGTGGGFPGLAIAIALPGSHMTLLDS
FT                   VGRKTAAVEAMASRLGLADRVAVRTERIETTGHDRACRGQFDLAMARAVAAAPVVAEYL
FT                   VPLLKPKGEALLFRGQWSEEDTTEFSSVISPLKAQLTGVQTCQLPAKRGIRHLLRVQPI
FT                   GSCPSSYPRAVGIPSRTPLGS"
FT   gene            627266..627808
FT                   /locus_tag="Syncc9902_0618"
FT   CDS_pept        627266..627808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0618"
FT                   /product="Heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25586"
FT                   /db_xref="GOA:Q3AZ91"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25586.1"
FT                   /translation="MKDQIKSVPDVSISHYQRLGVAPGVDPEALRQAFRRKSKALHPDT
FT                   TALPEAQASLAFQQLKESYALLADPGRRDAYDAMLRETTARPHVVQKSTSDPWNGIGER
FT                   RPLSGGEWFSLVLLSLALLLSLLLGLGVAVVQGRDWQVSPSWLTDEQTLRTSNVRSDVV
FT                   LPPTGEFTTESALPPSA"
FT   gene            627825..628022
FT                   /locus_tag="Syncc9902_0619"
FT   CDS_pept        627825..628022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25587"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25587.1"
FT                   /translation="MGAIRIDNDPCRWQLERPDWSAVLLLDREDLKVIWQASGTSTDTQ
FT                   CSLPYGLSRADVEAAIQAGP"
FT   gene            complement(628051..629325)
FT                   /locus_tag="Syncc9902_0620"
FT   CDS_pept        complement(628051..629325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0620"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25588"
FT                   /db_xref="GOA:Q3AZ89"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25588.1"
FT                   /translation="MVLQRHPNLWPPFTQMASAAAAQRVTAGDGALLLREEGPPLIDAI
FT                   SSWWVTLHGHANPVMAEAIADQARRLEQVIFADFTHEPAEQLAVRLSGITGLQRLFFSD
FT                   NGSTAVEVAIKIACQWWANRGQPRHQIVAFDGAYHGDTFGAMAVGERNLFSAPFEDKLF
FT                   PVARVPWPSTWWNDDDVDRKETAALQILEDTLQTPTAAVILEPLLQGAGGMTMVRPEFL
FT                   REVERRTKAAGALLIADEVLTGFGRCGDWFASRRAGIRPDLMALSKGLTGGCLPMGVTM
FT                   ASEAVFEAFIGDDPNLTLWHGHSFTANPLGCAAANASLTLLEQNPTAFQNFEARHRPQL
FT                   EALAQHPRVERPRLLGTVAAFDLVVGGTAGYLNPAGPTVKRIAMEHGVFLRPLGQVVYL
FT                   LPPLCITDAQLEQCYKAIQTALDQL"
FT   gene            complement(629608..630267)
FT                   /locus_tag="Syncc9902_0621"
FT   CDS_pept        complement(629608..630267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0621"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25589"
FT                   /db_xref="GOA:Q3AZ88"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25589.1"
FT                   /translation="MTSPSRRIVVCGTDTDVGKTVVSAWLVQGLEASYWKPIQSGLDGG
FT                   GDRERVRNLLDLPPQRLLPEAFAFSQPVSPHWAAELDQSPLVPEQLTIPPCDGALVVET
FT                   AGGLMVPLTRQLLQIDQLQHWGLPIVLVARSGLGTLNHTLLSLEALRHRNLPVLGLILN
FT                   GPHHSDNPTTLETFGGIPVLAQLPPLHPLNRDALQQQWQDQRLSPKFQELLDRTSR"
FT   gene            complement(630264..631028)
FT                   /locus_tag="Syncc9902_0622"
FT   CDS_pept        complement(630264..631028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0622"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25590.1"
FT                   /translation="MDRKPVIASEDVLKQFSDAADRYNHAARLQEGMAWRLAGHCRQLR
FT                   IPRGLWVDLGSGTGRLADALEVTHPGQSVLRVDGSAAMLQQQKPSATTLQWDLSRGLPP
FT                   WPKQPQLLSSSFALHWLPNPVQSLRMWIQSLQPGSWLVLAVPIEGSFPQWHAAAVAAGE
FT                   LCSALSLPVGDELTAAIPPGMVQRQQLLQFSQTADSPASLLKPMIEIGAGSTTANRLPP
FT                   GAWRRIFKAWPQASITNRFALSWRIQLLILSR"
FT   gene            complement(631010..631699)
FT                   /locus_tag="Syncc9902_0623"
FT   CDS_pept        complement(631010..631699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25591"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25591.1"
FT                   /translation="MTQILAVHGWAGHAEQWTYWRRLMEQRQWPMQVMERGYGNNTPTR
FT                   PSWTDKAGPRVVIAHSLGLHFLPEPLLQEATALVLLGCFTTFVPEGRNGRSTQAGLKGM
FT                   RAALGSEGEEAMLKRFFQRSNQPLSLSACPPSPLLKGISSEGRQRLHDDLILLETCRNF
FT                   PLGWPSKARVLVIQGGQDAVVHPNSHQQLLDQLGSQVERIHRGPDWGHALITTEVLAVV
FT                   ERWIESL"
FT   gene            complement(631696..632841)
FT                   /locus_tag="Syncc9902_0624"
FT   CDS_pept        complement(631696..632841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0624"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25592"
FT                   /db_xref="GOA:Q3AZ85"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25592.1"
FT                   /translation="MTSEPISSVESSRRRSLRSWRPGDQPWELKGSSTGRKSLRDLASN
FT                   DYLGLARHPAVIEAAALALDVDGVGAGGSRLVTGTRPRHTHLEEELGEWLGRDQVLLFP
FT                   SGFQANLAAVAALAERHTTVLADRLIHYSLLVGVRASGARLQRFAHNDLEDLDRRLHRL
FT                   DRNNTAPVVISESLFSMEGTSPDLKAMAALCARHGAQLLVDEAHGLGVLGLGGRGLCWG
FT                   VNDPVHLISGTFGKAFGSGGAFLAGDAAMGERLLQTSGAFRYTTALAPPLVAGAQAALD
FT                   LIKANPHWGQALIQRSEAWRTALALAGWQRPLGIGPVLPLLLNSDQAALDYQQQLEQHG
FT                   LLSIAIRPPTVPEGTSRLRLVLRKDLPDDTLELLLGALAAG"
FT   gene            632884..633819
FT                   /locus_tag="Syncc9902_0625"
FT   CDS_pept        632884..633819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0625"
FT                   /product="sodium/bile acid cotransporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25593"
FT                   /db_xref="GOA:Q3AZ84"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25593.1"
FT                   /translation="MNSERFTLLFPLWTLMGAGLALLYPPLFTWFRGDLITMGLGVIML
FT                   GMGLGLTPQDFVRVGQRPRPVVIGVLTQFIVMPSIAALLAFALHLSPPLAVGLILVGCC
FT                   PGGTASNVVALIGRADVALSVVMTTVSTLVAVVLTPQLTALLASQYVPIDGGLLLIKVL
FT                   QVVLFPVALGVLLKQGLPRLASRVEPVMAPLAVLAIVMIVASIVGSQANVLQQQGARLF
FT                   LACVLLHGAGFLLGWLVPLLVGEGVLVQRTISIEVGMQNSGLAVVLARSGGFSSPITAL
FT                   PGAISAVIHCLIGSALAALWRQKSRQQSKA"
FT   gene            complement(633816..634079)
FT                   /locus_tag="Syncc9902_0626"
FT   CDS_pept        complement(633816..634079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25594"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25594.1"
FT                   /translation="MTETLRRNDVATSQLLQTLPSEDTLIDALRGCRHTEELEALEQRL
FT                   RGVSEAPPLFEWICDLLVARRISRGLAARLLTQLHSQQQPST"
FT   gene            634320..637100
FT                   /locus_tag="Syncc9902_0627"
FT   CDS_pept        634320..637100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0627"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25595"
FT                   /db_xref="GOA:Q3AZ82"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25595.1"
FT                   /translation="MTKAQPEPSTQASDAAASGSGLDPSQCFAFPLDDFQLEAIDALNQ
FT                   GHSVVVSAPTGSGKTLVGEYAIYRALAHGQKVFYTTPLKALSNQKLRDFREQFGDENVG
FT                   LLTGDLSVNREASIVVMTTEIFRNMLYAEADEHDDPLADVEAVVLDECHYMNDSQRGTV
FT                   WEESIIHCPPPIQLVALSATVANAGQLTDWIEKVHGPTTLIVSDHRPVPLQFSFCSAKG
FT                   LHPLLNEAGTGLHPNCKVWRAPKGQKRKGRSNKPPQPEAPPISFVVAQMAQRDMLPAIY
FT                   FIFSRRNCDKSVRDLGAQCLVTQDEQARIQARFAAYSAANPEAVRDGIHADALMRGIAA
FT                   HHAGVLPAWKELIEELFQQGLVKVVFATETLAAGINMPARSTVIASLSKRTERGHRPLM
FT                   GSEFLQMAGRAGRRGLDSQGYVVTVQSRFEGVREAGQLATSPADPLVSQFTPSYGMVLN
FT                   LLQRHSLEKARELVQRSFGRYLAGLDLVDDEEMLSQLRLQLSQLDGVAGDVPWEDFEDY
FT                   EKERGRLREERRLLRILQQQAEETLANELTQALQFASNGALVSLKSAQLRGRVTPAVIV
FT                   EKVNGPGQFPRLLCLTDDNVWILLPCQGVVSLHAELSCLQVDGVVPPMLQRSGEIRHGD
FT                   QASGQLALAVSHMAKRHDMTTPQYDLAGEVLTQARLVQQLELDLEQHPAHRWGDRKQLK
FT                   KHRRRMEELEHEIAERQRLLHHRSNRHWDMFLALKDILQQFGCLDDLDPTEVGRTVAAL
FT                   RGDNELWLGLALMSGHLDELDPPNLAAVFEAISTEVNRPDLWSGFPPSGPAEEALQDLS
FT                   GLRRELLRAQERASVVVPAWWEPELMGLVEAWAKGTSWVDLIANTSLDEGDVVRIMRRT
FT                   VDLLAQVPYCEAISEQLRSHAKQALKAINRFPVAELEDPRAAVSGGLNPATERAA"
FT   gene            634879..634968
FT                   /gene="tRNA-Ser1"
FT                   /locus_tag="Syncc9902_R0004"
FT   tRNA            634879..634968
FT                   /gene="tRNA-Ser1"
FT                   /locus_tag="Syncc9902_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(637103..638500)
FT                   /locus_tag="Syncc9902_0628"
FT   CDS_pept        complement(637103..638500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0628"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25596"
FT                   /db_xref="GOA:Q3AZ81"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25596.1"
FT                   /translation="MTRSFRTEHDSLGPVEVSDDALWGAQTERSLRNFAISNEQIPVEL
FT                   IHALALIKQGCAAVNARHGVLSQELADMITSAANAIATGKHDDQFPLKVWQTGSGTQTN
FT                   MNVNEVISNLISRREGTPLGSHQPVHPNDHVNRSQSTNDVFPAAIHVAATQQLTHSLLP
FT                   AVQALIDAFDLKAEAWFPIVKIGRTHLQDAVPLRLGDEVSAWRDQLKLCRSWIEDSLTP
FT                   LAALPLGGTAVGTGLNAPKGFSTDVAKELFSATGLSFHPADNLFAVMAGHDALVHAMGQ
FT                   LRGLAVALLRISNDIRLLGCGPRAGLGELRLPANEPGSSIMPGKINPTQCEAMAMVCTQ
FT                   VIGLDAAVAAAGAGGHLQMNVFKPLIGFNLLQSIRLLSDAINSFRQNLVVGLEPNHQQI
FT                   QAFVERSLMLVTALTPRIGYEKASAIAQHAHEQGLTLKEAALKLGHISASDFDQLVDPI
FT                   KMAIPHE"
FT   gene            638606..639121
FT                   /locus_tag="Syncc9902_0629"
FT   CDS_pept        638606..639121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25597"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25597.1"
FT                   /translation="MKVHRSHRLDLDLPGGTAAQLEAYLSDPTRPLKALLNRKKIKQAE
FT                   DGRFYYISRPYSLLMFRIQPEVIFRSCWTDARLQIEFEDCTIRGLGNLDSLVMFCCRAT
FT                   IFPRDMGLVAEADLSLEMKSESATVWIPRGVLQAMGEKALQLIVERLEKRCRTGLLRGA
FT                   KGWILECT"
FT   gene            639197..639997
FT                   /locus_tag="Syncc9902_0630"
FT   CDS_pept        639197..639997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25598"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25598.1"
FT                   /translation="MSIHQVLNSSSSAEPILVFDEFVLRADKSDSSVVISSPWNWWLNP
FT                   GDRLSVMTTNSFLSYQLMATLADFVKPVSGEVVKRGTVSWPLGGEGGLDGKLSIDQSLD
FT                   FLSNIYSDCFEKSRVTLQEFYEVLQAQSIEPSLKLKELDKDQKDYFYMALSILFSFDVY
FT                   LVPKFRYLMSRKAVPLRALLHRQLEGCSLISTGGNNRFRREFCNKGLVLDGFGEVIFQG
FT                   DLEQAIVLIDQKNDDSGKVDSDEDQFDFGDSLKNSDQDEPNDVL"
FT   gene            640016..640849
FT                   /locus_tag="Syncc9902_0631"
FT   CDS_pept        640016..640849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0631"
FT                   /product="possible ABC transporter involved in
FT                   polysaccharide efflux"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25599"
FT                   /db_xref="GOA:Q3AZ78"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25599.1"
FT                   /translation="MNLIKRIIYGLRRQWIVINSVAVYDRNRQAAGSSLGAWENLIGPA
FT                   QMMAFFILMRVGFSFLRGNNRFAAGGSTDMYFNIVVFMSTGFCIAFLFRNVAIKSLSGL
FT                   KLRAPLYYSRIKPLDILLALSLNDMRALATLSLAILGLVYYFTWSFQLDSPGLAISVYL
FT                   LTVMMALGFGLSVVFLGKLNKWILKIIKRLIQRVIIFTSGIFFATFEIPAHIRPFVTWN
FT                   PILHGVELFRYSINNEYPIPDISLSYLMLCSILMLSFSLILYRTNESLLLESNDD"
FT   gene            640901..642112
FT                   /locus_tag="Syncc9902_0632"
FT   CDS_pept        640901..642112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0632"
FT                   /product="possible ABC transporter involved in
FT                   polysaccharide efflux"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25600"
FT                   /db_xref="GOA:Q3AZ77"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25600.1"
FT                   /translation="MANRSISPLKSTAASSFGSVDKFIRLKLSAFDNSSNAWQGRFEIL
FT                   KKPRVLISLFLATSAFYCFAIGRDRYTSVSEFVIQQAAPLETSSASVLAGAAAAPQVLT
FT                   SLVDGQYLQVYLASSEVKNRLFPNSVSLEKDYKQSFPDVFSGLSTGSSSPQQLSFYRKQ
FT                   LQISPQPLSGSVIIRTVGYAPEQAFSLNQSLILQSRRFVNEVNQSINADQNIFAKKEVE
FT                   LAENNLKEASRRLEIFQDKFGQLNVASEQAATSSFISELESRLVDSKVEEATLRRQYRD
FT                   PNAPEVSFVADQVRELEKQITKERQKSVSEYGSDLNSLAIQESSLLSNVEFATESLQSA
FT                   RLAADNSRRESQRQLKFVVMLSQPQRPVAPDQNWRWQVFLGSIGIIVVAWGVGGFILAA
FT                   MKEA"
FT   gene            complement(642133..645618)
FT                   /locus_tag="Syncc9902_0633"
FT   CDS_pept        complement(642133..645618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0633"
FT                   /product="Lipopolysaccharide biosynthesis protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25601"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25601.1"
FT                   /translation="MAKAPKKNQFKLSIPSGRQLLRTTARRLSREGIIPGFIRQQLKRR
FT                   ISTDSKAPDNRRQKITPELQAYIRKIDNNQISKTQYRDIRELAHYAYIFDVNFYKKQLP
FT                   DTELKEVNNLGNCLEHYCTKGWKAGIDPSPLFDTNNYFSKYPDIKESEINPMVHFLKFG
FT                   IQESRYSMDDIHFMRKTAGIKKATYSNDGKLISSIGQKKFGVFLHIFYPELAPIIADYI
FT                   RKIPVKIDIHISTTHDAISGLTEIFKGLENSLNVQVKSFPNIGRDVAPFIVGFREEIPK
FT                   YDYILKLHSKKSPHSNALSGWFEHCLDNLIGSIDVFYTNIQELNKEDISIVYPVENYAL
FT                   SLGIKHDSCWGHEDGNYNKAKTLLKKLGLEQINRNSEFLFPTGNMFWCKPDILKPILDW
FT                   DLKFEDFDNEGGQIDGTLAHSIERLIGLCCTEYFHKKIITSYCGYAESKQHQSDKKVIE
FT                   GRNKLQIDGFEKVIQFKEKTLNPSWKNHNNASPNQLQIHWVIPNFTRGLGGHMTIFRTI
FT                   DYLERCGHDCTIWVHSEIKGDKPSRLSSLHKRVIDQSFIKLKTDQVYMLGNTNDDLEKV
FT                   SGDVVIATDRMSTYPVLGMRKFAKRFYFVQDYEPFFFAKGTSTVLTEQTYRSNHKFACI
FT                   CASPWLKNMMIEQGNSAISFPLAVDTDTYYQSKKIIRSKNTIAFYVRRSTPRRLYQLGL
FT                   LALRALFDLGDSFEIITFGENYLPDLGIPVKITHAGILNSESLSKLYQRSTAGLVLSGT
FT                   NYSLVPNEMMACGLPVVDIDAPHTRLSYTSNTAILAQPNPEALAAALSQLLNDDVLREQ
FT                   ATIAGLTATKSLTWDRSNTIVESFIRTQFEAALPPDQNQNLPQADPTVTIVIPVYNGGD
FT                   QLISVVETCLQQDLDAEFEILIIDSSSTDGCINHLPKDERIRIHRISKSDFGHGRTRNL
FT                   GVSLARGEFVAFITQDAIPANRMWLMNLIEPLQTDRKIAGVFGCHIAHEGHNPLTSYDL
FT                   DQHFNRWIFRSHRKPIELEESRKKPNAPISNHERFYSDNNSCLRKNAWEQVPIPEVIYG
FT                   EDQLWAIDILRHGFKKAYASTAIVRHSHEYNFRETLIRANTEWHFYQQHLGEYLPSTKK
FT                   DVRAMIESSCTNDKKAQELFPEITEEQLIARRKLHFARACGYYFAGKGIGSIRP"
FT   gene            complement(645634..646761)
FT                   /locus_tag="Syncc9902_0634"
FT   CDS_pept        complement(645634..646761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0634"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25602"
FT                   /db_xref="GOA:Q3AZ75"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25602.1"
FT                   /translation="MAKSMPTTAELLGTRQRILVTGGAGFIGGAVVRRLLRESDAVVFN
FT                   LDKMGYASDLTSIEEVIKELGVEHQQRHQLQPIDLCDADAVEKAVQQANPDLVMHLAAE
FT                   SHVDRSISGPGVFIESNVTGTYNLLQSVRSHFEQLPPERREQFRLHHISTDEVFGSLGR
FT                   EGRFSETTPYDPRSPYSASKAASDHLVQAWHHTFGLPVVLTNCSNNYGPWQFPEKLIPV
FT                   VALKAAAGDSIPLYGDGLNIRDWLYVEDHVDALLLAACRGTSGRSYCVGGHGEKTNQEV
FT                   VNAICHQFDQERPESAPHAKLIQRVKDRPGHDRRYAIDPSRISTELGWQPRHNVEEGLA
FT                   ETVAWYLSHQDWCQTVRKQAGYDGGRLGINQAKTN"
FT   gene            complement(646811..647698)
FT                   /locus_tag="Syncc9902_0635"
FT   CDS_pept        complement(646811..647698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0635"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25603"
FT                   /db_xref="GOA:Q3AZ74"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25603.1"
FT                   /translation="MKILLTGTGGQLGQALLDSKPDAVELISTTRQELDLSNAEACRLA
FT                   VQKYQPDWVLNAGAYTAVDQAESEPELAHAINAGAPEAFAQELDRQGGRLLQVSTDFVF
FT                   DGQQGSPYRVDQPTTPIGVYGTSKAAGEQAIHRIFGANNPQGVILRTSWVMGPVGRNFA
FT                   RTMLRLHRERDQLSVVADQVGCPSSTLNLATACWTTITQGSQTNLPPIMHWSDAGAASW
FT                   YDVAVAIGELGHSLGLVDTPAKVNPITTADYPTPASRPNYSLLDCTTTRAALQLDGQHW
FT                   QEALKQLLLRVQAD"
FT   gene            complement(647695..648285)
FT                   /locus_tag="Syncc9902_0636"
FT   CDS_pept        complement(647695..648285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0636"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25604"
FT                   /db_xref="GOA:Q3AZ73"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25604.1"
FT                   /translation="MNVETLQTSQGITISGPLLITPRAFGDDRGWFFESWNQKRFNEAV
FT                   GQSVEFSQDNHSRSIQGVLRGLHYQLAPEPQAKLVRSSVGSIFDVAIDIRQTSPTCGQW
FT                   VGAVLSAENKAQLWIPEGFAHGFLTLSPVAEVQYKARGFWNKACERAIRWDDPNLAIDW
FT                   PQAELNGTAISLSDKDAEAPDFLSAKASGDLFP"
FT   gene            complement(648282..649214)
FT                   /locus_tag="Syncc9902_0637"
FT   CDS_pept        complement(648282..649214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0637"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25605"
FT                   /db_xref="GOA:Q3AZ72"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25605.1"
FT                   /translation="MGTAPKRKGIILAGGSGTRLHPITQAVSKQLLPVYDKPMIYYPLS
FT                   TLMLAGIRDVLIITTPHDRDAFERLLGDGSAWGMAIQYATQASPDGLAQAFLIGADFLD
FT                   GAPAALVLGDNLFHGHDLIPQLMNSNEQQQGATVFAYPVSDPERYGVAEFDAQGKVLSL
FT                   EEKPTHPKSRYAVTGLYFYDHTVVERARKVEPSPRGELEITDLNAMYLKEGQLRVELMG
FT                   RGMAWLDTGTCDSLNDAASYIRTLEHRQGLKVGCPEEVAWRQGWIDNEQLNRLAQPLKK
FT                   SGYGTYLLQMLEESVSDHAALQTSLEVSA"
FT   gene            complement(649315..652233)
FT                   /locus_tag="Syncc9902_0638"
FT   CDS_pept        complement(649315..652233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0638"
FT                   /product="possible glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25606"
FT                   /db_xref="GOA:Q3AZ71"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25606.1"
FT                   /translation="MVSSQSLSDRSLTQALRQVVERGFGLEDLQPALAERNPGLPVACL
FT                   DPRLIPIPLLVSPQSWAPQDSGIDEKALLQAHPDLIGATTLVSSGRLTQIVHGEACLYA
FT                   DLPPIHLQAYLDGLRPAAKKELQRQKACALEHLATLGWKRFRHRRALGKDLDRYQPEPD
FT                   AAIQTAHSPNNPLPLVLVVLQTEPRPANNAASTLDSNTTDGNTVGWNHIIHGHLDDLNS
FT                   VWSALPSSSEALVSFCHCDDRLAPQAPLLLSRAAEASHKAELFSSDETLQWSADPTQPP
FT                   GNRQNHVSALPWRLLTRGCIGGLVTLRLSRLRQLDLPNRRLCLHNLILDLSLQVSAQRH
FT                   TCEHLSQALLSRKITTNPAVPEVASPKDRLVFSAAQCQESLSICRERGAHFLTTGGVIT
FT                   AHPKWSGCHQVHWTPPENTFVSILIPFRDSAALTKVCVESIRRCAGDIPFELILIDNGS
FT                   TSTDTLTWLNHQRVLSDVTVLRLDCDFNYAQIHNFARPYCQGTHLLLLNNDIEVRSENI
FT                   LQKLLDPFAVSHTVAVGARLRYPNNSIQHHGVVLIKGERRCVLEPGKHLSELNTIDMFT
FT                   PLGVQEEWIAATAACLMLRTADFDQIGGFDEQLAVVFNDVDLCLRLRQLEGSVVVTPFV
FT                   DIIHHESVSRGKDQSGEALARHQRESGYLRHKHAGLFETGDPLFSHNIHPHSNRFQPKD
FT                   PAPQSSGRVKPQQISHWKQRGWKPNNKKPLIVMAHFDPTNRLRPDLLKLLESYAQFGDV
FT                   VLVSASPGLRWHWNTLRKLKRCCRAILIRRNEGYDFGSWMAALHSLKRDIDNIDQLILT
FT                   NDSFWGPITPLDDLFQRLKASSADVIGLTDDQMYAPHLQSAFLAFRKPVIQSDAFQSFW
FT                   NQLESWPRKRDLIKKYEVGLPVCLQKAGFKTESLYTKHANGNILHTAWKELIEAKNFPF
FT                   LKVSLLRDNPMHQEIDAWEQVISERNPVLAAQIRSQLQQPKS"
FT   gene            652332..653519
FT                   /locus_tag="Syncc9902_0639"
FT   CDS_pept        652332..653519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25607"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25607.1"
FT                   /translation="MAARRDWLLGRFPWARSRSSVDCAAAECNESSDCASESSLTERDP
FT                   HLMDVLREVIALRQAGDVQASLALVDRSLAEGMSSNYLLDNRARALAQLNRENEAIQIW
FT                   EFLSECGDLELQEKSKRLVFQQKCRYVLNRVVYFSRLGDAHEALTILDLAQAEGIENDM
FT                   LLDNRARIFVQLNRHIEAISIWKKLSQSNPKKYNAILINQLVGALQLICRSQGWNVQYF
FT                   NRDLETLDALEKGVLKECELLRKRGYAQPLIQLVDKALESGFESPWLVIAKANALIELE
FT                   KFVDAQNLLNHFKDSVHEQHALAAMEQMLDALSGDVEVELVLRAAVRLKAKGDLDAAQD
FT                   LLVKALLQNHSCVVYEETLQQLLVERGEKNPALQAFELFLGEAEKMQTAALISGQ"
FT   gene            653533..655092
FT                   /locus_tag="Syncc9902_0640"
FT   CDS_pept        653533..655092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0640"
FT                   /product="Lipopolysaccharide biosynthesis protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25608"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25608.1"
FT                   /translation="MARWFCRLDPAFYPAWQRGDLEAQARSFAIQGWLLSIDVDGQGTS
FT                   SSFLNPPAAPDLPWAWELNCSDPLSPQAERNLLASLKEAWCSEHVLHLLGRPVIVLRGL
FT                   KNLSSLKFALQRFRKLHDQLLILSSDLRPISGIEENGLDVDGWLDSSTDQMIYIRNLKL
FT                   AHHRLAGSGLEVPGVWAMDQDLEKVSSDSPNELYREWLEQASAWSELANDGAIDAPVCI
FT                   QDWSGHCRLMMPSSLKEKSVEPERLNVTQIPSTDERSWGESSPGHLALMIHGFYPDVLD
FT                   DILLKLPSFCAGMVGTQLDLYVSTSMDQIDQVEKKLRDLDFACVRLFGVENRGRDVAPF
FT                   LLHLLPAVAAAGHHFFVKLHTKKSLQFGIDGLDKWSRHLIESLLSAAGLEAIRYQFLDD
FT                   EDLGCLCPSGTLLPLAIALFKNKTHLHHLLSHSEINGRWALMQTFVAGSMFAGRVEAFR
FT                   SLLDQGFSLDDFELEGGQFDGTFAHALERLISLEVKRSGWQIKEMSGSPEAVPGFGYGL
FT                   VD"
FT   gene            complement(655031..655372)
FT                   /locus_tag="Syncc9902_0641"
FT   CDS_pept        complement(655031..655372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25609"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25609.1"
FT                   /translation="MNSLHHPSDQPELGQQLKDAKQTINKLKDSLNAKENEIQSLQNKL
FT                   NSAHEELINTQNELEYHYQKSQNKALLIDSYQHQQHRAKALIASLLQQLNPPSRNQNLE
FT                   PPRDCQTSP"
FT   gene            complement(655426..656496)
FT                   /locus_tag="Syncc9902_0642"
FT   CDS_pept        complement(655426..656496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0642"
FT                   /product="Dihydrouridine synthase TIM-barrel protein nifR3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25610"
FT                   /db_xref="GOA:Q3AZ67"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25610.1"
FT                   /translation="MADETERSGLDHPQPLNQSLQTPIHLPGNGTCRQLHSRVLQSPLA
FT                   GVTDKIFRGLVRRWSRDSLLFTEMVNATSLELGHGYGKMDDLKAEEGPIAVQLFDHRPH
FT                   AMAHAARRAEQAGAFLIDINMGCPVRKIAKKGGGSGLIRDPNLATQILEAVVDAVSIPV
FT                   TVKTRLGWCGSSSDPITWCRQLQNAGAQMLTLHGRTREQGFKGQANWNAIAEVKQALTI
FT                   PVIANGDINSPTDALRCLEITGADGVMVGRGTMGSPWLVGQIEAAFMNRPIPATPDSGA
FT                   RLHLAKEQLHDLVSSRGSHGLLIARKHMSWTCTGFPGAPQLRHSLMRATTPDDAYQLID
FT                   NAINSLRTVGIAQEAK"
FT   gene            656495..656947
FT                   /locus_tag="Syncc9902_0643"
FT   CDS_pept        656495..656947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25611"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25611.1"
FT                   /translation="MGDLWPVSRALLQQILEDRCTDRFVCECIWTRLGYVPVGDQWHAG
FT                   PTTSKEWSDAFPLGPELIAQRPASVRLTRSIPKPLKQLLKEQLGFAGYKIGGLYPRRTR
FT                   RATAVSWLLAWLAQRGEPLPDQGPLAQEMPVPSDPVKGHPGDLLIS"
FT   gene            657017..658384
FT                   /locus_tag="Syncc9902_0644"
FT   CDS_pept        657017..658384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0644"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25612"
FT                   /db_xref="GOA:Q3AZ65"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AZ65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25612.1"
FT                   /translation="MARPVVAIIGRPNVGKSTLVNRLCRSREAIVHDQPGVTRDRTYQD
FT                   GYWGDREFKVVDTGGLVFDDDSEFLPEIREQAALALDEASVALVIVDGKQGLTAADESI
FT                   AEFLRQQRCPTLLAVNKCESVEQGLAMAAEFWSLGLGEPYPISAIHGAGTAEVLDQVLT
FT                   FLPPKDQEGDEEEPIQMSIIGRPNVGKSSLLNAICGEQRAIVSPIRGTTRDTIDTNIVR
FT                   ENRPWRLVDTAGIRRRRSVNYGPEYFGINRSFKAIERSDVCVLVIDALDGVTEQDQRLA
FT                   GRIEEDGRACVVVVNKWDAVEKDSHTMSATEKELRAKLYFLDWAPMLFTSALTGQRVES
FT                   IFALAALAVEQHRRRVTTSVVNEVLKEALSWRSPPTTRGGRQGKLYYGTQVASRPPSFT
FT                   LFVNDPKLFGDTYRRYVERHIREGLGFDGTPLKLFWRGKQQRDAEKELARQQNRRG"
FT   gene            658388..659296
FT                   /locus_tag="Syncc9902_0645"
FT   CDS_pept        658388..659296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9902_0645"
FT                   /product="possible cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9902_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABB25613"
FT                   /db_xref="GOA:Q3AZ64"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AZ64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB25613.1"
FT                   /translation="MDWLRQIPMGQYVDGSEGWLRRLDPRLKLAWSLVFLLTPVLAGPW
FT                   WRVGLVLSLFVITALSGLPRKLWWRSLVVLVLLALAVGLLSMLLPAVDPPAAFSLRNPL
FT                   ELPDATTDGPSWDLIRLGPLQWGNFSLGPLVVDRASAQLGLRTSTLIFTVIHSVNLVLI
FT                   TTTPEDLVWGLSWYLTPLAVFGLPVERLGFQLLLALRFLPLVQEELQNLLRSMASRAVN
FT                   LRTLGFKAGFGIVLAVGERLLANILLRAEQGADALVARGGRILGPSRFRLPAERPAPLL
FT                   NALALLGLL