(data stored in ACNUC13767 zone)

EMBL: CP000103

ID   CP000103; SV 1; circular; genomic DNA; STD; PRO; 3184243 BP.
XX
AC   CP000103;
XX
PR   Project:PRJNA13912;
XX
DT   16-NOV-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Nitrosospira multiformis ATCC 25196, complete genome.
XX
KW   .
XX
OS   Nitrosospira multiformis ATCC 25196
OC   Bacteria; Proteobacteria; Betaproteobacteria; Nitrosomonadales;
OC   Nitrosomonadaceae; Nitrosospira.
XX
RN   [1]
RP   1-3184243
RX   DOI; 10.1128/AEM.02722-07.
RX   PUBMED; 18390676.
RA   Norton J.M., Klotz M.G., Stein L.Y., Arp D.J., Bottomley P.J., Chain P.S.,
RA   Hauser L.J., Land M.L., Larimer F.W., Shin M.W., Starkenburg S.R.;
RT   "Complete genome sequence of Nitrosospira multiformis, an ammonia-oxidizing
RT   bacterium from the soil environment";
RL   Appl. Environ. Microbiol. 74(11):3559-3572(2008).
XX
RN   [2]
RP   1-3184243
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Lykidis A., Richardson P.;
RT   "Complete sequence of Chromosome 1 of Nitrosospira multiformis ATCC 25196";
RL   Unpublished.
XX
RN   [3]
RP   1-3184243
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Lykidis A.,
RA   Richardson P.;
RT   ;
RL   Submitted (08-AUG-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6c02812b5ac1edd8b87fb4f337320d8c.
DR   BioSample; SAMN02598322.
DR   EnsemblGenomes-Gn; EBG00001105580.
DR   EnsemblGenomes-Gn; EBG00001105581.
DR   EnsemblGenomes-Gn; EBG00001105582.
DR   EnsemblGenomes-Gn; EBG00001105583.
DR   EnsemblGenomes-Gn; EBG00001105584.
DR   EnsemblGenomes-Gn; EBG00001105585.
DR   EnsemblGenomes-Gn; EBG00001105586.
DR   EnsemblGenomes-Gn; EBG00001105587.
DR   EnsemblGenomes-Gn; EBG00001105588.
DR   EnsemblGenomes-Gn; EBG00001105589.
DR   EnsemblGenomes-Gn; EBG00001105590.
DR   EnsemblGenomes-Gn; EBG00001105591.
DR   EnsemblGenomes-Gn; EBG00001105592.
DR   EnsemblGenomes-Gn; EBG00001105593.
DR   EnsemblGenomes-Gn; EBG00001105594.
DR   EnsemblGenomes-Gn; EBG00001105595.
DR   EnsemblGenomes-Gn; EBG00001105596.
DR   EnsemblGenomes-Gn; EBG00001105597.
DR   EnsemblGenomes-Gn; EBG00001105598.
DR   EnsemblGenomes-Gn; EBG00001105599.
DR   EnsemblGenomes-Gn; EBG00001105600.
DR   EnsemblGenomes-Gn; EBG00001105601.
DR   EnsemblGenomes-Gn; EBG00001105602.
DR   EnsemblGenomes-Gn; EBG00001105603.
DR   EnsemblGenomes-Gn; EBG00001105604.
DR   EnsemblGenomes-Gn; EBG00001105605.
DR   EnsemblGenomes-Gn; EBG00001105606.
DR   EnsemblGenomes-Gn; EBG00001105607.
DR   EnsemblGenomes-Gn; EBG00001105608.
DR   EnsemblGenomes-Gn; EBG00001105609.
DR   EnsemblGenomes-Gn; EBG00001105610.
DR   EnsemblGenomes-Gn; EBG00001105611.
DR   EnsemblGenomes-Gn; EBG00001105612.
DR   EnsemblGenomes-Gn; EBG00001105613.
DR   EnsemblGenomes-Gn; EBG00001105614.
DR   EnsemblGenomes-Gn; EBG00001105615.
DR   EnsemblGenomes-Gn; EBG00001105616.
DR   EnsemblGenomes-Gn; EBG00001105617.
DR   EnsemblGenomes-Gn; EBG00001105618.
DR   EnsemblGenomes-Gn; EBG00001105619.
DR   EnsemblGenomes-Gn; EBG00001105620.
DR   EnsemblGenomes-Gn; EBG00001105621.
DR   EnsemblGenomes-Gn; EBG00001105622.
DR   EnsemblGenomes-Gn; EBG00001105623.
DR   EnsemblGenomes-Gn; EBG00001105624.
DR   EnsemblGenomes-Gn; EBG00001105625.
DR   EnsemblGenomes-Gn; EBG00001105626.
DR   EnsemblGenomes-Gn; EBG00001105627.
DR   EnsemblGenomes-Gn; EBG00001105628.
DR   EnsemblGenomes-Gn; EBG00001105629.
DR   EnsemblGenomes-Gn; EBG00001105630.
DR   EnsemblGenomes-Gn; EBG00001105631.
DR   EnsemblGenomes-Gn; EBG00001105632.
DR   EnsemblGenomes-Gn; EBG00001105633.
DR   EnsemblGenomes-Gn; EBG00001105634.
DR   EnsemblGenomes-Gn; EBG00001105635.
DR   EnsemblGenomes-Gn; EBG00001105636.
DR   EnsemblGenomes-Gn; EBG00001105637.
DR   EnsemblGenomes-Gn; EBG00001105638.
DR   EnsemblGenomes-Gn; EBG00001105639.
DR   EnsemblGenomes-Gn; EBG00001105640.
DR   EnsemblGenomes-Gn; Nmul_AR0001.
DR   EnsemblGenomes-Gn; Nmul_AR0002.
DR   EnsemblGenomes-Gn; Nmul_AR0003.
DR   EnsemblGenomes-Gn; Nmul_AR0004.
DR   EnsemblGenomes-Gn; Nmul_AR0005.
DR   EnsemblGenomes-Gn; Nmul_AR0007.
DR   EnsemblGenomes-Gn; Nmul_AR0008.
DR   EnsemblGenomes-Gn; Nmul_AR0009.
DR   EnsemblGenomes-Gn; Nmul_AR0010.
DR   EnsemblGenomes-Gn; Nmul_AR0011.
DR   EnsemblGenomes-Gn; Nmul_AR0012.
DR   EnsemblGenomes-Gn; Nmul_AR0013.
DR   EnsemblGenomes-Gn; Nmul_AR0014.
DR   EnsemblGenomes-Gn; Nmul_AR0015.
DR   EnsemblGenomes-Gn; Nmul_AR0016.
DR   EnsemblGenomes-Gn; Nmul_AR0017.
DR   EnsemblGenomes-Gn; Nmul_AR0018.
DR   EnsemblGenomes-Gn; Nmul_AR0019.
DR   EnsemblGenomes-Gn; Nmul_AR0020.
DR   EnsemblGenomes-Gn; Nmul_AR0021.
DR   EnsemblGenomes-Gn; Nmul_AR0022.
DR   EnsemblGenomes-Gn; Nmul_AR0023.
DR   EnsemblGenomes-Gn; Nmul_AR0024.
DR   EnsemblGenomes-Gn; Nmul_AR0025.
DR   EnsemblGenomes-Gn; Nmul_AR0026.
DR   EnsemblGenomes-Gn; Nmul_AR0027.
DR   EnsemblGenomes-Gn; Nmul_AR0028.
DR   EnsemblGenomes-Gn; Nmul_AR0029.
DR   EnsemblGenomes-Gn; Nmul_AR0030.
DR   EnsemblGenomes-Gn; Nmul_AR0031.
DR   EnsemblGenomes-Gn; Nmul_AR0032.
DR   EnsemblGenomes-Gn; Nmul_AR0034.
DR   EnsemblGenomes-Gn; Nmul_AR0035.
DR   EnsemblGenomes-Gn; Nmul_AR0036.
DR   EnsemblGenomes-Gn; Nmul_AR0037.
DR   EnsemblGenomes-Gn; Nmul_AR0038.
DR   EnsemblGenomes-Gn; Nmul_AR0039.
DR   EnsemblGenomes-Gn; Nmul_AR0040.
DR   EnsemblGenomes-Gn; Nmul_AR0041.
DR   EnsemblGenomes-Gn; Nmul_AR0042.
DR   EnsemblGenomes-Gn; Nmul_AR0043.
DR   EnsemblGenomes-Gn; Nmul_AR0044.
DR   EnsemblGenomes-Gn; Nmul_AR0045.
DR   EnsemblGenomes-Gn; Nmul_AR0046.
DR   EnsemblGenomes-Gn; Nmul_AR0047.
DR   EnsemblGenomes-Gn; Nmul_AR0048.
DR   EnsemblGenomes-Gn; Nmul_AR0049.
DR   EnsemblGenomes-Tr; EBT00001697280.
DR   EnsemblGenomes-Tr; EBT00001697281.
DR   EnsemblGenomes-Tr; EBT00001697282.
DR   EnsemblGenomes-Tr; EBT00001697283.
DR   EnsemblGenomes-Tr; EBT00001697284.
DR   EnsemblGenomes-Tr; EBT00001697285.
DR   EnsemblGenomes-Tr; EBT00001697286.
DR   EnsemblGenomes-Tr; EBT00001697287.
DR   EnsemblGenomes-Tr; EBT00001697288.
DR   EnsemblGenomes-Tr; EBT00001697289.
DR   EnsemblGenomes-Tr; EBT00001697290.
DR   EnsemblGenomes-Tr; EBT00001697291.
DR   EnsemblGenomes-Tr; EBT00001697292.
DR   EnsemblGenomes-Tr; EBT00001697293.
DR   EnsemblGenomes-Tr; EBT00001697294.
DR   EnsemblGenomes-Tr; EBT00001697295.
DR   EnsemblGenomes-Tr; EBT00001697296.
DR   EnsemblGenomes-Tr; EBT00001697297.
DR   EnsemblGenomes-Tr; EBT00001697298.
DR   EnsemblGenomes-Tr; EBT00001697299.
DR   EnsemblGenomes-Tr; EBT00001697300.
DR   EnsemblGenomes-Tr; EBT00001697301.
DR   EnsemblGenomes-Tr; EBT00001697302.
DR   EnsemblGenomes-Tr; EBT00001697303.
DR   EnsemblGenomes-Tr; EBT00001697304.
DR   EnsemblGenomes-Tr; EBT00001697305.
DR   EnsemblGenomes-Tr; EBT00001697306.
DR   EnsemblGenomes-Tr; EBT00001697307.
DR   EnsemblGenomes-Tr; EBT00001697308.
DR   EnsemblGenomes-Tr; EBT00001697309.
DR   EnsemblGenomes-Tr; EBT00001697310.
DR   EnsemblGenomes-Tr; EBT00001697311.
DR   EnsemblGenomes-Tr; EBT00001697312.
DR   EnsemblGenomes-Tr; EBT00001697313.
DR   EnsemblGenomes-Tr; EBT00001697314.
DR   EnsemblGenomes-Tr; EBT00001697315.
DR   EnsemblGenomes-Tr; EBT00001697316.
DR   EnsemblGenomes-Tr; EBT00001697317.
DR   EnsemblGenomes-Tr; EBT00001697318.
DR   EnsemblGenomes-Tr; EBT00001697319.
DR   EnsemblGenomes-Tr; EBT00001697320.
DR   EnsemblGenomes-Tr; EBT00001697321.
DR   EnsemblGenomes-Tr; EBT00001697322.
DR   EnsemblGenomes-Tr; EBT00001697323.
DR   EnsemblGenomes-Tr; EBT00001697324.
DR   EnsemblGenomes-Tr; EBT00001697326.
DR   EnsemblGenomes-Tr; EBT00001697328.
DR   EnsemblGenomes-Tr; EBT00001697330.
DR   EnsemblGenomes-Tr; EBT00001697332.
DR   EnsemblGenomes-Tr; EBT00001697334.
DR   EnsemblGenomes-Tr; EBT00001697335.
DR   EnsemblGenomes-Tr; EBT00001697336.
DR   EnsemblGenomes-Tr; EBT00001697337.
DR   EnsemblGenomes-Tr; EBT00001697338.
DR   EnsemblGenomes-Tr; EBT00001697339.
DR   EnsemblGenomes-Tr; EBT00001697340.
DR   EnsemblGenomes-Tr; EBT00001697342.
DR   EnsemblGenomes-Tr; EBT00001697343.
DR   EnsemblGenomes-Tr; EBT00001697344.
DR   EnsemblGenomes-Tr; EBT00001697345.
DR   EnsemblGenomes-Tr; EBT00001697346.
DR   EnsemblGenomes-Tr; Nmul_AR0001-1.
DR   EnsemblGenomes-Tr; Nmul_AR0002-1.
DR   EnsemblGenomes-Tr; Nmul_AR0003-1.
DR   EnsemblGenomes-Tr; Nmul_AR0004-1.
DR   EnsemblGenomes-Tr; Nmul_AR0005-1.
DR   EnsemblGenomes-Tr; Nmul_AR0007-1.
DR   EnsemblGenomes-Tr; Nmul_AR0008-1.
DR   EnsemblGenomes-Tr; Nmul_AR0009-1.
DR   EnsemblGenomes-Tr; Nmul_AR0010-1.
DR   EnsemblGenomes-Tr; Nmul_AR0011-1.
DR   EnsemblGenomes-Tr; Nmul_AR0012-1.
DR   EnsemblGenomes-Tr; Nmul_AR0013-1.
DR   EnsemblGenomes-Tr; Nmul_AR0014-1.
DR   EnsemblGenomes-Tr; Nmul_AR0015-1.
DR   EnsemblGenomes-Tr; Nmul_AR0016-1.
DR   EnsemblGenomes-Tr; Nmul_AR0017-1.
DR   EnsemblGenomes-Tr; Nmul_AR0018-1.
DR   EnsemblGenomes-Tr; Nmul_AR0019-1.
DR   EnsemblGenomes-Tr; Nmul_AR0020-1.
DR   EnsemblGenomes-Tr; Nmul_AR0021-1.
DR   EnsemblGenomes-Tr; Nmul_AR0022-1.
DR   EnsemblGenomes-Tr; Nmul_AR0023-1.
DR   EnsemblGenomes-Tr; Nmul_AR0024-1.
DR   EnsemblGenomes-Tr; Nmul_AR0025-1.
DR   EnsemblGenomes-Tr; Nmul_AR0026-1.
DR   EnsemblGenomes-Tr; Nmul_AR0027-1.
DR   EnsemblGenomes-Tr; Nmul_AR0028-1.
DR   EnsemblGenomes-Tr; Nmul_AR0029-1.
DR   EnsemblGenomes-Tr; Nmul_AR0030-1.
DR   EnsemblGenomes-Tr; Nmul_AR0031-1.
DR   EnsemblGenomes-Tr; Nmul_AR0032-1.
DR   EnsemblGenomes-Tr; Nmul_AR0034-1.
DR   EnsemblGenomes-Tr; Nmul_AR0035-1.
DR   EnsemblGenomes-Tr; Nmul_AR0036-1.
DR   EnsemblGenomes-Tr; Nmul_AR0037-1.
DR   EnsemblGenomes-Tr; Nmul_AR0038-1.
DR   EnsemblGenomes-Tr; Nmul_AR0039-1.
DR   EnsemblGenomes-Tr; Nmul_AR0040-1.
DR   EnsemblGenomes-Tr; Nmul_AR0041-1.
DR   EnsemblGenomes-Tr; Nmul_AR0042-1.
DR   EnsemblGenomes-Tr; Nmul_AR0043-1.
DR   EnsemblGenomes-Tr; Nmul_AR0044-1.
DR   EnsemblGenomes-Tr; Nmul_AR0045-1.
DR   EnsemblGenomes-Tr; Nmul_AR0046-1.
DR   EnsemblGenomes-Tr; Nmul_AR0047-1.
DR   EnsemblGenomes-Tr; Nmul_AR0048-1.
DR   EnsemblGenomes-Tr; Nmul_AR0049-1.
DR   EuropePMC; PMC5960693; 29867847.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000103.
DR   SILVA-SSU; CP000103.
DR   StrainInfo; 103735; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA available from Dan Arp (arpd@bcc.orst.edu)
CC   Bacteria available from ATCC: ATCC 25196
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3184243
FT                   /organism="Nitrosospira multiformis ATCC 25196"
FT                   /strain="ATCC 25196"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:323848"
FT                   /culture_collection="ATCC:25196"
FT   gene            69..1499
FT                   /locus_tag="Nmul_A0001"
FT   CDS_pept        69..1499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73310"
FT                   /db_xref="GOA:Q2YD61"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD61"
FT                   /protein_id="ABB73310.1"
FT                   /translation="MLAPDTFWLACLEYFENELSAQQFNTWIKPLRLQLSDDSPEPALR
FT                   LIAPNRFVLQWVKDNFLSDITQMAENHFARPVQLQLELAGQIPASASPSTGRNNGTASH
FT                   SITAVFDAPTESAQKAPKDTKDTKDAKEKQEKNPTRLNPSFTFNTFVTGKANQLARAGA
FT                   IQVAERPGVAYNPFFIYGGVGLGKTHLIQAIGNFVVEQNPAAKVRYIHSEQYVSDVVRA
FT                   YQHKAFDEFKRYYHSLDLLLIDDIQFFGGKNRTQEEFFYAFNALIEAHKQVIITCDSYP
FT                   KEIAGMEERLISRFGWGLTVAVEPPELEMRVAILLKKALMEDIILDESVAFFIAKHIRS
FT                   NVRELEGALKRVVAYSRFTGHALTLDLAREALKDLLAVQNRQISIENIQKTVADYYKIK
FT                   VAEMYSKKRSRVVARPRQMAMAISKELTPLSLPDIGEAFGGRDHTTVLHGYRKIAELRA
FT                   SDPAVNRDFNTLLHILRG"
FT   gene            1719..2828
FT                   /locus_tag="Nmul_A0002"
FT   CDS_pept        1719..2828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73311"
FT                   /db_xref="GOA:Q2YD60"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD60"
FT                   /protein_id="ABB73311.1"
FT                   /translation="MKLIEADRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISF
FT                   IATDLEIQITTSTTDGGKVREEYSVTVAAKKLQDILRALPEKMRVTLETNDSRLQAKAG
FT                   KSRFNLQTLPAEDFPKFPESNETQGTVKVQQKELKHLLAMVQYAMAHQDIRYYLNGLLL
FT                   LLENNQLKVVATDGHRLAFALMMLETSLERKEVILPRKVVLELSRLLNETEDPVTIEVL
FT                   QNQVRFTFSNVVLVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRAAILSNEKF
FT                   RGVRLILTADNLRIVCNNSEQEEAQEELELQYNGDGLDIGFNITYLLDVLNNADSETVT
FT                   CAFGDANSSALITIPGNDSFKYVVMPMRI"
FT   gene            3157..5589
FT                   /locus_tag="Nmul_A0003"
FT   CDS_pept        3157..5589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73312"
FT                   /db_xref="GOA:Q2YD59"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD59"
FT                   /protein_id="ABB73312.1"
FT                   /translation="MNEKERSRQQKSKSSADYGSDSIKILKGLDAVRKRPGMYIGDTSD
FT                   GTGLHHMVFEVLDNAIDEALAGYCDEISVIIHPDNSVTVQDNGRGIPTGIKQDDELKRS
FT                   AAEIVMTELHAGGKFDSDSYKVSGGLHGVGVSVVNALSEWLRLSIRRDGKIHQIEFRMG
FT                   VPVGPLATTGKTERRGTEVHFLASKEIFGDIEYHYDIFAKRLRELSFLNNGVKIHLIDQ
FT                   RNAKEETFAFVGGVKSFVEYVNRTKSVLHPNIFYAAGEKDRIAVEVSMQWNDSYTEQVL
FT                   CFTNNIPQKDGGTHLTGLRAAMTRTLNNYIEKSDLAKKAKIETSGDDMREGLSCVLSVK
FT                   LFEPKFSSQTKEKLVSSEVRPVVEEIVSLKLAEFLMEHPVDAKIICGKIIEAARAREAA
FT                   RKARELTRRKGVLDGMGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRDRKFQAIM
FT                   PLKGKILNVEKARFDKLISSQEIASLITALGTGIGKDEYNPDKLRYHRIIIMTDADVDG
FT                   SHIRTLLLTFFYRQMPELIERGHIFIAQPPLYKIKHGKQERYVKDDHELKQYLLGLALT
FT                   EAELHTGEGKSPLTGETLENIANEYLLAEAVIERMSSLIDSEVMHALLRHSDIDLSNEE
FT                   LATESAVRLAAQVNAPNITIVPKYDVATEEYRLKISRMHHGNVRYSYIDQDFLQSGDYA
FT                   QIRQTAEVLDGLIGPAAYVQRGEKKQAVSDFKQALDWLLEEVKKGIGTQRYKGLGEMNP
FT                   AQLWETTMDPKVRLLLRAQIEDSIAADEIFTTLMGDIVEPRRAFIENNALGVRNLDV"
FT   gene            5730..6980
FT                   /locus_tag="Nmul_A0004"
FT   CDS_pept        5730..6980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0004"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73313"
FT                   /db_xref="GOA:Q2YD58"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD58"
FT                   /protein_id="ABB73313.1"
FT                   /translation="MLSSYNTLETVDPDLWQAIKGEMQRQEEYIELIASENYASPAVMQ
FT                   AQGSVLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVRALFDAEYVNVQPHSGSQANAA
FT                   VYLTALKPGDTLLGMSLAHGGHLTHGASVNLSGKIFNAVSYGLRSDTEELDYDEVARLA
FT                   HEHKPKLIVAGASAYSLVIDWKRFRKIADDIGAYLFVDMAHYAGLVAAGYYPNPVGIAD
FT                   FVTSTTHKTLRGPRGGIIMARAEHEKALNSAIFPQTQGGPLMHVIAAKAVAFKEAASQE
FT                   FKDYQEQVIDNARVMAKVLQERGLRIVSGRTDCHMFLVDLRPKYITGKQAAESLEVAHI
FT                   TVNKNAIPNDPQKPFVTSGIRIGSPAITTRGFAEFESEQLAHLIADVLEAPTDSSVLTE
FT                   VARQAKALCAKFPVYQG"
FT   gene            7110..7589
FT                   /locus_tag="Nmul_A0005"
FT   CDS_pept        7110..7589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0005"
FT                   /product="Protein of unknown function DUF193"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73314"
FT                   /db_xref="GOA:Q2YD57"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD57"
FT                   /protein_id="ABB73314.1"
FT                   /translation="MKCPFCHTPDTSVIDSRVSEEGDRIRRRRRCPHCDKRFTTYETVE
FT                   LRLPQVVKQDGNRAEFDREKLRTGFVRALHKRPVSAEDVEAAMNRVVQKLLSLGEREIA
FT                   SHKIGEMVMGELYKLDKVAYIRFASVYRSFQGAADFDDAIRELQGSDSRKEPDKP"
FT   gene            7704..8804
FT                   /locus_tag="Nmul_A0006"
FT   CDS_pept        7704..8804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0006"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="1.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73315"
FT                   /db_xref="GOA:Q2YD56"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD56"
FT                   /protein_id="ABB73315.1"
FT                   /translation="MFSPTDYRFMAQALRLAEKGLYSTSPNPRVGCVLVRDGQVVGTGW
FT                   HERAGEAHAEINALAAAGPAARGALAYLTLEPCSHYGRTPPCADALVQAGVAKVITAMQ
FT                   DPNPLVAGRGCALLEEAGIEVKTGLMEAEAKALNIGFVSRMTRGRPWVRVKIAASLDGK
FT                   TALNNGSSQWITSAAARRDGHRWRARSCAVMTGIGTVLADDPQLTVRHIHTSRQPMPVV
FT                   VDRGLDIPLDAGLLRGAGELVFTAAASEGKIVALRDVGAHVILLPDSAGNVDLAAMMRR
FT                   LADLEINEVLVEAGSGLNGGLIQADLVDEFVIYLAPCLIGNAARDMLKLPELSNLEDKR
FT                   ALKIHNVRAVGQDIRIIARGPDGMAT"
FT   gene            complement(8891..9454)
FT                   /locus_tag="Nmul_A0007"
FT   CDS_pept        complement(8891..9454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0007"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73316"
FT                   /db_xref="GOA:Q2YD55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD55"
FT                   /protein_id="ABB73316.1"
FT                   /translation="MTTTLPMTEVDDRPALLIVDDDQTFCTVLANAMTKRGFTVTCAHN
FT                   VDQALELAEACAPEYAVVDLRLPGPSGLSLVEKLKALDPGTRIVMLTGYASIATAVEAI
FT                   KLGATHYLAKPVDVHEIMAAFERTTGDADVQISAHPLSVGRLEWEYIQRVLNENKGNVS
FT                   VTARVLNMHRRTLQRKLTKYPAKT"
FT   gene            complement(9451..10716)
FT                   /locus_tag="Nmul_A0008"
FT   CDS_pept        complement(9451..10716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0008"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73317"
FT                   /db_xref="GOA:Q2YD54"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD54"
FT                   /protein_id="ABB73317.1"
FT                   /translation="MLVNPGQPPLRKNLQRLFLLRNIVIAAQCLTFALAYWGLELELPW
FT                   AEMVAVAVLLGVVNLATWIRLHRKWPVSSMEFFAQLLVDVLALSTLLYLSGGSTNPFIS
FT                   LYLLPLTIAAAALPWAYTWVMAAITISCYTLLLFYYVPLPHNHEEHGSEFIMHVSGMWL
FT                   AFVLSTVLIAWFVVKMGISIRERDKDLALAREQALRNEQIIALGTLAAGAAHELGTPLA
FT                   TMAIVTGELQDEYIDDTEFQGNIRILRDQIAHCKRTLTQLLADAGQARAEDVSGQTVDL
FT                   FLRQVVDKWQLMRPSAQFTYRGSGVQPAPQILNTQLLSQSILNLLNNAADASLKHIEIE
FT                   VTWSHQELHLQILDYGEGLRGEAAQRAGQPFFTTKTKGQGFGIGLFLANANIERFGGKV
FT                   RLTNREGGACTQVILPLIQPSI"
FT   gene            10912..11538
FT                   /locus_tag="Nmul_A0009"
FT   CDS_pept        10912..11538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0009"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73318"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD53"
FT                   /protein_id="ABB73318.1"
FT                   /translation="MFTGIVEAVGEIKTANPQKNGLSLRIAPGKLSLAETKVGDSIAVN
FT                   GVCLTVTGLADNLLSVDVSGETLQCTQGLDKPGGKVNLEKSLRLSDGLDGHLVSGHVDG
FT                   VGEVTKFQPLGESSLLAIRLPDSLLKYIAKKGSITVNGVSLTVNRVERDELEINLIPHT
FT                   LAETTLKELKAGARVNVEVDMLARYVERLLLAMDDKHRSESSVQT"
FT   gene            11535..12668
FT                   /locus_tag="Nmul_A0010"
FT   CDS_pept        11535..12668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0010"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73319"
FT                   /db_xref="GOA:Q2YD52"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD52"
FT                   /protein_id="ABB73319.1"
FT                   /translation="MIISSIQEIIADIKTGRMVILVDEENRENEGDLVLAADFITPAAI
FT                   NFMATYGRGLICLTLMEERCRQLNLPLMVAANRSPLGTNFTVSIEAATGVTTGISAADR
FT                   ARTVQVAVNRGAKPDDIVQPGHIFPLMAQNGGVLVRAGHTEAGCDLAHLAGLTPASVIC
FT                   EILNEDGSMARLPDLVEFAAKHQLKIGAIADLIHYRSRTESLVERIVERPLQTAHGRFQ
FT                   LVAYLDKTVNTVHLALVKGAIAPDDETLVRVHEPLSVMDLLDLEDDTHSWNLNEALRII
FT                   SDAGRGVIVLLHCGESGSGLMERVLPAKLPHRPVAKPDLRNYGIGAQILKDLNVRKMRL
FT                   LAVPRKMPSMAGFGLEVTGYLEPEDKSRLAESRQAVR"
FT   gene            12785..13267
FT                   /locus_tag="Nmul_A0011"
FT   CDS_pept        12785..13267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0011"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73320"
FT                   /db_xref="GOA:Q2YD51"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD51"
FT                   /protein_id="ABB73320.1"
FT                   /translation="MARYENILELEPNLNGEDLSIGIVMSRFNIEASEGLLGACVEELM
FT                   KQGVDAGNVVLVSVPGALEIPLALQKMALTDQFDALIALGAVIRGETYHFEIVSEQSTN
FT                   GVSTVQLDTGIPIANGILTTNTDDQALARMSQKGAEAARVAIEMANLQRTLDEMEQ"
FT   gene            13378..13854
FT                   /locus_tag="Nmul_A0012"
FT   CDS_pept        13378..13854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0012"
FT                   /product="NusB antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73321"
FT                   /db_xref="GOA:Q2YD50"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD50"
FT                   /protein_id="ABB73321.1"
FT                   /translation="MKRVEKRAEKQGRGTARKSRRRLARELALQGLYQWCVAGGSAGTI
FT                   EAQLRDTEEFPKTDEEYFSRLLHGVLMQAPELEKEIQPCLDRPFNELSPVEISILLLGA
FT                   YELERHPEIPYRAVINEAVELAKAYGGTHGHKYVNGVLDKLAVKLRAAEIGAKI"
FT   gene            13916..14941
FT                   /locus_tag="Nmul_A0013"
FT   CDS_pept        13916..14941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0013"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73322"
FT                   /db_xref="GOA:Q2YD49"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD49"
FT                   /protein_id="ABB73322.1"
FT                   /translation="MDLVGGSKVLSEFDIIRSFFTRSAPATVLGIGDDAALIRPAPGME
FT                   LAISSDMLVSGRHFFEDVDPYKLGHKSLAVNLSDMAAMGARPRWATLSLALPESVVQKD
FT                   ESWLRAFADGFFALAHVHRVDLIGGDTTNGPLNICVTIIGEAPEGKALRRSGARAGDDI
FT                   WVSGYLGDAALALAYQKKKIMPKPGEVEAAELEAAELEFLMAALEMPIPRVELGQRLIG
FT                   LAHSAIDISDGLLADLGHILECSRVAAVVRIDRILRSAAMEKHFPHPLAIECLLAGGDD
FT                   YELCFTVPKSERIKVELLSREEGIPLTRIGSIEEGAGLVVLDSAGRTVTTRVKGYDHFQ
FT                   V"
FT   gene            14922..15554
FT                   /locus_tag="Nmul_A0014"
FT   CDS_pept        14922..15554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0014"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73323"
FT                   /db_xref="GOA:Q2YD48"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD48"
FT                   /protein_id="ABB73323.1"
FT                   /translation="MTISKSDNRSDNSPDRRPLEVESTLPPSVDKGDEARREALPLLPS
FT                   PWIERPIPDKTFIRGSVAHFIAFAGGVGLSPVAPGTAATLVAFPLFWVLEYIFDPPGFL
FT                   LFLVAAFGIGIWACEVTGRALRNTDHGGIVWDEVTAFLLVLFFTPKGLMWQAFAFLLFR
FT                   LFDIIKPAPIRYYEKKLRGGFGVMFDDLLAAFFTLLCLAFWKAYVTG"
FT   gene            15630..16139
FT                   /locus_tag="Nmul_A0015"
FT   CDS_pept        15630..16139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0015"
FT                   /product="CinA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73324"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD47"
FT                   /protein_id="ABB73324.1"
FT                   /translation="MDDMMLQDLAMRVGTALAQQELTLVTAESCTGGWLGQVVTSVAGS
FT                   SGWYERGFITYATASKQEMLGVSNATLEQYGSVSEQTASEMAAGAIARSHAQVAVSVTG
FT                   IAGPEGGTEEKPVGMVCFAWIMKEGMALAETRYFSGSREEIRRQSVSGALQGLIDLLHS
FT                   IPPAVA"
FT   gene            complement(16151..16798)
FT                   /locus_tag="Nmul_A0016"
FT   CDS_pept        complement(16151..16798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0016"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73325"
FT                   /db_xref="GOA:Q2YD46"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD46"
FT                   /protein_id="ABB73325.1"
FT                   /translation="MKINEDSNDTNDTPLPVYSGRSRKIQPLAYFIFTTRWLQLPLYLG
FT                   LILAQCVYVYHFWVELLDLIGAVMGNKEALEHTLDAVSIEGAAPPKKIGETTIMLVVLG
FT                   LIDVVMISNLLIMVIIGGYETFVSRMNLEGHPDQPEWLSHVNATVLKVKLSTAIIGISS
FT                   IHLLKTFINANAYDEKTILAQTGIHIVFLLSAIAIAYSDRLMSRPGGHESDH"
FT   gene            16951..18174
FT                   /locus_tag="Nmul_A0017"
FT   CDS_pept        16951..18174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0017"
FT                   /product="tetratricopeptide TPR_3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73326"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD45"
FT                   /protein_id="ABB73326.1"
FT                   /translation="MTAISSLALLVFASALFLPLLPGASAKTPEQVFTEERGSIVSIDM
FT                   LNARGELAVQGSGVALGADQVITTCDVARQAESARVGWAGRIFKAKPAPSQTHLNLCRL
FT                   RVAGMHAPSLALGGAEKLRVGQPVNAIGLPHARLGGRLKGNRNEERRNGRDRICPMCDG
FT                   SKVTGLQEEHRRDPILAEGVVAVMRPYAGSRYMRISAPLLPGFSGGGLFDEQGQLVGIL
FT                   SPQRVEGESLAFVLPSDWLDSLPKMTQAPRPMDPKSADPGHGLVWLNQTLALEKKADWR
FT                   RLLKLSQQETGRDPSNAAAWFNVGIASCNLKQYSQAVNAYREAIRHHAGYADAWHKLGM
FT                   AYAHLKDYENASQAYEDAVRLDPDNGEAWYDLGNTYHHLKKYAHTIHAYRHALRIDPKN
FT                   FRAWYNWE"
FT   sig_peptide     16951..17031
FT                   /locus_tag="Nmul_A0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 27"
FT   gene            18171..18386
FT                   /locus_tag="Nmul_A0018"
FT   CDS_pept        18171..18386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD44"
FT                   /protein_id="ABB73327.1"
FT                   /translation="MTYDELKLHGEAVEAYRKTVVLQPENADAWYNLGVDYAILDERDR
FT                   IREIYKTLRKLDPSRAERYFNTYILP"
FT   gene            18529..19548
FT                   /locus_tag="Nmul_A0019"
FT   CDS_pept        18529..19548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0019"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73328"
FT                   /db_xref="GOA:Q2YD43"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD43"
FT                   /protein_id="ABB73328.1"
FT                   /translation="MDENRSKALAAALSQIEKQFGKGSIMRLGASDVGKDVQVISTGSL
FT                   GLDIALGVGGLPRGRIVEIYGPESSGKTTLTLQVIAEMQRMGGTAAFIDAEHALDSQYA
FT                   QKLGVNVQDLLISQPDNGEQALEIADMLVRSGSIDVVVVDSVAALTPRAEIEGEMGEPQ
FT                   MGLHARLMSQALRKLTGNIKRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVR
FT                   LDIRRTGSIKKGEEVIGSETRVKVVKNKVAPPFRQAEFDILYGEGISREGEIIELGVQH
FT                   KLIDKSGAWYAYKGDKIGQGKDNVREYLKEHRDIAMEIESKIRAAVGVSNPAEPAPVE"
FT   gene            19616..20068
FT                   /locus_tag="Nmul_A0020"
FT   CDS_pept        19616..20068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0020"
FT                   /product="Regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73329"
FT                   /db_xref="GOA:Q2YD42"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD42"
FT                   /protein_id="ABB73329.1"
FT                   /translation="MTRAPSLKTRALGYLAKREHSRLELEKKLAPHAETPEELSSVLDG
FT                   LEQRGFLSAARLVEQIMHMRKARFGSLRILQELREKGIEENLITAVLPDLREAEQRSAY
FT                   EVWRKKFGAIPADAKAFGRQTRFLLGRGFRPEVVRRVLQHPDKEEG"
FT   gene            20065..20517
FT                   /locus_tag="Nmul_A0021"
FT   CDS_pept        20065..20517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD41"
FT                   /protein_id="ABB73330.1"
FT                   /translation="MKNHLSRLSRRTAQFLQAVFLVAALGILLGSCDRLRATPINEVNT
FT                   SPANFDGKEVVFHGVVTELTRIPLIDMKSFILKDESGEIAILTDHDLPKSGQELSVKVK
FT                   VQNLAIINGEPLGTTITEIERQEWAIKDWINRTVSQAASNLPRLIK"
FT   gene            20524..23112
FT                   /locus_tag="Nmul_A0022"
FT   CDS_pept        20524..23112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0022"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73331"
FT                   /db_xref="GOA:Q2YD40"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD40"
FT                   /protein_id="ABB73331.1"
FT                   /translation="MKSSEVRQKFLEFFETHGHTIVPSSPLVPGNDPTLLFTNAGMVQF
FT                   KDVFLGQDKRPYVRAASAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRN
FT                   AIRFAWEFLTDILKIPRERLWITVYAEDDEAADIWLNEVGIDSSRFTRIATQDNFWQMG
FT                   DTGPCGPCSEIFYDHGPEIPGGPPGTPNADGDRYVEIWNLVFMQYNRDSAGTLHPLPRP
FT                   SVDTGMGLERISAVMQQVHSNYEIDLFQQLIKAAARATNTTDLSSSSLNVIADHIRACS
FT                   FLIADGVIPGNEGRGYVLRRIIRRAIRHGYKLGQKQPFFHQLVEDLASVMGQAYPELME
FT                   AKTRVSAVLKQEEERFAETLENGMQVLEAALRRGDRMLDGETLFRLYDTFGFPLDLTAD
FT                   IARERGIAIDEAGFDQAMEQQRERARTTSKFIMQEAIAYSGPSTTFHGYESLRQEGQVL
FT                   AIYKEGSRVEFIEAGDEAVIVLDKTPFYAESGGQVGDSGELLAANGTFAVADTQKIQAD
FT                   VFGHKGLLRSGRLATGDAVLAEVDRAARARTERNHSVTHLMHKALREVLGHHVQQKGSL
FT                   VDANKTRFDFAHNQPVTDAEIRKVEMLVNAEILANAATEARMMAIEDAKKSGAMMLFGE
FT                   KYSDEVRVLDIGTSRELCGGTHVKRTGDIGLFKIVAESGVAAGVRRVEAVTGERALTYI
FT                   QEQELQLQRVAAAVKAQPQDAAARITQILDNVKHLERELGRMKSKLASSQGDDFADRVR
FT                   EIKGVKVLAVCLEEADPKTLREAVDKFKNKFKSCVTVLAAVEDGKVKLIAGVTSDLTAR
FT                   LKAGDLVNFVAQQVGGKGGGRADLAQAGGTVPDSLPAALESVASWVEQHL"
FT   gene            23153..24103
FT                   /locus_tag="Nmul_A0023"
FT   CDS_pept        23153..24103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0023"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73332"
FT                   /db_xref="GOA:Q2YD39"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD39"
FT                   /protein_id="ABB73332.1"
FT                   /translation="MTSKHARLLILGSGPAGYTAAVYAARANLKPMLVTGLAQGGQLMT
FT                   TTEVDNWPADAMGVQGPELMERFQKHAERFDTEIIFDHIHTARLSEKPFTLIGDQGTYT
FT                   CDALIIATGASARYLGMPSEEAYMGKGVSACATCDGFFYKGQDVAVIGGGNTAVEEALY
FT                   LSNIARSVTVVHRRDKFRSEKIMIDKLMDKVKNGNIKLELHYVLDEVLGDESGVTGMRI
FT                   KNVLDDSTKTIDLQGVFIAIGHKPNTDIFQGQLKMENGYIMTQAGIHGNATATSIPGVF
FT                   AAGDVQDHIYRQAVTSAGTGCMAALDAEKYLDVLV"
FT   sig_peptide     23153..23227
FT                   /locus_tag="Nmul_A0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.956 at
FT                   residue 25"
FT   gene            24258..24893
FT                   /locus_tag="Nmul_A0024"
FT   CDS_pept        24258..24893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0024"
FT                   /product="Smr protein/MutS2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73333"
FT                   /db_xref="GOA:Q2YD38"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD38"
FT                   /protein_id="ABB73333.1"
FT                   /translation="MRRREGKPGIHTTTRTETAAGSDKREGTGASIGDNDAAVFRAAMR
FT                   DVAPLAPTDKVILSASHPPPVPLQFQPARPAVHDALSDDGHPLEPGDEWAFLRPGVSRQ
FT                   TLRRLRRGYWKIEAQLDLHGLTREEARLALGVFLDASGESGKRCVRVIHGKGFGSQNRE
FT                   PVLKTRIGGWLFQREDVLAFCQARPAEGGSGAVLVLLRIFSDSQPATP"
FT   gene            complement(24924..25319)
FT                   /locus_tag="Nmul_A0025"
FT   CDS_pept        complement(24924..25319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0025"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73334"
FT                   /db_xref="GOA:Q2YD37"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD37"
FT                   /protein_id="ABB73334.1"
FT                   /translation="MAQFTEEQLAQLKEVLQQRYLQLREEVRDELESSGDQHYADLAGS
FT                   VADPGDASVADMLVDVGANLVDRQVNEMREVEAALKRLADLDYGDCIDCGGEIGFDRLM
FT                   VYPTAQRCVRCQEVHEKTYMHENKPTL"
FT   gene            complement(26103..27338)
FT                   /locus_tag="Nmul_A0026"
FT   CDS_pept        complement(26103..27338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0026"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73335"
FT                   /db_xref="GOA:Q2YD36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD36"
FT                   /protein_id="ABB73335.1"
FT                   /translation="MEKPDQIALPQQPVPRKKLPPTVIVLGLVSFFNDFASDIVVPLIP
FT                   ILLATVLAAGPIALGLIEGVADAVASLLKLWAGRHSDIMRERRKGLAVAGYTLSNITRP
FT                   MLGLAGSWLVILVLRSIDRAGKGLRSAPRDALVADATPPGMHGYAFGYHRAMDNGGAVA
FT                   GSLVAAAVLAWSGLSLTEVILWSAVPGVIAVLLLGVGVKEDKEDAAGHRPVPPELPPLR
FT                   WSLLSLPMRRYLLVLMLFTFARASETFILLLGHQLGVGTVELLLLWAALSLCKAATSIW
FT                   GGQLADSLGRGTLMLIGWSTFSLSFLMLGQVAGSSGLWAVSIFYGLCAGMSEGAERAII
FT                   SDYALPRERGTAFGWYHLMVGLAAIPAGLLFGSLWQFQSAATAFFFAGGLAAIAAVLLR
FT                   MWALPVRKLNPN"
FT   gene            27371..27446
FT                   /locus_tag="Nmul_AR0001"
FT   tRNA            27371..27446
FT                   /locus_tag="Nmul_AR0001"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg1"
FT   gene            28045..28866
FT                   /locus_tag="Nmul_A0027"
FT   CDS_pept        28045..28866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73336"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD35"
FT                   /protein_id="ABB73336.1"
FT                   /translation="MEIVTKTYNRVLVQANKDGPRLAIDDKEAGASALGKEASHCNQDR
FT                   QTSFAKGRAKTSVNKLNELGVEVNLESAAFARGGYFITCQESNPRQFPCDTGGCLGNVT
FT                   NNKLASADVSSSARVELRLLTADSSDYRIKISKSGSSDLVATLIGPDGKEVKLNEPGGK
FT                   DPVLRRASKGSYQLNLELPAVASKKGQDREELEKSATVRVQLIALPTQESPKTETPKPE
FT                   ASKPETPKSETPKPEASKSETPKSEAPKPETSKPETSKPETPKSEASKSKK"
FT   gene            complement(29878..30336)
FT                   /locus_tag="Nmul_A0028"
FT   CDS_pept        complement(29878..30336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0028"
FT                   /product="Rickettsia 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73337"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD34"
FT                   /protein_id="ABB73337.1"
FT                   /translation="MNQTSISAAWAKRLLLLALVALLSACQSTETRRAGGLIGSVAGSI
FT                   GGGYLGSYLGGGTAGRILGAVAGGVGGYYLGAEIGGRLGQEDQRRMAQTSQRAYETNQT
FT                   QTFTNPDSGVSGRAEVVGVDDSSNCKTIRQTVVLKDGKTVTEDVKSCK"
FT   sig_peptide     complement(30250..30336)
FT                   /locus_tag="Nmul_A0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.691 at
FT                   residue 29"
FT   gene            30389..30721
FT                   /locus_tag="Nmul_A0029"
FT   CDS_pept        30389..30721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73338"
FT                   /db_xref="GOA:Q2YD33"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD33"
FT                   /protein_id="ABB73338.1"
FT                   /translation="MGPQCSYTCRDPFASHCVINEKEDARMARLFCFLWGDFLRQLLFS
FT                   SYSQTAMKFRKIINLVTLLAILPALSGCWYLLAGGAGAYGGYKMKEKGYTLQNPITKEK
FT                   SSQTSK"
FT   gene            complement(30847..32124)
FT                   /locus_tag="Nmul_A0030"
FT   CDS_pept        complement(30847..32124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0030"
FT                   /product="Protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73339"
FT                   /db_xref="GOA:Q2YD32"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD32"
FT                   /protein_id="ABB73339.1"
FT                   /translation="MQPIESSASSRHTSSLKRSLADNRMGRLATALLMVMLAVLVLTNI
FT                   FLPVHPAMGYVRAFAEAAVVGALADWFAITALFRQPLGLPIPHTAIIPRNKDRIGESLG
FT                   RFVESNFASPEVVAAKLAPVDLSGKLATWLCGEARTDLLADYVTHLIPELLDSVDERHV
FT                   QHFVSAGVLEKAGRIDLGPLLGEAVRMLTAEKRHQRLLDKLLREADEYVTANESRIRQR
FT                   VRENTAWFWQRLSMDEKVGESVVAALREVVAEIARDPAHPLRLRLDAAIGKLASDLATS
FT                   PEYREQVAAHTRKLLEHPALRDYADGVWRDLRNGMREDIDSEDSAIRGWMRGLIQSGTD
FT                   TVLEDRGLRERLNNWMREVLVEAVQSHQRDVGRLIADTVREWDTQTVTHRIERQVGEDL
FT                   QYIRINGTLIGGLAGLAIYTIAHLFA"
FT   gene            complement(32159..32398)
FT                   /locus_tag="Nmul_A0031"
FT   CDS_pept        complement(32159..32398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD31"
FT                   /protein_id="ABB73340.1"
FT                   /translation="MHSSAEIAWDLRGYKRGTILQSGEISYGCPSFSFFKRHFRVWLSG
FT                   RHVDQEIRKTKKYLDYTVLQHVLSIHLAQKSLEK"
FT   gene            32528..33013
FT                   /locus_tag="Nmul_A0032"
FT   CDS_pept        32528..33013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73341"
FT                   /db_xref="InterPro:IPR033456"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD30"
FT                   /protein_id="ABB73341.1"
FT                   /translation="MASENFKSNLITGLAAGVGATLLAPVLLPFLARLVRPATKAAIKG
FT                   SVLLYEKGRESFAELSETVDDLMAEVKSEMEAGAVEDVAAGASAVQAGSAQGRTASPPP
FT                   QPRPDSVAGQSSATPAASPPGEADKAPESLLTQPAMQANRGSQRHEEAQDRPPTKGE"
FT   gene            33010..33522
FT                   /locus_tag="Nmul_A0033"
FT   CDS_pept        33010..33522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73342"
FT                   /db_xref="GOA:Q2YD29"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD29"
FT                   /protein_id="ABB73342.1"
FT                   /translation="MMAPLARVVHSLPGRKRIKIDERRGDTAYFETLQKELAECPGVGA
FT                   VVTNSRTGTALVIHKVEDPVLWRYIAEHGLLQLGKNETSAPAVGPSIVDDIRNVERKPY
FT                   PKSGKKPDIRRLIFLGMMGMGIVQVIRGNIAIPAIAAFWYAYFILPATNDDNQEHSFLE
FT                   TKLSEES"
FT   gene            33715..34551
FT                   /locus_tag="Nmul_A0034"
FT   CDS_pept        33715..34551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73343"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD28"
FT                   /protein_id="ABB73343.1"
FT                   /translation="MKTPRSGRHGGGKPHPEEKKWTDNNIETPEEARYARGETPPGDEG
FT                   YVGTTHPYRSDAERAMGEAGRTVKTGIASSLRGIDEIESDIVSLVRNTVSNTLRATGAV
FT                   GAEAVDITRDVVKGALAATEDVGTGLALSTKSVAKGVVMGVSDVGGDVITAATETVKAA
FT                   VRGAADAGGDTLLVAKRTVDGVAEGTRETGGNVVEMVRATVNAAAGGIGDIGTTAVASV
FT                   RDILMSVVEGVKDVAGAAMLKSYHPEDRVSPGEYTAPTERTNPPEYVSPPESKKPT"
FT   gene            34825..35184
FT                   /locus_tag="Nmul_A0035"
FT   CDS_pept        34825..35184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73344"
FT                   /db_xref="GOA:Q2YD27"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD27"
FT                   /protein_id="ABB73344.1"
FT                   /translation="MAHYIHHVPGRLRVNTPLLKKNEPGARQLKSYLEGVNGILQIEAS
FT                   IVTGSVVIRYDKCLVSSTSILNSLQDLGYIQHIGTLSESANGTRGTPKVVDIFVQKLVE
FT                   TALERSAVALVAALI"
FT   gene            complement(35230..36420)
FT                   /locus_tag="Nmul_A0036"
FT   CDS_pept        complement(35230..36420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0036"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73345"
FT                   /db_xref="GOA:Q2YD26"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD26"
FT                   /protein_id="ABB73345.1"
FT                   /translation="MMKQNFMFTSESVTEGHPDKLCDQVSDALVDRFLQQDPFSKVIAE
FT                   CAVSTGILFIAARFASSASVDIPEVARRVIHQLGYEQADFNARDCTIMTSLSELPAPSY
FT                   PFIDEREMNEEELESVTAKNQANVFGFACNQSSAFMPLPISLSHKLARRLTAARFQKQI
FT                   PYLAPDGKTQVGVEYREGRPYRIHSITIIAAQQKTAMRGLAPLRDDLNAHVIEPVFATE
FT                   TLRPDSRTHIFINPEGLVADGGPSLHSGLTGRKNAVDTYGEYSRHSESALSGKDPSRID
FT                   RVGAYAARYAAKNVVAAGLAQACEVHLAYSIGISRPVSVQADTFGTGSVPDTEITARIL
FT                   DQFDFRPAGIIRAFNLRYQPQLFRGLFYRKLAVYGQVGRMDIGLPWENTDKAALLR"
FT   gene            complement(36417..39539)
FT                   /locus_tag="Nmul_A0037"
FT   CDS_pept        complement(36417..39539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0037"
FT                   /product="ATPase, E1-E2 type"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73346"
FT                   /db_xref="GOA:Q2YD25"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD25"
FT                   /protein_id="ABB73346.1"
FT                   /translation="MSLLFDQMQRPSFFGTGATEAEPPEPVRIVHAAVGGRARLKVRGL
FT                   YRSESVRRKLESALPRHDAIRHASANILTGRVLIVFDPARDLEEIKTWLEQLLLEAGHE
FT                   IIPGNPVDDGRFLRASGRPASPVISSDPDSVLLQDRKNWHALPGDTVVAALETSMEFGL
FT                   SQASVERKLGYFGVNSLPETPPRSGLSIFLGQFKSLPVALLGVSAVLSAATGGLLDAAV
FT                   ILGVVLINAGTGYVAESQSERTINALGHVAEQNAMVIRDARLLEVPAKSLVPGDILVLT
FT                   PGARVAADGRVLESRNLMMDESMLTGESLPVAKRVSPLDKPEVSLADRLNMVYMGTVVT
FT                   GGSGLSVVVSTGRYTEIGMIQSLVGETRPPETPMQRQLAILGNQMVLLSLGICGAMFLI
FT                   GLVRGHAWLQMLKTSISLAVAAVPEGLPTVATTTLALGIRTMNRHKVLVRRLDAVETLG
FT                   AVQVICLDKTGTLTLNRMSVLALYSGGRRITVDSDVFYDAGIRINPYQSDELLRLLHVA
FT                   VLCNEVELNGEKGNYLLKGSPTESALMHLALAAGVSVEALRRRYPREQVEYRTETRNYM
FT                   STTHSAQGEGKLVAVKGNPVEVLEMCRWWLKDGARLPLTQAERTVILMENDRMAAEALR
FT                   VLGFAYVEPRQADQSSADELIWLGMTGMADPLRQGMKELIALFHQAGIDTVMITGDQSG
FT                   TAYAIGKELGLSGGSELDILDSTRLDQLDAEVLAGLAQKVNIFSRVSPANKLQIVQALQ
FT                   RGGKIAAMTGDGINDGPALKAADIGVAMGGTGTEVARSVADVILEDDNLSTMIVAVSEG
FT                   RTIYNNIRKSIHFLTATNLSEIMLMLGSIGTGLGTPLTTSHLLWINLVTDVFPGLALAV
FT                   EPPEPDVLRQPPRDPAEPIVGPADFKRYGLESLAMAAGSMGGYGYAMTRYGGGQKASTI
FT                   AFMTLTMGQLLHAYSCRSDHIGIFSHETLRSNRYLDLAIGGTALLQWATVLVPGVRSLL
FT                   GNTPIGPLDVAAIGAGSVLPFFLNEATKETAFKGKRRKEPLSLPPAPQEYG"
FT   gene            39950..41914
FT                   /locus_tag="Nmul_A0038"
FT   CDS_pept        39950..41914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0038"
FT                   /product="Amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73347"
FT                   /db_xref="GOA:Q2YD24"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD24"
FT                   /protein_id="ABB73347.1"
FT                   /translation="MPGNTSHTQKSEINDLVIVGGGIAGLYCCHELIKKVRSGSLDIRS
FT                   ILLLEASDRFGGRIETWSLLRSSEENGKKIGFEDTWDPCNWNIDNGCLAPPDPQTGKQS
FT                   PFKGPTEKSFRNVDGKDVEKLTDIEYFRAEFGPMRIEPRDQILLQGLLDDLGIREPDPG
FT                   EEESLDDLVPFSSYTSEDPMAPRFTLQEEEAQQKTPFDLMILALRRIFELVQGPKFDGP
FT                   ASNPWCTEAANEQWRKLHSAQFFYRHYWKGELLEWIQYLTDPDFVTIREHARFRDQPLW
FT                   DLGFWNVLSDVLSHYAVVKIRDWGSYYHFVHENLNAAEWIIFWLRAIRSTGSLRGIRGG
FT                   MSRIIWNLLEVLRKHQNSHQSPRLKIAKGSRVVSVERRDDALVALTVQNEDEVELVCAR
FT                   RVIFALPKRPLEEMSWNGEHPKGKLHEAFNAVVCLPLLKCFFVIEKPWWEDNRSLNRHA
FT                   SDIPTRELLYVKSRDRTKGLIMIYTDRPAITFWSDYLRSESGNNSKGPEQPEGPQVDYQ
FT                   DAARIWFLEKKPSPTCGSIIEIKPGSARLWQRFVQFARDYEHHDFTTGRLLACGMRDWG
FT                   KEPFGAAAHGWRPGVKSREHIEFLEAFSLEQEEQETGQNNLHVCGEAFSDYQGFIEGAL
FT                   RSAQRVLVVIEEQQEPGKS"
FT   gene            complement(41919..43004)
FT                   /locus_tag="Nmul_A0039"
FT   CDS_pept        complement(41919..43004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73348"
FT                   /db_xref="GOA:Q2YD23"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD23"
FT                   /protein_id="ABB73348.1"
FT                   /translation="MSFSPNKEELRPQAVEILAAQAAAAGLIYVSGDEPGIRRLASGEG
FT                   FRYVGPDEKPLSDKGELERIARLAIPPAYTDVWICPHPLGHLQATGLDARSRKQYRYHS
FT                   DWRAVRDSIKFDRMVEFGEALPQLRERVHLDLKKRGLPQKKVVAAIVRLLDTTQVRIGN
FT                   LSYARDNHSFGLTTLRKRHLAFINPRRALLKFRGKSRVEHEVTIGDRRIITIIRACQEL
FT                   RGQHLFQYLDESGKRRPVGAEQVNAYLHEVMEAEFTAKDFRTWSGTLRAFEIMLNTPLP
FT                   EFPTKRALKAGIVAAIRQVAEDLRNTPAVCRKSYINPAVFSAWQKGDLHRCVQEMEEAA
FT                   HAAHDPLESAVLSFLRKQKTG"
FT   gene            complement(43320..43700)
FT                   /locus_tag="Nmul_A0040"
FT   CDS_pept        complement(43320..43700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0040"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73349"
FT                   /db_xref="GOA:Q2YD22"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD22"
FT                   /protein_id="ABB73349.1"
FT                   /translation="MSETAKEFILNQTVIPQLRIISATVSLPFYVEGLGFSVDWKHQFE
FT                   PGFPLFIQLTRKDQVIFLTEHTGDCQGGGAIYFIVPNVDNCYGEFTGRGITTIEAPQDT
FT                   PWGTREMVVTDPDGNRLRFVTH"
FT   gene            43871..44449
FT                   /locus_tag="Nmul_A0041"
FT   CDS_pept        43871..44449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0041"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73350"
FT                   /db_xref="GOA:Q2YD21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD21"
FT                   /protein_id="ABB73350.1"
FT                   /translation="MTNANQRNQRKKQPALVRRRLLDNGARLCVEQGVAGLTLQAVADA
FT                   ADVTKGGLLHHFSTKQALIEEIFSERLQAFDTSIKQAMKLDPEPSGCFTRAYITATLEL
FT                   IEKDDFIQWAALMMAMLTEPGLKKRWTQWLEQSLEQHRDTDSAPEMRLARYAVDGLWLA
FT                   GLLDEEERVATKREALHLHSQLIEMTRKP"
FT   gene            44617..45792
FT                   /locus_tag="Nmul_A0042"
FT   CDS_pept        44617..45792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0042"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73351"
FT                   /db_xref="GOA:Q2YD20"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD20"
FT                   /protein_id="ABB73351.1"
FT                   /translation="MRFINLITTIFIALSTIFLAACSNTESSTSVEPPPPDVAVADVLS
FT                   RSVRAWDEFNGRVRAVPTVELRPRVSGYIDRVAYKEGSEVKPGDLLFVIDPRPYRNALQ
FT                   SAQAQLEHARAAANLAQSRTEHAQALFAAQAMSREEFNGRQTELNQTIAEVRAAEAAVA
FT                   TAKLNLNFTEVRAPIAGRVGRAYLTAGNLAQADQSILTTLVSQDPMYVYFDCDEHNFLR
FT                   YKEFARKNDRESNVYPVRIRLANEEGFSHHGTVDFFDNQLNPATGTIRVRAVVANADRA
FT                   LTPGLHARVQLQGGDVLHALLIDDKAILTDQDRKYVYVLGEGNKALRKNITLGRQVDGL
FT                   RIVQSGLDTTDKIIVIGAQKIFHDGMTVKPQHVAMETRAAIPPSTLLKATE"
FT   sig_peptide     44617..44694
FT                   /locus_tag="Nmul_A0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.291 at
FT                   residue 26"
FT   gene            45802..48930
FT                   /locus_tag="Nmul_A0043"
FT   CDS_pept        45802..48930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0043"
FT                   /product="Hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73352"
FT                   /db_xref="GOA:Q2YD19"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD19"
FT                   /protein_id="ABB73352.1"
FT                   /translation="MDFSRFFIDRPIFAIVLSIVIFAAGLIAIPLLPAGEYPEVVPPSV
FT                   VVRAMYHGANPKEIADSIAVPLEEAINSVEGIMYMKSVAGSDGSLQVTITFTPGIDPDT
FT                   AAVRVQNRVAQALSRLPNDVRQYGVTTQKQSPTPLMYVNLSSPDGRYDAVYLRNYMTLN
FT                   IKDQLSRLKGVGNVGLYGEGDYAMRLWLDPNKLAARGLTASDVVDAVREQNVQVSAGQL
FT                   GAQPSPRSADFLVPINVRGRLRSEQEFGDIVLKSADDGQLVRLADVGRVELGSSDYTLH
FT                   AMIDNRGSTSAGIFLTPGANSLEVARTVYAKFEELAASFPPGIEYRVVWDPNVFVRDSI
FT                   RAVGQTLIEAVFLVVLVVILFLQTWRASIIPLIAVPVSIIGTFAWLYLLGYSINTLTLF
FT                   GLVLAVGIVVDDAIVVVENVERNIEEGLSPLAAAHQAMKEVSGPIIAIALVLCAVFVPM
FT                   AFLSGVTGEFYKQFAVTIAISTVISAINSLTLSPALAAKLLRGHDAPKDAPTRVLERSL
FT                   GWLFHPFNRLFLRSSGKYQSTVARTLGQRGRVFTVYAGLLLATVMLFHIVPTGFIPNQD
FT                   KLYLFAGAKLPEGASLARTDAVTRQLNDLASSIEGVEMTESYVGMNALQSVNTPNQAAS
FT                   YVILKPFDQRRRSAESITAELNARLADIKDGQAYALLPPPIQGLGNGSGYSLYLVDRGG
FT                   LGYGALQSATTKFQNAIAQTPGMTFPVSSYQANVPQLEVKVDRVKAKAQGVNLTDLFNT
FT                   LQVYLGSFYINDFNLYGRVYRVMAQADAAFRQNAEDINNLYTRNSRGEMVPLGSMVTIQ
FT                   HTFGPDPVIRYNGYPAADLIGDADPRVLSSGQVIAKLSEIATEVLPPGITLEWTDLSYQ
FT                   QVTQGNAAVIVFPLSIMLAFLVLAALYESWTLPLAVILIVPVCMCAALFGIWLTGGDNN
FT                   IFVQVGLVVLMGLACKNAILIVEFARELEIQGKDTIEAALEACRLRLRPIVMTSIAFIA
FT                   GSVPLVLSQGAGSEVRYATGITVFAGMLGVTLFGLFLTPVFYVALRKLARPKL"
FT   gene            complement(49143..49829)
FT                   /locus_tag="Nmul_A0044"
FT   CDS_pept        complement(49143..49829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73353"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD18"
FT                   /protein_id="ABB73353.1"
FT                   /translation="MNRFFRDAIASGVLLSAISAAQATPIYMTADFSGGILTTNGLANS
FT                   LGLQQTSTCSGCAAGSVSGKVLFDQSLIPGSGTGTVNIALAAVTGASNSTIFDIDFGSR
FT                   PLGFEFGNGDVLGGPSIQFNNGVFNGFFFVKDFVADGKTYELSMQGANWTMNWLKSNSS
FT                   SQLVAAGYLNVGNQGLTSQAYFDPSLPATELPNNRIPEPTVLALVMVGMLGIFMTRRHK
FT                   QTYAAA"
FT   sig_peptide     complement(49758..49829)
FT                   /locus_tag="Nmul_A0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.915 at
FT                   residue 24"
FT   gene            50064..53867
FT                   /locus_tag="Nmul_A0045"
FT   CDS_pept        50064..53867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0045"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73354"
FT                   /db_xref="GOA:Q2YD17"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD17"
FT                   /protein_id="ABB73354.1"
FT                   /translation="MSLPEGMVEKGMIESRLHPNFGIAMNEHPRIKLLEDLLARRILLL
FT                   DGAMGTMIQSHKLGEKDYRGERFADFPHDLRGNNDLLTLTQPQVIRSIHEAYLEAGADI
FT                   VETNTFNSTAASMGDYHMQDLVYELNFAGARLAKEAAQAMEAKTPEKPRFVAGVLGPTT
FT                   KTASISPDVNDPGFRGITFDQLVEDYSESIRGLLDGGADILLVETIFDTLNAKAALFAI
FT                   DRYFETHQVRVPIMISATITDASGRTLSGQTPEAFWNSVSHARPLSVGLNCALGAELMR
FT                   PYVEELSRVAGVYVSAHPNAGLPNPLAETGYDESPEYTAGLIKGYAQAGFVNIVGGCCG
FT                   TTPAHIKAIADAVGSIPPRVVPDVPKKLRLSGLEPLNIGDDSLFVNVGERTNVTGSKAF
FT                   ARLILGNNYAEALSVGRSQVENGAQIIDINMDEAMLDSQKAMVTFLNLVAAEPDISRVP
FT                   IMIDSSKWSVIEAGLKCVQGKPIINSISLKEGEAEFIEHAKLARRYGAAVIVMAFDETG
FT                   QADTLARKVEICARCYRILVDQVGFPPEDIIFDPNIFAIATGIEEHNNYGVDFIEATRA
FT                   IKEKLPYAKVSGGVSNVSFSFRGNEPVREAIHTAFLYHAVRAGMTMGIVNAGQLGVYSD
FT                   IPKDLLERVEDVLLNRPVPGDGETTATERLVEFAESFKGQSKESTEDLAWRNGSLQERL
FT                   THALVKGITTYIVEDTEAARQEIAAQGGRPIQVIEGPLMNGMNVVGDLFGSGKMFLPQV
FT                   VKSARVMKQAVAHLLPFIEAEKKLSGDSKPKGKIVIATVKGDVHDIGKNIVTVVLQCNN
FT                   YEVVNMGVMVPSAQILETARRENADMIGLSGLITPSLEEMAHVAKEMEREGFTIPLLIG
FT                   GATTSRVHTAVKVAPKYSGVTVWVPDASRAVGVCSNLLSEDLRADYIQQIQTEYERVRA
FT                   QHKNKKGPAPMLSIADARKNAFKTDWETYSPPSPGFTGLRSLRNYPLEKLVPFIDWTPF
FT                   FQAWELSGRFPAILEDEVVGEAASNLYRDAQVMLKKIVEQKWLTANAVFGLFPANTVNS
FT                   DDIEIYTDKARERVAMTFHNLRQQTMKPDGKPNLCLADFIAPRESGITDTIGAFAVTAG
FT                   MGIEAKLKVFEEAHDDYSAIILKALADRLAEAFAEHMHWRIRREFWGFVKDENLSNEQL
FT                   VAEEYQGIRPAPGYPACPDHTEKGPLFEMLKAPENAGIIVTESFAMVPTAAVSGFYFSH
FT                   PEARYFAVGKIGKDQVEDYARRKGWTMEETETWLAPVLAYER"
FT   gene            53982..54362
FT                   /locus_tag="Nmul_A0046"
FT   CDS_pept        53982..54362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0046"
FT                   /product="IS298, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73355"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD16"
FT                   /protein_id="ABB73355.1"
FT                   /translation="MWVMDRDMLSDAQWARISGLLPGKPTDKGGRAADNRLFVEAVLYT
FT                   ARVGNPWRDLPPKFGNWHSVYVRFARWEANGVWSRVAEALQGEADLEELFIDSTVVRAH
FT                   QHSAGASKKTVAIRRSAARVVG"
FT   gene            54212..54745
FT                   /locus_tag="Nmul_A0047"
FT   CDS_pept        54212..54745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0047"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73356"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE3"
FT                   /protein_id="ABB73356.1"
FT                   /translation="MVACCRSAPGRGRSGRAIHRLNRRACAPALGWRVKKNGSDQAIGR
FT                   SRGGLTTKIHACVDALGNPLRLILTGGQVADITQGPALINSIKTDAVVADKGYDSHVFV
FT                   AVITETGAEAVIPSRSNRCASREFDRERYKARNLVERFFNRLKQFRRLATRYDKLANRF
FT                   NAFLHLACAYIWLL"
FT   gene            54842..55651
FT                   /locus_tag="Nmul_A0048"
FT   CDS_pept        54842..55651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73357"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD14"
FT                   /protein_id="ABB73357.1"
FT                   /translation="MDANSVLGAITKSTLEQLGQLIRNLERLVGLLDECPISAGLESEW
FT                   NDEYCEKVSKLAQEVEALAYSTRIPQPLIPFTGFYDTFGIKTHAYVSFLHSLRAERSTW
FT                   LPRPEGYFGNIEALKFPDQLITFHQRVYEIYDRWTRVGDLRQAAGKPSGYTLSRRFDEH
FT                   QVEELSKTSRFRRMLESALKDAFTDADQKELLGEITHAAVVYAKDFRLELHGIASVLVW
FT                   IEAAKRYAHHISDNAHRMQHSALERELAKVWDAGRVQEIHSLSCKSR"
FT   gene            complement(55669..56367)
FT                   /locus_tag="Nmul_A0049"
FT   CDS_pept        complement(55669..56367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0049"
FT                   /product="Protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73358"
FT                   /db_xref="GOA:Q2YD13"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD13"
FT                   /protein_id="ABB73358.1"
FT                   /translation="MCGRYGLNHPDPVLAEWYRASFMPELKPRYNIAPTMEILAIRDTD
FT                   SGRMGSMMRWGLIPYWIKDVKKLPVLNNARAETVAEKPAFRQPFRQRRCLIPASGFFEW
FT                   KTESRRKQPYFISSRDGAPFSFAGIYETWVTDTGEAKESCAIITTGCNALMQPIHDRMP
FT                   VILPEDAWDTWLDPDLRRNEILLSLLKPCDENRMQAWPVTQAVGKVVNQGEELFRPLIS
FT                   EQEGDFFGAN"
FT   gene            complement(56539..58686)
FT                   /locus_tag="Nmul_A0050"
FT   CDS_pept        complement(56539..58686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0050"
FT                   /product="(p)ppGpp synthetase I (GTP pyrophosphokinase),
FT                   SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73359"
FT                   /db_xref="GOA:Q2YD12"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD12"
FT                   /protein_id="ABB73359.1"
FT                   /translation="MQARGLSSSSATLPEASFLFHELSSYLTREDVSELQNAYLFSQSA
FT                   HSGQFRQSGEPYISHPLAVASILGKLRLDSQTLAAALLHDVMEDTHVSKAEIGDRFGKS
FT                   VAELVDGVSKLDKIEFQSHADAQAENFRKMLLAMARDVRVILIKLADRLHNMRTLEAMR
FT                   PEKKRRIARETMEIYAPIANRLGLNNIYHELQDLSFRYLYPRRYRVLTNATRAARGNRR
FT                   EMVTKILETMKQRLKTAGLDAEVTGREKQLYSIYKKMVEKHLSFSEILDIYGFRVIVKD
FT                   VASCYIALGALHSLYNPIPGKFKDYIAIPKANGYQSLHSTLWGPYGTPIEIQIRTPEMH
FT                   RIAEAGVASHWLYKSSDADLNDLNMKTHQWLQSLLETMSDSTDSLEFLEHIKVDLFPGE
FT                   VYVFTPQGEILALPKGSTAVDFAYAVHTDIGDCCVAAKINGENAPLRTVLRSGDRVEIV
FT                   TASHAKPNPAWLNYVVTGKARSHIRRFLKTMQYEESAKLGERLLNQAFATLKVDPQTIS
FT                   EAQWEKLTRESGAKSRTDLLADMGLGKHLPAVIARRLAASPGESTLGASGATDVITILG
FT                   TEGMAVQFARCCRPIPGDPVIAFIKKDQGLVIHTDDCPAVTKNKGSSDNWLDVAWGKDI
FT                   DRQFEVGIKLMVANQRGVLARVAAAIADADSNIDNVAMEGDGAYTNMNFVLQVRNRHHL
FT                   AQVIRSLRRIPEVAKISRVKE"
FT   gene            complement(58820..59026)
FT                   /locus_tag="Nmul_A0051"
FT   CDS_pept        complement(58820..59026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0051"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73360"
FT                   /db_xref="GOA:Q2YD11"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD11"
FT                   /protein_id="ABB73360.1"
FT                   /translation="MARITVDDCLKKIPNRFDMTLVATIRARQLSVGGSPMVEPARDKP
FT                   TVIALREISQGLVGTDILTTGPI"
FT   gene            complement(59209..59841)
FT                   /locus_tag="Nmul_A0052"
FT   CDS_pept        complement(59209..59841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0052"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73361"
FT                   /db_xref="GOA:Q2YD10"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YD10"
FT                   /protein_id="ABB73361.1"
FT                   /translation="MTTTPGTLYIISAPSGAGKTSLVKALLQTGIDLSLSISYTSRQPR
FT                   PEEMDGRDYHFVTRQVFEQKLQEDEFLESAELYGNFYGTSKKWINETMTSGRDILLEID
FT                   SQGARQVRAVFPVAVGIFVLPPSLEVLEMRLRQRAQDSLEAISRRLAAAREELSHAGEY
FT                   NYIIINDKLDRALQDLKCIIQAERLKTAKQLVRHHGLLAQLTRTSVL"
FT   gene            complement(60014..60454)
FT                   /locus_tag="Nmul_A0053"
FT   CDS_pept        complement(60014..60454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0053"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73362"
FT                   /db_xref="GOA:Q2YD09"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD09"
FT                   /protein_id="ABB73362.1"
FT                   /translation="MSDSLHLVCPHCHSINRVPTARLGEQPNCGQCHQPIFAGQPLELT
FT                   GSTFARYINKNDVPVLVDFWAPWCGPCKMMAPAFKEAAALLEPHVRLAKVNTDVEQTVG
FT                   AQYRIRSIPTLILFKDGRELARQAGAMTTQDIVRWTRSQALG"
FT   gene            60899..61306
FT                   /locus_tag="Nmul_A0054"
FT   CDS_pept        60899..61306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0054"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73363"
FT                   /db_xref="GOA:Q2Y705"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y705"
FT                   /protein_id="ABB73363.1"
FT                   /translation="MPGAMHSASGLDRIEIVTGIERRRRWSLGEKLKAVEESRLPGMSV
FT                   SYVARKYGIAPSLLFRWRKLMTEGGKEAVRSDDAVVSAAEVKELKKRIRELERVLGKKT
FT                   LENEILTEAVKLAHEKKLISRMPLLPPDDLP"
FT   gene            61303..62151
FT                   /locus_tag="Nmul_A0055"
FT   CDS_pept        61303..62151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0055"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73364"
FT                   /db_xref="GOA:Q2YCP5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP5"
FT                   /protein_id="ABB73364.1"
FT                   /translation="MKAIADTMGVARSRLVERMKPQEKSFRCRYNKADDAWLLPLIREI
FT                   VDCRATYGYRRICALLNRKLERMGKPAVNHKRVYRIMRQNGLLLARYTGKQRVLSHEGK
FT                   VITLRSNLRWCSDGFEIPCWNGQVVRVAFALDCCDREVISHVATTGGITGEMVRDLMTE
FT                   SVERRFGTVDLLPHRVEWLSDNGSCYTASETTAFAKDMGFISCFTPVRSPESNGMAEAF
FT                   VKTFKRDYVYVHDRPDAKTVMAQLDQWFEDYNEFHPHKGLKMKSPRQFIRSQLLTASCP
FT                   V"
FT   gene            complement(62655..63260)
FT                   /locus_tag="Nmul_A0056"
FT   CDS_pept        complement(62655..63260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73365"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD06"
FT                   /protein_id="ABB73365.1"
FT                   /translation="MFDWLKVKSTLEDARNECQKMRATIGKNKLRIEELKNLPPPREEL
FT                   ADLLAARMDRIADRYPQKLAEAVKLVTKNPCHGKDAGCNYVGDRGKVGGLKILTACEHD
FT                   HHEATVYDLEVALFWMLGDQLKAGLRKAVQEMEYPTIVGPAMPKRMTEINNLMAENTSL
FT                   QAQIDQIETGLTDAGVVHTAVQSQKPARKGDTGVYPPF"
FT   gene            complement(63303..64268)
FT                   /locus_tag="Nmul_A0057"
FT   CDS_pept        complement(63303..64268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0057"
FT                   /product="protein C, Serine peptidase, MEROPS family S49"
FT                   /EC_number="3.4.21.69"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73366"
FT                   /db_xref="GOA:Q2YD05"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD05"
FT                   /protein_id="ABB73366.1"
FT                   /translation="MSLHTELFGRPWALHKETFESLIRNAHAAGPGLKFPASQRKSVSQ
FT                   DGVAVIDITGPITPRASFLSLLFGGTDVETIQQDLSAALADSSVNKIVLNIDSPGGVVS
FT                   GVSPLADQIFSARSIKPIESFVSGMGASAAYWLAAATSHITISDTALVGSIGVVGTAID
FT                   DKARQQMQGVIFHQIVSSNAPKKRPDPATPEGLQVLQKEIDSLASVFTAKVARYRGVNE
FT                   MKVNSDFGQGGVLVGVEAVRAGLADAIGTFESTLVSSGAMPSAARATKKEEQISMSLEE
FT                   SCAAQWRNDPQIREEFVTLEGFTAYTRAAAAGSVKILRRV"
FT   gene            complement(64265..65140)
FT                   /locus_tag="Nmul_A0058"
FT   CDS_pept        complement(64265..65140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73367"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD04"
FT                   /protein_id="ABB73367.1"
FT                   /translation="MSASHIEANHWRQLATGGETPPGRQCGLPPDIEEHIRALTAPDSE
FT                   LVPAETLLWVRAKFREYVNGKRTLDEVMNLAPSAAQRNWRTVDRFEARNTWLVRAFELI
FT                   DEPTDHKRRLELSKQIDIFQEVFWPQLEERTLPPEDMTPFRRALFFAFKFGGGMVPRDW
FT                   RQLRKIVQEHAAASCTSSILLHLHADTYDQPRSTTAINPSTHIGKSYMDILGKLAVLTL
FT                   HAWGSSEELQARHDHDLSDYHGRILRQAMDCDDEKGELPPLITDVLSQEQIENALRSAG
FT                   LHMSTDAKSL"
FT   gene            complement(65529..66923)
FT                   /locus_tag="Nmul_A0059"
FT   CDS_pept        complement(65529..66923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73368"
FT                   /db_xref="GOA:Q2YD03"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD03"
FT                   /protein_id="ABB73368.1"
FT                   /translation="MAIRDDTQSIERGAVALDKVAAKASASKLPGPQLVETHTPLAPPR
FT                   MHEDGFPPLVHKFVEAACSNSEAHPVAVASNVLAFFCAMTGRSIFQKIGDASIHCRAFQ
FT                   IIVGKSGKARKGTAETTVREIFRRADEILRKRQGNNDRLRIHAGGLSTGEGVAWAIRDP
FT                   READDNGKGADAGVADKRLLVIESEMDNTLSQLRRDNNTLSATIRNLFDGRDMEPLTKT
FT                   NQTKATRPHVVILGHITSHELREKSTDNEVANGLLNRFMMLYVYRPKLVPLPEPTPEET
FT                   LSLLAARVADAVMAATGGDLHGNNTREVRLSDAARELWIEQYPRLTRDRDGKGGSLLAR
FT                   SEMYARMLAMIFAAMDGRLEIEPCDLWAAIAWVEYWHASVTYIFNCQDDEGGIDPFVAE
FT                   VLSLITSNPGITLTALQDHWNRKHIKQVKHALEVLLNLAPPLAEERKDSASGGRPALRY
FT                   YAYKKG"
FT   gene            complement(66910..67335)
FT                   /locus_tag="Nmul_A0060"
FT   CDS_pept        complement(66910..67335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73369"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD02"
FT                   /protein_id="ABB73369.1"
FT                   /translation="MSASTLLNRLDGVKQTGRGRWIARCPAHRDKRPSLAIRELDDGRV
FT                   LLHDFAGCETSNVLAAVGLSLEDLFPERQEGYSGQKERKPFYASDILRCLAFEALLVSI
FT                   AALNVAKGVELSEEDRKRLLVAASRLQRATEVCNGDS"
FT   gene            complement(67332..67607)
FT                   /locus_tag="Nmul_A0061"
FT   CDS_pept        complement(67332..67607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD01"
FT                   /protein_id="ABB73370.1"
FT                   /translation="MARQNAQVVALQASTTNKLIEAQDMLCEATYVAEFLSGALSNRAE
FT                   LESRLELSAPEAYGFIYTLQNLIKQIEKASALLDEHDAEQQKAGGS"
FT   gene            complement(68549..68803)
FT                   /locus_tag="Nmul_A0062"
FT   CDS_pept        complement(68549..68803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0062"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73371"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YD00"
FT                   /protein_id="ABB73371.1"
FT                   /translation="MPQQSKRVKQEDVIPDALKHFDSLPDSANVRQPVLKGLLNCSDAT
FT                   VWRRVNDGTLPQPTKLGRMTFWNVGKLRKVLASLQGTAQ"
FT   gene            complement(68916..69539)
FT                   /locus_tag="Nmul_A0063"
FT   CDS_pept        complement(68916..69539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73372"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCZ9"
FT                   /protein_id="ABB73372.1"
FT                   /translation="MSSWDKKSWDMLEVREMARRDLADFIPPNLYNTNKVTISEIDCKI
FT                   GKKLNLSSEPEHINMTTRQRRAASVLWKLGLCGFAAWKIQHTEEEGLRESMKERLAVLE
FT                   ADLPHFIKSYVECISEEERKLLSIFTVNDTGQQDNLPDSARTSLLKIVLGIAVKKYKYD
FT                   PEAKKSAVPGVIKRDLEIVGIKISEETVLAYLREAATRIPFKGA"
FT   gene            complement(69640..70902)
FT                   /locus_tag="Nmul_A0064"
FT   CDS_pept        complement(69640..70902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0064"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73373"
FT                   /db_xref="GOA:Q2YCZ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="PDB:2KJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCZ8"
FT                   /protein_id="ABB73373.1"
FT                   /translation="MAKLTDMEIRNWIKAGERFEGRAVGGGLYLSFREGYAIPIWRFRY
FT                   RFCGKRRVMNIGSYGTLSLADARDEAKKLSARVALGYDVAGEKQQRKGEAIARIEAEKN
FT                   AYTVAQLADEYFERMIAGRWKHPNIVRSRIEKDIKPAIGSLKVEDVKPRHIDDVLKAVM
FT                   KRGAPSIANDTLRWLKRMFNYAIKRHIIEYNPAAAFDPGDAGGKEKSRTRWLTSEELVT
FT                   LFEAMRQAPGFSVENGLSIKLLLLLAVRKGELIGARWSEFDLDKAVWYLPAERTKTESA
FT                   IDIPLPPIAVEWLRELQRLAGVSKWVLPARKMQDRMIPHIAESTLSVALAKIKHGLEPF
FT                   TIHDLRRTARTHFEALGVAPHIAERCLNHKIKGIEGIYNRHDYFEERKAALEAWAGLLL
FT                   QIERGEADKVVPIRRAVATKQ"
FT   gene            complement(71155..72048)
FT                   /locus_tag="Nmul_A0065"
FT   CDS_pept        complement(71155..72048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73374"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCZ7"
FT                   /protein_id="ABB73374.1"
FT                   /translation="MDDRVDKLAKIYSMTGYAVVAKELPQGSLNLELRSVNSRYLDIQF
FT                   RLPDEFRMLETAMREFLTTRLKRGKIECRVSFSRITPAEDLQHINADLLQKLLELDRTV
FT                   RAVLPEARGLAVADVLRWPGILATESSSAENFFGPCMDLMHAAVDELAAARGREGAKLK
FT                   AILLDRLGNMRRLASEVSPSIPALLATFQEKLKARLREAMINCDDERIRQELTLFASKI
FT                   DVDEELSRLQAHFDEVERVLEKGGAIGKRLDFLMQELNREANTIGAKSVDAEVSKISVE
FT                   LKVLIEQMREQVQNIE"
FT   gene            72220..72936
FT                   /locus_tag="Nmul_A0066"
FT   CDS_pept        72220..72936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0066"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73375"
FT                   /db_xref="GOA:Q2YCZ6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCZ6"
FT                   /protein_id="ABB73375.1"
FT                   /translation="MRPSKRRPDQLRSVQITRHYTRHAEGSVLIECGDTRIICTASVDE
FT                   KVPLFLRGKGQGWLTAEYGMLPRSTNERMQREAAKGKQSGRTMEIQRLIGRALRSVMDL
FT                   TKLGERTIQVDCDVIQADGGTRTASITGAFVAVHDAIGTLLRKQAIEATPITGHVAAVS
FT                   VGVYEGVPMLDLDYLEDSRCDTDMNIVMTDDLGLVEMQGTAEGMPFSRNDLDMMLDLAQ
FT                   QGIRELIAAQKNALNR"
FT   gene            72945..73538
FT                   /locus_tag="Nmul_A0067"
FT   CDS_pept        72945..73538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0067"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73376"
FT                   /db_xref="GOA:Q2YCZ5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCZ5"
FT                   /protein_id="ABB73376.1"
FT                   /translation="MQKLVIASNNAGKLREIRLLLEPLGIEVLPQSAFDFPEAEEPHCT
FT                   FVENALAKARHASKNTGLPALADDSGICVNILGGKPGILSARYAGEPKSDERNNQRLVE
FT                   ALQNQSDRRAYYYCVIALLRHPEDPRPIIADGSWHGEILLNPRGNGGFGYDPYFFLANL
FT                   DKTAAELPMEQKNRISHRGKALAQLVERIRQEQP"
FT   gene            73643..74869
FT                   /locus_tag="Nmul_A0068"
FT   CDS_pept        73643..74869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0068"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73377"
FT                   /db_xref="GOA:Q2YCZ4"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCZ4"
FT                   /protein_id="ABB73377.1"
FT                   /translation="MTAIISPAAILGSQTLQLKSLPPLSLYIHIPWCMKKCPYCDFNSY
FT                   EVRDRSGGMPEAEYVAALIRDLEASLPQIWGRKVISIFFGGGTPSLFSPHSIDGILAAV
FT                   RALLPLEHLAEITLEANPGTFEAQRFADFQAAGINRLSIGIQSFNARHLASLGRIHDGK
FT                   DARRAIEIAQKNFDNINLDLMYGLPNQTLEEAREDIETAIAHGVQHISAYHLALEPNTL
FT                   FHRYPPSLPDDELTADMQAMIEQTLAREGYANYETSAFARPGRESRHNMNYWLFGDYLG
FT                   IGAGAHSKISFRDRIVRQMRYRQPKEYLIKSVPEMASEPPVMEQHEVGRNDRAFEFVMN
FT                   ALRLTDGFAPQMFIERTGLALTHIQRQLDEAERRQLITRDFQRIAPTFAGRRFLNDLLQ
FT                   IFLPGQSRV"
FT   gene            complement(74876..75565)
FT                   /locus_tag="Nmul_A0069"
FT   CDS_pept        complement(74876..75565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0069"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73378"
FT                   /db_xref="GOA:Q2YCZ3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCZ3"
FT                   /protein_id="ABB73378.1"
FT                   /translation="MVEHSPHRPIRSFVLRQGRLSNAQRRAHETLMPKYGIPYSGKLLD
FT                   LAIIFSRSAPKFLEIGFGMGETTALIAQAHPQNDYLAAEVHTPGMGSLLKQVEELELTN
FT                   IRVIQHDAVDVLQHALPPECLDGVHVFFPDPWPKARHHKRRLIQAEFVDLLCSRLKPGG
FT                   YIHVATDWEDYAEQILEVLSGEPHLSNTAVGYAPRPEYRPLTKFEQRGLRLGHEVWDVI
FT                   FRKKQGA"
FT   gene            complement(75617..76411)
FT                   /locus_tag="Nmul_A0070"
FT   CDS_pept        complement(75617..76411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0070"
FT                   /product="thiazole-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73379"
FT                   /db_xref="GOA:Q2YCZ2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCZ2"
FT                   /protein_id="ABB73379.1"
FT                   /translation="MDKLVIAGKAYSSRLLVGTGKYRDFDETRTAVDASGAEIITVAIR
FT                   RTNLGQNPEEPSLLDVLPPSEYTLLPNTAGCYTVEDAVRTLRLARELLDGHTLVKLEVL
FT                   GDPKTLYPNIVETLKAAEILIKEGFQVMVYTSDDPIAARQLEEIGCVAIMPLASLIGSG
FT                   MGILNPWNLQIIIENAKVPVIVDAGVGTASDAAIAMELGCDGVLMNTAIAAAQNPVLMA
FT                   SAMKKAVEAGREAYLAGRMPKKLYSASPSSPVEGVIGNMSGK"
FT   gene            complement(76415..76903)
FT                   /locus_tag="Nmul_A0071"
FT   CDS_pept        complement(76415..76903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0071"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73380"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCZ1"
FT                   /protein_id="ABB73380.1"
FT                   /translation="MPCSFAPGFLALTVAIHPGTTAQPSQQSPRAFPFFRPVLAQLMKH
FT                   RVAQESTRRWLDRIIQIIKYAYCQKLRRHFCQATLWKMIQLIVNGQSQLVPSPDSGTDS
FT                   GTTNDARLNIRQLLEHMGLQGKRIAVERNGEIVPRSQFDQPMLASGDKLEIVVAVGGG"
FT   sig_peptide     complement(76835..76903)
FT                   /locus_tag="Nmul_A0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.683 at
FT                   residue 23"
FT   gene            77017..77475
FT                   /locus_tag="Nmul_A0072"
FT   CDS_pept        77017..77475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73381"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG8"
FT                   /protein_id="ABB73381.1"
FT                   /translation="MDGRLRMERLSLHPFHWSLPIMEKEIRKFLTSLSMLGLLASCAET
FT                   STLEARNDNASMAGQIIRTSIDHDELARRYESRARKLLEIAAEHEKRLQYHEDKSPSYG
FT                   RHGQDFQSHAILVQKYKRAAEKATQAAFHHRMASQPAKRDYIASIALH"
FT   gene            complement(77708..78220)
FT                   /locus_tag="Nmul_A0073"
FT   CDS_pept        complement(77708..78220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0073"
FT                   /product="conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73382"
FT                   /db_xref="GOA:Q2YCY9"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY9"
FT                   /protein_id="ABB73382.1"
FT                   /translation="MQRSAIARLLWCGLGAAAGVAVALFLASPPASPFFLASLGGSAVF
FT                   LFGLTRAPAAQPRALFGGHLGGALIGIVCYQLCGDSLWVYALAQVLALWYMLLTRTVHP
FT                   PAGANPMIMIHAHSSLTGLWEPVFIGVFSLAVVAAVWSRLYPGLSHYPVSWLDQSPPSL
FT                   FWGGWNE"
FT   sig_peptide     complement(78140..78220)
FT                   /locus_tag="Nmul_A0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.360 at
FT                   residue 27"
FT   gene            78484..78903
FT                   /locus_tag="Nmul_A0074"
FT   CDS_pept        78484..78903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0074"
FT                   /product="Protein of unknown function DUF326"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY8"
FT                   /protein_id="ABB73383.1"
FT                   /translation="MLIHFKGGSAMTHTTDPKMQSCIDACNRCHQTCLHEAMTHCLESG
FT                   GKHVSPDHMRLMWNCAEICQTSANFMLSNSTLSSQLCGVCAEACEACARSCEQVGDMEE
FT                   CARICRECAESCRQMAGSYANQGTGAQQRVPADDL"
FT   gene            complement(79069..79404)
FT                   /locus_tag="Nmul_A0075"
FT   CDS_pept        complement(79069..79404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0075"
FT                   /product="membrane protein, Kef-type K+ transport system
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73384"
FT                   /db_xref="GOA:Q2YCY7"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY7"
FT                   /protein_id="ABB73384.1"
FT                   /translation="MNEHAAHLVILGISGMIVAICVMLHYEALRFLGRTLGAHVHKRIG
FT                   VLLVMMGLLIAHFLEVWVFAVAYMFVEHEMGFGRIAGITTGDIFDYFYYSSISYTTVGF
FT                   GDLVPVG"
FT   gene            79526..80437
FT                   /locus_tag="Nmul_A0076"
FT   CDS_pept        79526..80437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0076"
FT                   /product="Ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73385"
FT                   /db_xref="GOA:Q2YCY6"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY6"
FT                   /protein_id="ABB73385.1"
FT                   /translation="MKKQEQENVAPRPISRSDVAAYFGKPESGFRDRLFVIIFEAETRA
FT                   GRRFDFSLIAAILLSVVVVMLDSVSGINYRYGGILNALEWFFTVAFTIEYIARLWCVKH
FT                   PLRYARSFFGIVDLLAILPTYAAFFIPELHALVDLRLLRLLRMFRLLKLTAYVEEYSVL
FT                   GSAIMASRRKILIFLSVVAIVVILNGTLLYVIEGGPHSPFSSIPTSVYFAITAVTTVGF
FT                   GDITPQTDLGRAITSVTMLVGWSILAVPTGIITSEMTAQRFAMKRPPNTRTCPVCLTTG
FT                   LEENARFCRNCGAKLPLFARDQ"
FT   gene            80715..80788
FT                   /locus_tag="Nmul_AR0002"
FT   tRNA            80715..80788
FT                   /locus_tag="Nmul_AR0002"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA-Gly1"
FT   gene            80802..82322
FT                   /locus_tag="Nmul_A0077"
FT   CDS_pept        80802..82322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0077"
FT                   /product="AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73386"
FT                   /db_xref="GOA:Q2YCY5"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY5"
FT                   /protein_id="ABB73386.1"
FT                   /translation="MNRYPHCTRWAFFLFAGLTILLLGGIIYIFVIFDPNAYKPEIIRL
FT                   VKEKKERMLRLDGPITLVFFPSPGLKLSGLFLSEHNRDEEFATIEKVHVSLEILPLLRK
FT                   ELVLNEISITGLKANLIRFSDGSTNIDDLIRSEEQRERFRFDIGRVHMEKTLLAFRDEG
FT                   SDTHFVFRNIGLEADRADERADSEEDAIRSKVELAFNIALPEHAEVDIATRVRFHLTLN
FT                   AERQYFALNGMNLAAEAQLPGTGRLLIQSRGNFSASFLEEGGELGADEFTFDVGIRNVD
FT                   SSFNIGVNAVHLGLKGQKVIADKVLGVAQINRSHSLTRGKFSLSSIQGTLAEFRSEVFS
FT                   ADLESESEGRIIKAHFSSPLGGNIQAPWLGLPELKAEIEAKGASLPANGIQGSLFGSAS
FT                   LDGSAGKAWTKLNGTLADSNITVIFSASGFIPPRLAFEADIDELNLDRFSARQQDGQQR
FT                   QKAGHPERSFELNVLDDLEGLNLEGSVRVGVLKAGDFTASRVRVHIRP"
FT   gene            82322..83473
FT                   /locus_tag="Nmul_A0078"
FT   CDS_pept        82322..83473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0078"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73387"
FT                   /db_xref="GOA:Q2YCY4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY4"
FT                   /protein_id="ABB73387.1"
FT                   /translation="MSAGGDISDSIANSFATRLIRWQREHGRHHLPWQNTRDAYSIWLS
FT                   EIMLQQTQVGTVIPYYRRFLQCFPDIQSLASAPLDEVMVQWSGLGYYSRARNLHKAAQR
FT                   IVGEHGGIFPEEVAIIRQLPGIGRSTAAAIAVFAFGKRAAILDGNVKRILSRCFGIEGY
FT                   PGEKQVEAQLWQKAEALLPKGDESPIERDIEGYTQALMDLGATICIRARPMCGSCPLRL
FT                   ECVAFRDNRAGSLPTPRPRKILPEREAVLLLAVAQGKILLEKRPSTGIWGALWSLPEMG
FT                   MNENVIEYCLRFGINVRPMSQMEALTHTFTHFRLRIYPLILQVISRPPDHLTPEVLSQP
FT                   RRPCVWRMPEDALKAAIPSPVRKVLLQYASQTEPLEIPAMTDN"
FT   gene            83497..84150
FT                   /locus_tag="Nmul_A0079"
FT   CDS_pept        83497..84150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0079"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73388"
FT                   /db_xref="GOA:Q2YCY3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY3"
FT                   /protein_id="ABB73388.1"
FT                   /translation="MNNWKDWRRHQRAELMAARECIGEADHLRWSAAITELLKQGFLAL
FT                   RTRTVGFCWPHRGEYDPRPLMFFFQTRGATLALPEVVNKHEPLRFRKWWQEAPMKIGAY
FT                   DIPVPDNTDLVTVDALIIPMIGFDKFGFRLGYGSGYFDRTLAVMKPRPLAIGVAFEILR
FT                   LESLHPHAHDIPMDFVVTEAGIYHATRTGLKPVSAGQCPDILTARAGEIKETQG"
FT   gene            complement(84182..84817)
FT                   /locus_tag="Nmul_A0080"
FT   CDS_pept        complement(84182..84817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0080"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73389"
FT                   /db_xref="GOA:Q2YCY2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY2"
FT                   /protein_id="ABB73389.1"
FT                   /translation="MNSRASTSKTVTLAFTGASGMPYGMRLLELLLAAGTRVYLMYSQA
FT                   AQIVAHQEMELVLPSRAREAEELLRRRFSTEQGQLRVFGREDWLAPVASGSNPADAMVV
FT                   CPCTMGTLAAIAAGMSQKLIERSADVMLKENRKLILVPRETPFSAIHLENMLKLARSGA
FT                   IILPPNPGFYHHPRDIHGMVDFVVARILDHVGVAHTLMPRWGEESTVD"
FT   gene            complement(84905..85744)
FT                   /locus_tag="Nmul_A0081"
FT   CDS_pept        complement(84905..85744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0081"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73390"
FT                   /db_xref="GOA:Q2YCY1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCY1"
FT                   /protein_id="ABB73390.1"
FT                   /translation="MQVIVISGLSGSGKSIALTVLEDNGYYCVDNLPANLLLEVTVYLK
FT                   QSGHERVAVSIDARSRETLHLLPQRLADLRRQKMDIHLLFLDTKTDTLLKRFSETRRRH
FT                   PLSDNQSTLPECIEMEREMLREIHDLANRIDTSDLSASSLRAWIRDFIGLEPGRLTLLF
FT                   QSFGFKHGIPLDSDMVFDVRCLPNPHYEALLRPLTGKDGAVIEYMDANSSVNRMFEDIR
FT                   RFVDDWLPCFIRDNRNYLTVAIGCTGGRHRSVYFVERLARYFTENNQVLVRHRELNA"
FT   gene            complement(85831..86817)
FT                   /locus_tag="Nmul_A0082"
FT   CDS_pept        complement(85831..86817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0082"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73391"
FT                   /db_xref="GOA:Q2YCY0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCY0"
FT                   /protein_id="ABB73391.1"
FT                   /translation="MIFPNPDNQEAFNQMVGIDARQLFEEKRQKLGLTWEAGRDGGDRS
FT                   LDNEAIARSTQGMIGHLNFIHPNWIQVLSETEAEYLNALDPASLEQHMRRLAESDMLCI
FT                   IVTAGACVPDSIKSLADSTRTPLFCTPYSSLEILWILRPYLGRVLAPSCSRHGVLLDVL
FT                   GLGVMITGESSVGKSELALELVSRGHGLVADDVVELYRIAPETLEGRCPPMLRDFLEVR
FT                   GLGMLNIRTIFGEAAVRRKKNMKLIVHLQKPNSADLNAMERLPINDVTENILDVNIRKV
FT                   IIPVAAGRNLAVLVEAAVRNYVLQLRGIDSGQEFFARHQQELENGQT"
FT   gene            complement(86952..87254)
FT                   /locus_tag="Nmul_A0083"
FT   CDS_pept        complement(86952..87254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0083"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73392"
FT                   /db_xref="GOA:Q2YCX9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX9"
FT                   /protein_id="ABB73392.1"
FT                   /translation="MNIHVTGRQVEITPPLREYVVSKLSRITQRFDQIVDITVTLSVEK
FT                   LEHKAEALARVPGNDIFVEADSTDMYASIDDLVDKLERQLVRRKEKNESQRTDTV"
FT   gene            complement(87281..88747)
FT                   /locus_tag="Nmul_A0084"
FT   CDS_pept        complement(87281..88747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0084"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73393"
FT                   /db_xref="GOA:Q2YCX8"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX8"
FT                   /protein_id="ABB73393.1"
FT                   /translation="MKPTLQVKLSQHLALTPQLQQSIRLLQLSTIELNQEIERIVQENP
FT                   LLELDDSLGNDSTDYHSLIPEELAAPLPNELEVAEESLPILSVEAETDVKQPLDEREWP
FT                   PDDSVFRPYRDDEDERDIPQQAVEPPNLRAHLNSQLSLSQISQRDRKITGLLIDSLDDD
FT                   GYLVQDLEELVDLLPAELSIDIDDLHIALEHLQHLDPPGIGARNLRECLVMQLQALPPD
FT                   TPYLEQALALVNNHLESLASRDFGAIKRVLHCNDDCLRSVQQMITRLNPRPATAFSSTV
FT                   ACYIVPDVIVTKVGGSWVASLNPEAMPRLRINRLYAEILKGCNDDSTRRLISQLQEAKW
FT                   LVKNVQQRFNTILKASAAIVERQQQFFEHGAVAMRPMILREIADVLNLHESTISRVTTQ
FT                   KFMRTPRGIFELKYFFGSHVSTDSGGACSATAIRALIKQMISEENSRKPLSDSQISEVL
FT                   GQQGIMVARRTVAKYRESLQIPSVNLRKSF"
FT   gene            complement(88798..89604)
FT                   /locus_tag="Nmul_A0085"
FT   CDS_pept        complement(88798..89604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0085"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73394"
FT                   /db_xref="GOA:Q2YCX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX7"
FT                   /protein_id="ABB73394.1"
FT                   /translation="MELPLSSARGHADHASQAPEAPLVSSGKRSEFRAENLKKSYKSRT
FT                   VVHDVSLSVKSGEVVGLLGPNGAGKTTCFYMMVGLVPLDGGSIVLDELDLSQMPMHERA
FT                   RLGLSYLPQEASIFRRLSVADNIRAVLELKNHGADEMQQHLDNLLHDLHISHIRNSPAI
FT                   SLSGGERRRVEIARALATGPHFILLDEPFAGVDPIAVLDIQKIIRFLKERGIGVLITDH
FT                   NVRETLGICDHAFIISDGRVLASGSPDEIIYNENVRKVYLGEHFRL"
FT   gene            complement(89617..90189)
FT                   /locus_tag="Nmul_A0086"
FT   CDS_pept        complement(89617..90189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0086"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73395"
FT                   /db_xref="GOA:Q2YCX6"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX6"
FT                   /protein_id="ABB73395.1"
FT                   /translation="MTRNARFSFTAPMKPLSVAFLAVMLFSAPVRAERADSEKPVHLEA
FT                   DRATVQDANKLATFIGNVVLTQGTLIIRADKMTVKEDANGFQYATAFGNLASFRQKRDG
FT                   KDEYVEGWSERMEYDGKADKVQLFKKARLRRGKDEVHGDYISYDAVNEFFQVNGEGGTS
FT                   TQTHSEGRVRAVIQPKKKEPKPEADNS"
FT   sig_peptide     complement(90091..90189)
FT                   /locus_tag="Nmul_A0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(90173..90745)
FT                   /locus_tag="Nmul_A0087"
FT   CDS_pept        complement(90173..90745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0087"
FT                   /product="Protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73396"
FT                   /db_xref="GOA:Q2YCX5"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX5"
FT                   /protein_id="ABB73396.1"
FT                   /translation="MMGHLRFGFLFVIVALFASLLTLLNQDGPTPLLAPESISVRAPDY
FT                   VVEDFSAIRTDENDAGYKMLLGKKMVHYPDDDSAELEQPRLITIEPGKPSVQLQADNAK
FT                   MSAEGEDIYLSGNVVIVRNAGKGRGETILTTSLLHLIPDQDIARTDKPVEITETNATIR
FT                   AIGMEMNNRTGHTELLSQVKVVHDKKR"
FT   sig_peptide     complement(90668..90745)
FT                   /locus_tag="Nmul_A0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.604 at
FT                   residue 26"
FT   gene            complement(90742..91266)
FT                   /locus_tag="Nmul_A0088"
FT   CDS_pept        complement(90742..91266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0088"
FT                   /product="phosphatase kdsC"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73397"
FT                   /db_xref="GOA:Q2YCX4"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX4"
FT                   /protein_id="ABB73397.1"
FT                   /translation="MQHIYEKARKITMVIFDVDGVLTDGSLYLTDGGEEIKAFNSQDGH
FT                   GLKMLKATGVKVALITGRQSRCVDLKAKDWGVTLVYQGAKNKLPAFEALLEDQHLDASA
FT                   CAYVGDDLIDLPILLRCGLAISVPAAPALVKKHAHYITRLEGGRGAAREICEMIMQAQD
FT                   TLDAHLATYLT"
FT   gene            complement(91488..92447)
FT                   /locus_tag="Nmul_A0089"
FT   CDS_pept        complement(91488..92447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0089"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73398"
FT                   /db_xref="GOA:Q2YCX3"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX3"
FT                   /protein_id="ABB73398.1"
FT                   /translation="MENGEMIKVLLANPRGFCAGVDRAIEIVERALSVHGAPIYVRHEV
FT                   VHNRFVVEDLEKKGAVFVENLDEVPAGSILIFSAHGVSHAVRREAEAGQFKVFDATCPL
FT                   VTKVHIEVAKMRDQGREIIMIGHAGHPEVEGTMGQAEGDGPSMYLVETEEDVEKLQVQD
FT                   PAHLAYVTQTTLSVDDANRVIQALKGRFPNILGPKKDDICYATQNRQDAVKTMVKQCDL
FT                   VIVVGSPNSSNSNRLCEVARNAGVDAYMLDRAEQLQEAWLKGKMRIGITAGASAPEVLV
FT                   QEVISRLRQIVSEQAEREVVVEELRGVVESVVFPLPRN"
FT   gene            complement(92720..93715)
FT                   /locus_tag="Nmul_A0090"
FT   CDS_pept        complement(92720..93715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0090"
FT                   /product="Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73399"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX2"
FT                   /protein_id="ABB73399.1"
FT                   /translation="MIRHVLILLFALFTSALMDSGNAGGVIRPSSSPGFATPATGTCLS
FT                   GFPTTVTDDDGRRVRMTHAAMRIISLSPNVTELIFAAGAGKKLVGVSRHSNYPDAAKSI
FT                   PDIGDSFSLDLERIVALQPDLLLAWRSGNARADIEKLERLGLTVFATEAVTLADVSRLL
FT                   RIIGTLAGTSGPAERAAKAYEEELQGIQSSYSNRPRVSVFQLIWHQPLMTINNQHLISD
FT                   VIQICGGTNVFARESSLTPVVSGENLLEADPDAIISSVSLEQDESAPAEVKAFLRQFSP
FT                   LSAVRNNNVFFVHPDLIQRQTTRVLRGAHLVCEQLECVRSRRKIVRLPDS"
FT   sig_peptide     complement(93638..93715)
FT                   /locus_tag="Nmul_A0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.461 at
FT                   residue 26"
FT   gene            complement(93840..94994)
FT                   /locus_tag="Nmul_A0091"
FT   CDS_pept        complement(93840..94994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0091"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73400"
FT                   /db_xref="GOA:Q2YCX1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCX1"
FT                   /protein_id="ABB73400.1"
FT                   /translation="MILVLSPDTGPESPDYKQLLAYLANMPGISTRVRTEVGSEQTLTE
FT                   VYLIGNTKALLVEDMQNLPCVEQVVRISEEYRVLGRHKDDHRPTYFDYNGVRFGQDTLN
FT                   VFAGLCAVDTLEHVELMMQALRDNGQVCTRMGAYKPRTSPYSFQGHGKACLPYVFELAG
FT                   KYGIRVIAMEITHESHLEEICDALYRTGNATGVILQIGTRNTQNFELLKIVGRQQDFPV
FT                   LLKRGFGITLDESLNAAEYLASEGNRKVVFGLRGMKTNMGDPHRNFVDFAHVPVVKRLT
FT                   RMPVCIDPSHSVGMRAASPDGILDIMHATVQGVIAGANMILVDFHPAPGKALVDGPQAL
FT                   LMRELPLFLEDVAIARKAYEQRVALAQRYQEDTEPALPSSVQSA"
FT   gene            95266..96237
FT                   /locus_tag="Nmul_A0092"
FT   CDS_pept        95266..96237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0092"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73401"
FT                   /db_xref="GOA:Q2YCX0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCX0"
FT                   /protein_id="ABB73401.1"
FT                   /translation="MKKKTGYSPYPPAIFLMGPTASGKSALALHIARYLPVEIISVDSA
FT                   QVYRHMNIGTAKPGPEALAATPHHLIDLIDPHEHYSAARFRTDALRTMREIADRGSIPL
FT                   LAGGTMLYFKTLLEGLSELPSADSDVRAAIEAKARKSGWPAMHQELFRLDSVSAERIKP
FT                   TDSQRIQRALEVFYLTGKPMSETLRKPKNVSLPYEVVKIALVPGNRQALHQRIACRFEQ
FT                   MLKHGLIDEVRAIRDKFYLSDENPSMRCVGYRQVWMHLENATDALRMREMALAATRQLA
FT                   KRQLTWLRSMKETREFDCLQENLPEQVKTYLLNTGLKFTEVS"
FT   gene            96297..96656
FT                   /locus_tag="Nmul_A0093"
FT   CDS_pept        96297..96656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0093"
FT                   /product="hypothetical protein"
FT                   /note="Transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73402"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW9"
FT                   /protein_id="ABB73402.1"
FT                   /translation="MIDRYKPIALAAVALAGALSLAGCGQEEKVHESWKTPEPQAVVDD
FT                   STLNSSIQGALKLDPEVRHLDIRVEAHNGTVMLSGFADNQAQLDRVNMLAWMVEGVKKV
FT                   DNKMNVRGTPAPGDG"
FT   sig_peptide     96297..96374
FT                   /locus_tag="Nmul_A0093"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.683 at
FT                   residue 26"
FT   gene            96722..99061
FT                   /locus_tag="Nmul_A0094"
FT   CDS_pept        96722..99061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0094"
FT                   /product="Acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73403"
FT                   /db_xref="GOA:Q2YCW8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW8"
FT                   /protein_id="ABB73403.1"
FT                   /translation="MISSLLLTLILVAGVIIFVPQVRRILISSRLLKIFRKILPHISQT
FT                   EQEALDAGTVWWEAELFSGRPDWSKLLAFPKPKLQAEEKAFLDGPVEELCAMLDEWQIT
FT                   RELHDLPPHVWQFIKDKGFFGMIIPKEYGGLGFSAFAHSEVILKISSRSGTAAVTVMVP
FT                   NSLGPSELLLQYGTEEQKSYYLPRLAKGLEVPCFGLTGPEAGSDASAIPDSAIVCYGTF
FT                   NGNEKVLGMRVTWEKRYITLGPVATLLGLAFKLHDPDGLLGGQRDLGITLALIPTDTPG
FT                   VEIGRRHFPLDAAFQNGPNSGKDVFIPMEYVIGGIEGVGRGWRMLMNCLAAGRSISLPA
FT                   TSTGGAKLATRATGAYSRVRVQFKQPIGFFEGVEEALARIGGHTYMMDAARMMTAGAVD
FT                   LGQKPSVISAIVKYHLTERGREVINDAMDVHGGKGICLGPGNYLGRNYQQIPVSITVEG
FT                   ANILTRNMIIFGQGAIRCHPYLLKEIRAAGDLDTKRGLVEFDKALAGHFVFTVGNGLRS
FT                   LMHGLTGGRFAKAPLNTDPEVQDYYSQLTRCSASFAFLADISLLVLGGSLKRRERLSAR
FT                   LGDILSLLYLCSAVLKRFNDDRRPPSDLPLLHWSMQDALYRVQQAFDGVLDNFPATGFT
FT                   RRVLRFMVFPLGKPFSPPPDELEQKIATLMLAPGDARDRLTAGIYIPTAKDEPLNILEQ
FT                   ALQHAVSCEATEAKLRTAIKSGQIPAQEEESIAAALKQRVITSTELEILKKMGALRRRV
FT                   IMVDDFPSDFGSRSDAAAEAASPINA"
FT   gene            99069..101060
FT                   /locus_tag="Nmul_A0095"
FT   CDS_pept        99069..101060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0095"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73404"
FT                   /db_xref="GOA:Q2YCW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW7"
FT                   /protein_id="ABB73404.1"
FT                   /translation="MNNVSASRQQVRSALSPAATPSDAEIPTTSGRQDMAGIIPVETAG
FT                   TLDGLFRERVRRTPEAIAYRDYDRSSGKWRDLSWARMDERIAHWVIALSKEKLKPGDRV
FT                   GIMLRNCPEWVMFEQAALRLGLVVVPLYPTDRPDNAAYILQDAGVKVLLLEELGQWLAF
FT                   SEVRDQMTGLVRVIIIQGSVRQGHRGNELVLALHDWLPEWFPGERPTESLPSVEPLYQL
FT                   PAEPEHQAPEEVPPSRVLARDPHQLATIIYTSGTSGHPKGVMLSHHNILTNAHSCLQVV
FT                   PIEESDVLLSFLPLSHTFERTAGYYVPMMRGSTVAYARSIPQLQEDLLIIRPTILVSVP
FT                   RIYERVYAGIRAKLAEGPLLSRRLFDLAVEIGYNRFEYQQGRAEKHFSHALWPLLEILV
FT                   AKKVMSKLGGRLRAAMSGGAALSSEVSRIFIGLGLPILQGYGMTESSPVVCCNTIEDNV
FT                   PASVGRPIPGVEVKLGEQNALLIRGPNVMLGYWNNEEATRAVMTPDGWLNSGDIAEIDE
FT                   AGHIAITGRVKEIIVMSTGEKIPPANMEAAILRDPLFEQVMVVGEGRPHLAVLAVLNSG
FT                   NWESMADEYHLDRNWRRLGGDPKFEEILLERIAYQIKGFPGYAKIYRIAVVAEPWTVEN
FT                   QMLTPTLKLRRTYVQNHYKSEVDRLYTK"
FT   gene            101126..101545
FT                   /locus_tag="Nmul_A0096"
FT   CDS_pept        101126..101545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0096"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73405"
FT                   /db_xref="GOA:Q2YCW6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW6"
FT                   /protein_id="ABB73405.1"
FT                   /translation="MTDSDTESQVSLPEGSDPVLRLVPMPTDTNYAGDVFGGWIMAQVD
FT                   IAGSLPAIRRARGRVVTVAVNSFVFKQPVFVGDVVSFYADIVRIGRTSITVDVVVYAQR
FT                   GLRQGDKEICYRVTEAVLTYVAVDEHRKPRVVPPG"
FT   gene            101573..104125
FT                   /locus_tag="Nmul_A0097"
FT   CDS_pept        101573..104125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0097"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73406"
FT                   /db_xref="GOA:Q2YCW5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW5"
FT                   /protein_id="ABB73406.1"
FT                   /translation="MNNSGFTVRKAAVLGAGVMGAQIAAHLINANVETLLFELSAGEDP
FT                   NANVVKAIENLKKQEPQPLSSTARGTFIQPANYDQNLELLGECDLVIEAIAERMDLKTG
FT                   LYAKIAPYLGERTIFASNTSGLSINQLAQVFPETLRHRFCGIHFFNPPRYMHLVELIPC
FT                   TTSDSAMLDDLEAFLVTSLGKGVVRAKDTPNFIANRIGVFSMLATMHHASEFGLGFDVV
FT                   DALTGSLIGRPKSATFRTADLVGLDILAHVINTMREMLPDDPWHEYYAVPPWLQGLIGK
FT                   GALGQKTKRGVYQKTGKDIHVLDIARNEYVLSAGKADPDIAELLKDKSPAGKLGALRAS
FT                   PHPQAQFLWAVFRDLFHYCAVHLEEIADNARDLDFAMRWGFGWTQGPFETWQAAGWGEI
FT                   SGWISEDIAAGKSMSNVSLPEWVHELGQSPAQAVNPDIQGVHRKPGSYAPSSKSFRLRS
FT                   LLPVYRRQLFPDRLLSEEPQYGQTVFETQAVRMWSMPEKAEAGGRTEKGDDGIAILSFK
FT                   SKMHTIGSDVLDGIQQAIDEAERNWRALIIWQTEPPFSAGANLKKATERLKNEEPPSAL
FT                   NVLAKKFKKTAQSAVLKAARKLNLADALMAGKLAEVEAMIAQFQQTSQALRYSMIPTVA
FT                   AVDGLALGGGCEFVMHCDRAVATLESYIGLVEAGVGLLPAGGGCKELALRAAQKAKDGD
FT                   PFPVLKNYFQSVATAQVSKSAEEAKELGYLRRADEIVMNRFELLYIAKALAVAMAEAGY
FT                   RPPLRARRIPVAGATGIANIKGMLVNMHEGNFISDHDFLVGTKIASVMCGGELTPGSLV
FT                   DEEWFLELERDAFIELLATEKTQARIEHTLKTGKPLRN"
FT   sig_peptide     101573..101650
FT                   /locus_tag="Nmul_A0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.342 at
FT                   residue 26"
FT   gene            104286..105488
FT                   /locus_tag="Nmul_A0098"
FT   CDS_pept        104286..105488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0098"
FT                   /product="Acetyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73407"
FT                   /db_xref="GOA:Q2YCW4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW4"
FT                   /protein_id="ABB73407.1"
FT                   /translation="MTTKQTSEAYIVSAVRTPVGKAPRGMFKTVRPDDMLAHVLKTAVN
FT                   QCEGLDPAAIEDVIAGCAMPEAEQGLNVARISLLLAGLPNSVPGMTVNRFCASGLQTVA
FT                   LAADRIRLGEADVIIAAGTESMSMVPMSGNKPALDPAIFLRDENVAIAYGMGITGEKVA
FT                   QRWQVSREAQDEFATTSHTRALKAIETGEFEQEIAPYTVVEKRPDIASHEIRDVAVVRD
FT                   TDEGPRPGTNPEVLSRLKPVFAAHGTVTAGNSSQMSDGAGAVVLASEGALKRFNLTPMG
FT                   RFLGYSVAGVPPEIMGIGPVKAIPKVLKQVGLKQDDLDWIELNEAFAAQSLAVINDLGL
FT                   DRQKVNPLGGAIALGHPLGATGAIRVATLLHGLRRHHQKYGMVTMCVGTGMGAAGVFEA
FT                   M"
FT   gene            complement(105585..105773)
FT                   /locus_tag="Nmul_A0099"
FT   CDS_pept        complement(105585..105773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73408"
FT                   /db_xref="InterPro:IPR021853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW3"
FT                   /protein_id="ABB73408.1"
FT                   /translation="MAKFYESDHTRFMRELFEKNPKLPEDQREARAIWWDKKLDPEERR
FT                   RFKESAVPQKAYVYFGK"
FT   gene            106448..106771
FT                   /locus_tag="Nmul_A0100"
FT   CDS_pept        106448..106771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73409"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW2"
FT                   /protein_id="ABB73409.1"
FT                   /translation="MTSDSSRFAVGIFIALVSLAACATLNNFPDRPAAGAAGQLYEELN
FT                   AFASRWKAHVGLNIKVEPARNKSGKPVRVTLQGLDVPALALPCDADKLHDKEIFITPTS
FT                   ASF"
FT   sig_peptide     106448..106519
FT                   /locus_tag="Nmul_A0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.949 at
FT                   residue 24"
FT   gene            107117..107935
FT                   /locus_tag="Nmul_A0101"
FT   CDS_pept        107117..107935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0101"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73410"
FT                   /db_xref="GOA:Q2YCW1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW1"
FT                   /protein_id="ABB73410.1"
FT                   /translation="MNQGIALVTGASSGIGRATAELLAQNGYYVFAIARRKYRLEQIRS
FT                   ERIEPIILDVTDDEAVRKAIGYVISTKSRIDLLVNNAGISQLGAVECVPLEAARYQLEV
FT                   NLFGYARFMQAVLPHMRNQKSGCIVNIVSVLSRISVPGFGWYSASKYAIEALTDAVRGE
FT                   VMEFGIDVVLIAPGLIKTEFVPKEFRLLETISHPPEYKNLLSGMRNLVADEPEAPGPEL
FT                   IAKAVLDAATASPPVRHALPLDSKMSVIARWLLGARIFAWAVRLQMKFSR"
FT   sig_peptide     107117..107179
FT                   /locus_tag="Nmul_A0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.868 at
FT                   residue 21"
FT   gene            complement(108092..108877)
FT                   /locus_tag="Nmul_A0102"
FT   CDS_pept        complement(108092..108877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0102"
FT                   /product="Spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73411"
FT                   /db_xref="GOA:Q2YCW0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCW0"
FT                   /protein_id="ABB73411.1"
FT                   /translation="MNRFLKRGRQANASRNPALADPALVHLSEEYGIRSLHLGSSMVQS
FT                   AMRIAAPNELQLAYTQCMMCFLLFCPRPKNVLMIGLGGGSLTKFVYWQLPTVNTTVIEI
FT                   NPQVVAVARSQFYVPADDERLEVLIAEGSEYIAAHPDSTDILMVDGFDDGRQVASLCTQ
FT                   AFYDQASEALTRNGVLVVNLLSRDGRVHEYLARLENSFAGRITTILAEPYGNLIVFAFK
FT                   HAPTRAAWEELPATAKMLEKEFSLPFSKFAQKLPHRRPF"
FT   gene            109025..109534
FT                   /locus_tag="Nmul_A0103"
FT   CDS_pept        109025..109534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV9"
FT                   /protein_id="ABB73412.1"
FT                   /translation="MQPGIKRITVLVFSLGGTLLAACAGLGWEESAFTHGGKVSGNLAA
FT                   LARCTVDQLQSDSRWMIRTLQYQVFSYRDIAAMEIYAYPEGALAGTYARNSPSNPDAVI
FT                   SYGPPTPLIHPGKPGSNADKEVDPDYSFVLTLKRTDNATAFATVSGRKYESRIAWETLE
FT                   ACAGPE"
FT   sig_peptide     109025..109099
FT                   /locus_tag="Nmul_A0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.591 at
FT                   residue 25"
FT   gene            109727..111196
FT                   /locus_tag="Nmul_A0104"
FT   CDS_pept        109727..111196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0104"
FT                   /product="Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73413"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV8"
FT                   /protein_id="ABB73413.1"
FT                   /translation="MHLSKSVATSGFVTAAPVLMLFASLAIAGDFEDGMKFVLSKDYTK
FT                   AMQSFRKAANAGNADAQFNLGVLYSRGRGVPQDHEQAAKWYRRAAEQGDAPAQSMLGYM
FT                   YLKGQGVPQDYQQAMFWYFRAADSGYAVAQYNLGVMYAKGQGVEKDYRHALSWYLKAAE
FT                   QGHAPAQAIMGFMYLKGQGVEQDDHQAVSWYRKAAEQGYGEAQYALGVLYAKGRGVAQS
FT                   NQEAASWYRKAAEQGNTDAQFNLGMMFATGEGVTQDYRQAASLYRQAADQGYARAQFKL
FT                   GVANAKGLGIPEDAYEAAAWYRKAAEQGYAPAQFNLGVMYATGKGVIRDERQAVSWYRQ
FT                   AAEQGDPDAQYNLGVRYDTGRGIEKDPQQAVAWYRKAAEQGYARAQYSVGVKYDSGQGV
FT                   PQDYAQALAWYLKAAEQGHAGAQTNLGVLYYNGNGVKQDYVEADKWFSIASAGGYEDAK
FT                   ENRELMEKLMTPMQIADARREADEWARAHQR"
FT   sig_peptide     109727..109813
FT                   /locus_tag="Nmul_A0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 29"
FT   gene            111740..112558
FT                   /locus_tag="Nmul_A0105"
FT   CDS_pept        111740..112558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0105"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73414"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV7"
FT                   /protein_id="ABB73414.1"
FT                   /translation="MLDSVDERHVQHFVSAGVLEKAGRIDLGPLLGEAVRMLTAEKRHQ
FT                   RLLDKLLREADEYVTANESRIRQRVRENTAWFWQRLSMDEKVGESVVAALREVVAEIAR
FT                   DPAHPLRLRLDAAIGKLASDLATSPEYREQVAAHTRKLLEHPALRDYADGVWRDLRNGM
FT                   REDIDSEDSAIRGWMRGLIQSGTDTVLEDRGLRERLNNWMREVLVEAVQSHQRDVGRLI
FT                   ADTVREWDTQTVTHRIERQVGEDLQYIRINGTLIGGLAGLAIYTIAHLFA"
FT   gene            complement(112666..113520)
FT                   /locus_tag="Nmul_A0106"
FT   CDS_pept        complement(112666..113520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0106"
FT                   /product="probable Mg(2+) chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73415"
FT                   /db_xref="GOA:Q2YCV6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV6"
FT                   /protein_id="ABB73415.1"
FT                   /translation="MVGPPGTGKSMLAARLPGILPAMSEEEALESAAMQSLGSSGFSVA
FT                   NWKRRPYRSPHHTASGVALVGGGSNPRPGEISLAANGVLFLDELPEFDRKVLEVLREPL
FT                   ESGRITISRAARQAEFPARFQLVAAMNPCLCGYLGHFSGKCRCTSDQVARYRGKISGPL
FT                   LDRIDIQIEVPAPPQEDLMRQAQGESSEIIQRRVQAAYQRQLERQGRANAYLAVKDIDK
FT                   YCIPDKPGENLLGQAISRLNLSPRAYHRILKVARTIADLAASPGITGAHIAEAVQYRKM
FT                   DRN"
FT   gene            113563..115197
FT                   /locus_tag="Nmul_A0107"
FT   CDS_pept        113563..115197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0107"
FT                   /product="Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73416"
FT                   /db_xref="GOA:Q2YCV5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV5"
FT                   /protein_id="ABB73416.1"
FT                   /translation="MRKAYSYIRMSTDKQLSGDSLRRQREASEKYAKAHGLELIETLDG
FT                   KDLRDIGVSGFKGANSRRGVLSVFLEHLNDGKIDANSILLIESFDRLSRADVLDAFSLF
FT                   TNILNKGIEIITLSDNQRYTRDSVRVNPGQLFLTIGIMTRANEESVTKSKRGLSVWNNK
FT                   RDNAQKKPITSRCPAWLTYSSESEKFEVIEERARVVRLIFELCAKTSGTWSISRYLNRH
FT                   NIPVFGDAQFWQKSYVNKILSNRAVLGEFQPNSRESGQRIPVGKVIENYYPAIISATEF
FT                   HLAWAARDRRNKTGSGRKGINFSNLFSGLVYCGNCGSKMSVRNRGVPPKGGKWLVCQNH
FT                   LAGAGCEMREWKLPLVEDAIFKHLYEVDFSELLGNKSAGFDIEKELFALQVEQKELESK
FT                   MDQAIEMSAAQELNEQSRFRYVKLINQLESDINEKKKCISSKEKELEVFKSQQSLLHTK
FT                   ELKETLLLLEKNKDDYYFRSSVNQLLTRTIARIDLITDHGGPLPWEIEPDDKIVGNFRA
FT                   LYPKLSSLSIDELVLQRVFLDYITLIC"
FT   gene            115256..115522
FT                   /locus_tag="Nmul_A0108"
FT   CDS_pept        115256..115522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0108"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73417"
FT                   /db_xref="GOA:Q2Y7F4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y7F4"
FT                   /protein_id="ABB73417.1"
FT                   /translation="MKKRFSEEQIIGILREGEADGVVIRDVCRKHNITEQTFFRWRTKF
FT                   GGMTVSDARRLKDLESENAKLKKIVAEQMLAIEGLKEIATKKW"
FT   gene            115516..116337
FT                   /locus_tag="Nmul_A0109"
FT   CDS_pept        115516..116337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0109"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73418"
FT                   /db_xref="GOA:Q2Y7F5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y7F5"
FT                   /protein_id="ABB73418.1"
FT                   /translation="MVTPAARREALGILTGKGLSQRSACRIVGVSRRIGSYEVKQPVKD
FT                   RAVATRIIEASSRYPRFGYRRIAVMTDQSMGRVWRLWGKLGLSLPRRRPRKRRCGTDIR
FT                   LPGATKPNSVWTYDFVHDRLANGQTLKLLCVLDEHTRECLAIEVGKSLRNQDVILTLSR
FT                   LMRIYGKPAFIRSDNGAEFTATAVMTWLRDNNVGPAFIKPGSPWQNGFVESFNGKLRDE
FT                   CLNREWFITRQEAKVLIEKWRQFYNNERPHSALANRTPAQAGLQRLQIQNV"
FT   gene            116675..117574
FT                   /locus_tag="Nmul_A0110"
FT   CDS_pept        116675..117574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73419"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV2"
FT                   /protein_id="ABB73419.1"
FT                   /translation="MNFILELLRREQGRQQKELEFSQLPYQQRVAQLKEQKLPLFFYKY
FT                   HSLHSHNPNKPQEKWEHASDYLINSRFYLSRPANFNDPFDMRAYFTDSVPKEKKRYFLD
FT                   QLLKIRTPQLTEKDRVLEVKKLLDNPEKLRTIHKLTLDEAVDSFGVSCLSTAPCNILMW
FT                   SHYANHHRGIAFQFNFAIDIFSFKWLQPVSYSNDFPGIEYFERRDNKYSIALLTKHHGW
FT                   EYEKEWRIVKPNGAGTYQDFNSKILTGVILGCRIDRKDEDKIRTMIEQRKEQGLSSVKL
FT                   YKLRQHESRYKLVIKHVE"
FT   gene            complement(117665..118531)
FT                   /locus_tag="Nmul_A0111"
FT   CDS_pept        complement(117665..118531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73420"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV1"
FT                   /protein_id="ABB73420.1"
FT                   /translation="MPDKRPIGLGTAFRIDSWSRCITAFHIGEDLFQLDDHEAEPILKK
FT                   NINLAALDISKLGYGCLSVPKNAWRPLSGLYSLCGKECSPIAPPRILNRTELMVLRIQP
FT                   AQQSSTGSPFLPVDFHRWTPSKGEEVMALGYAGIDQDQYDLGENRPIRAHLYGSVGRII
FT                   DIERVDFDRVRLWPFIRVEAKWPGGMSGGPVFNKLGHVIGVVSTGNEDSSTAVLFSGWD
FT                   VPQQIFGSIDPVNPGFFYCYGVFEETGELVLCGQDENEIKEFARSRGLVDQCIISINPI
FT                   THDYVRR"
FT   gene            complement(118570..118824)
FT                   /locus_tag="Nmul_A0112"
FT   CDS_pept        complement(118570..118824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCV0"
FT                   /protein_id="ABB73421.1"
FT                   /translation="MKQRKVMRRKYLNTEITLFYLMPLSLLSLKPVLMRFAQALFYLNE
FT                   QPTRNDTLGIRKSTRIEECFQFKQAKWIVKAFFRVTKRD"
FT   gene            119515..120090
FT                   /locus_tag="Nmul_A0113"
FT   CDS_pept        119515..120090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73422"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU9"
FT                   /protein_id="ABB73422.1"
FT                   /translation="MKRTIINKEEVADWIREVGTNGVMLTISEPHAKLKYLNLEQAHME
FT                   PIVSRIIELASKVVYGKHKRFEALEGLVVCESPIFRPHFHIVFKKPETIDKVKFKDKLT
FT                   KLAIRLCNKKFRFDLSDSNLPEGLKKVMAFPCYDRFVEVTNTHKNTGSYLTKEHANYYL
FT                   LTGRKLVLKDSKIELSMKLYGATLSPVL"
FT   gene            complement(120420..121574)
FT                   /locus_tag="Nmul_A0114"
FT   CDS_pept        complement(120420..121574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73423"
FT                   /db_xref="GOA:Q2YCU8"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU8"
FT                   /protein_id="ABB73423.1"
FT                   /translation="MLNIFNFADCRSAIIRCNLVLIVFGLTNVAVAHDLPGLKSENLSN
FT                   ISDSTGLRNSTPAPDQISSDKDENSQLRNSERATLIAMKDQSHAIVIASALAREAGSQN
FT                   IYGLTEADKKKVEAVILRAKTWDPGTIVKICFYEEGKTARPAIVEFAKTWTNHGNVKFD
FT                   FGVAPAYRTCSPNESSNIRITFRTKGYWSLIGTDSMYRVSAPSMGLQDFDSRDPKDPEF
FT                   ATTVLHEFGHALGFHHEHQTPAADCEAQMDTGKIKQIYRWDDSEIKENFHRIEVSSLTG
FT                   MKNGFKVGDSPDGKVAYTVYDPNSIMHYALPYIIFKQPLPKTGSCYIPPNRTLSKIDIA
FT                   GMKEAYPNTDQASLTEQNRKIIKELMVDQRLTTIQRAAFSVLQK"
FT   sig_peptide     complement(121476..121574)
FT                   /locus_tag="Nmul_A0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.747 at
FT                   residue 33"
FT   gene            complement(121814..122899)
FT                   /locus_tag="Nmul_A0115"
FT   CDS_pept        complement(121814..122899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU7"
FT                   /protein_id="ABB73424.1"
FT                   /translation="MYLKSLFAIILLLMMSGCASIYQTKQILGSEDEKVGITRQYYLPR
FT                   GLVSISGTVDEKKEVSVTVESKLVPDEKAKKLYLVPHHSWWYDDNFVVETTKDGLLTSV
FT                   TTKSTYKGIEIAEQIGAFAGAVAKIVPLAELKEKEKEKEEEEEKTCVPALAIPFTVHVD
FT                   IDPYNKNDLQLKELNANCFFLEIGEDDRLKDWEDALKQKFDQAKKQMEKEKKFKQVEEQ
FT                   TDKTETPGIPGIVYRDPFNLLIKIEYKGKGDDVERKLYSFWVTIPDRKTVRSAPVNRGV
FT                   FVTRQHDYTFSNGMLTKSTLDYPSEIYGLITTPLSLLNGVAQAITGRFDTAKESAANEA
FT                   AYLDARRQLLEARKNLEDMKK"
FT   sig_peptide     complement(122840..122899)
FT                   /locus_tag="Nmul_A0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.666 at
FT                   residue 20"
FT   gene            122963..123208
FT                   /locus_tag="Nmul_A0116"
FT   CDS_pept        122963..123208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU6"
FT                   /protein_id="ABB73425.1"
FT                   /translation="MAIRLGFLPFPQPPISFSQPNTQYSVSSLRLHQLRQRRITFAKIA
FT                   PAACNSFIGMVQNNLFLSSIFSSSSRCLEAAFSLFF"
FT   gene            123482..123838
FT                   /locus_tag="Nmul_A0117"
FT   CDS_pept        123482..123838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0117"
FT                   /product="Protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73426"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU5"
FT                   /protein_id="ABB73426.1"
FT                   /translation="MNKPIDEPKPIEFRGNSLSDLRTFPVLARRETGFQLHLVQHGIEP
FT                   DHWKPMNTIGQGVREIRIWDESGAFRVIYVAKFANTVYVLHCFQKKTAKTSKEDIKLAE
FT                   KRYRDLLQELRLAK"
FT   gene            123835..124119
FT                   /locus_tag="Nmul_A0118"
FT   CDS_pept        123835..124119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0118"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73427"
FT                   /db_xref="GOA:Q2YCU4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU4"
FT                   /protein_id="ABB73427.1"
FT                   /translation="MSNERFASVWDAIEDTPEEAENMKLRSSLMLALKNHLLRNNISQT
FT                   EAARLFGVTQPRISDLMRGKINLFSLDALVNMAAAAGLHLEIRVVEETA"
FT   gene            124924..126393
FT                   /locus_tag="Nmul_A0119"
FT   CDS_pept        124924..126393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0119"
FT                   /product="Cytidine/deoxycytidylate deaminase, zinc-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73428"
FT                   /db_xref="GOA:Q2YCU3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU3"
FT                   /protein_id="ABB73428.1"
FT                   /translation="MKIDNQLKNCELVLGIVAPVGVNLDDVQNRLESFFNQFLYEFHFI
FT                   HISKLGQPYIEAPLPNLTELQRLDNGMNNGRFLRNKFKRGDFYALLAIKAINQKRASIN
FT                   GKTRLLKRYAHVIRSLKHPTEVETLRRVYGDGFFLLGVSSSIESRKYYLKNIKGVPEEE
FT                   IDRLISRDDKEAGDFGQRTRDVFQLADAFVTTDDTARLSEQLSRILDLLFAAPVVSPTA
FT                   DEYAMFMAYAASLRSADLSRQVGAVISNVYNDIIATGANDVPRFGGGLYWPTDEDQRDY
FT                   VLGKDSNEMEKREITLRIMKKLEPNSQKNDEYLIAEGKKILSDTGVLNISEYGRAVHAE
FT                   MEAIISAARNGISIRGSTLYSTTYPCHNCAKHIVAAGISKVRYIEPYPKSYAIKLHEDS
FT                   IEANGRGESKKVQFEAFVGIGPRRFVDLFSTSLSSGRKLIRKQDGRLVEWKRNSAELRV
FT                   PMIPLSYLEAETCAVEELNEVLRHISNEILS"
FT   gene            126615..127904
FT                   /locus_tag="Nmul_A0120"
FT   CDS_pept        126615..127904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0120"
FT                   /product="ATP-dependent endonuclease of the OLD family-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73429"
FT                   /db_xref="GOA:Q2YCU2"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU2"
FT                   /protein_id="ABB73429.1"
FT                   /translation="MFKKIVLHGWRQFRNVDIDFHPRLTVLTGANGAGKTTLLNLVSRH
FT                   FGWDGSFISTPVPRRSNPSLMYSTDFWDIDDIQVDIIHSFEREQNRKKQAAAQGSQTTI
FT                   GKIIYGDGTETLITVPNSEVGSRYDVSIPARQRIDGLHIPSHRAPSTYQQVQNIPTIPR
FT                   RRQEVFNQYLSLVQSRYLGSYTQWSPQYYMKETLISLATFGYGNAVVDADPESARLFEG
FT                   FQEILRKMLPPKLRFKRLQIRVPEVILETETGNFSIDALSGGAAAVIDLAWQVFMYEPS
FT                   ESEFVVTLDEPENHLHPELQQRVLADLLTAFPSVQFVVATHSPFIVGSVPHSHVYVLGY
FT                   DDSRRVNSTLLDTVNKTGTANEILRDVLGLEFTIPVWVENRLENLIEKYSKKDFTEDNL
FT                   MMLRQEMTSLGLGKHVPQTISMLAQKKDGQ"
FT   gene            127901..128551
FT                   /locus_tag="Nmul_A0121"
FT   CDS_pept        127901..128551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73430"
FT                   /db_xref="GOA:Q2YCU1"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU1"
FT                   /protein_id="ABB73430.1"
FT                   /translation="MIKLNKLTVPPEIAEKIRQRQQHYNELDAKGEQIPDSLASAYKAP
FT                   EVKELLRCETAEKCAYCESKISHVDYGDVEHLLPKSKFPQLRYSYENLTYTCSVCNTKK
FT                   GDFFDAQTPLLNPYKDKPEDHLMAVGSMIFFIPGSDRGLVTQKRLALNRSNLVERRGER
FT                   LESVATLIDQIARTKTSAIREVLLHELKEECEASEEYAFVVRTYVEAVLPWIN"
FT   gene            complement(128686..129504)
FT                   /locus_tag="Nmul_A0122"
FT   CDS_pept        complement(128686..129504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73431"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCU0"
FT                   /protein_id="ABB73431.1"
FT                   /translation="MYVCKKCSPDLAETVRREYFMARWYKVPEAESILWRYMDFTKFVS
FT                   LLSTKTLYFPSAVCFDDIWEGAKGLRKNKWLWDEFFLDSFRNSLRTIPTNIRPPLSDEE
FT                   IESEAIRMLRELEEGGELDRKRTFISCWHENEFESEAMWKLYSSSVNNAIAIRTTYEGL
FT                   YQALGRDPEIEIGRVEYVDLHSDFVDLNAAFWRKQKSFEHEREVRALLMKPEHIELGLA
FT                   IPCNIEKLIERVIVSPLAPKWFFELVDDVSTTYGFKLTIEKSSLIQDVFF"
FT   gene            complement(129768..129983)
FT                   /locus_tag="Nmul_A0123"
FT   CDS_pept        complement(129768..129983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73432"
FT                   /db_xref="GOA:Q2YCT9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT9"
FT                   /protein_id="ABB73432.1"
FT                   /translation="MKGNGFKAIYLKAGIDSATSHSGRCSFITNLASKGVGVRVSMSLA
FT                   GHQSIAAAQLYIDVNDDMTPKAVNLV"
FT   gene            complement(130118..130807)
FT                   /locus_tag="Nmul_A0124"
FT   CDS_pept        complement(130118..130807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0124"
FT                   /product="probable Mg(2+) chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73433"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT8"
FT                   /protein_id="ABB73433.1"
FT                   /translation="MPLAVLYSRAIAGMEAPLVTVEVHIANGLPGFTIVGLPEAEVKES
FT                   KDRVRAALQNTRFEFPPRRITVNLAPADLPKESGRFDLPIALGILAATGQIPSDKLGHY
FT                   EWAGELALTGELRAIRGALAMTYGAARSGRSFVLPEQNAAEAALVREAAVYPATSLLQI
FT                   CAHLAGREPLQLYSLHAERDAGTGEGEGSALRYPGMEEVKGQAQAKRALEIAAAGSHSL
FT                   LTLCPII"
FT   gene            complement(130913..131215)
FT                   /locus_tag="Nmul_A0125"
FT   CDS_pept        complement(130913..131215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0125"
FT                   /product="Protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73434"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT7"
FT                   /protein_id="ABB73434.1"
FT                   /translation="MVNQKVLDEIVTKVNELVAQSPVKDVEKNLRVMLGAVFTRLDLVT
FT                   REEFEVQQEVLKRTREKLIALETRVAALESAAKSGPLPNTLDVPPETLDDLSETE"
FT   gene            131312..132346
FT                   /locus_tag="Nmul_A0126"
FT   CDS_pept        131312..132346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0126"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73435"
FT                   /db_xref="GOA:Q2YCT6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT6"
FT                   /protein_id="ABB73435.1"
FT                   /translation="MERYRLLENWLLEQFPDRQFTLSPASADASFRRYFRVKFDDGRTL
FT                   IVMDAPPQQEDCRSFLQVANLFSAAGVHVPEILAQDLSHGFLLLSDLGSTTFLQALNAN
FT                   SNNIDSAVRDADASRLYSDATNALLKIQRVSRPGLLPDYDEALLLRELNLFPDWYLAYH
FT                   LQVTPVAGQKAQLDAIFRLILENNLAQPRVFVHRDYHSRNLMVTSPNPGILDFQDAVYG
FT                   PITYDLVSLFKDAYIRWDEERILDWLIRYWEEARKLQLPVAASFPDFYRDFEWMGVQRH
FT                   LKVLGIFARLNYRDGKSGYLKDIPLVANYLRKACERYRELNPLLALLDRWESNKPGLKV
FT                   GYTF"
FT   gene            132372..133076
FT                   /locus_tag="Nmul_A0127"
FT   CDS_pept        132372..133076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0127"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73436"
FT                   /db_xref="GOA:Q2YCT5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT5"
FT                   /protein_id="ABB73436.1"
FT                   /translation="MILAAGRGERMRPLTDTLPKPLLRVGGKALIEYHLQNLARAGFHD
FT                   IVINHAHLGQMIEAALGNGERFGLRIHYSPEPVALETAGGIAQALPIIRAGFGKGRRPF
FT                   LAVNADIYCSMDFSILLPVLHRLRDHPDSALAHLVLVDNPAHHPNGDFSLEAGRVAVTG
FT                   KEMLTFSGIGIYQPQLFQDIVPGTVAKLAPLLKEAMAGEKVSGQRYAGSWVDVGTPERL
FT                   RLLDIDLMRPVS"
FT   gene            133190..134512
FT                   /locus_tag="Nmul_A0128"
FT   CDS_pept        133190..134512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0128"
FT                   /product="aminopeptidase P, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73437"
FT                   /db_xref="GOA:Q2YCT4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT4"
FT                   /protein_id="ABB73437.1"
FT                   /translation="MTPVKSFADRRHSLAWQMQEGVAIIPTAPEHLRNRDAHYPYRFDS
FT                   YFYYLTGFTEPEAVLVIVAGPVDGVSKHILFCREKNAEREIWDGYRYGPEAAREAFGFD
FT                   EAYSISALDEQLPKLIAGQPAIYYSLGHDAAWDRRVVGWINEVRQQVRSGLTPPEDIRD
FT                   IRRLLDEMRLFKSPEELQVMRQAARISAGAHQHVMRKTRVGMREYEVEAELLREFRRHG
FT                   AQAPAYTLIVAGGANACVLHYVENKDRLNEGELLLIDAGCELDGYASDITRTFPVNGKF
FT                   SAAQKDLYELVLYAQAAAIAEVRPGNSWDAPHNAAIAVLSQGFIEYGLCRGSLEEVVET
FT                   EGYKRFYMHRTGHWLGLDVHDAGEYKQNGRWRALLPGMTLTVEPGCYIRPADDVPAHFH
FT                   NIGIRIEDDVTVTEEGCEVLTSAAPKMVDEIEELMRRRKSK"
FT   gene            134512..134856
FT                   /locus_tag="Nmul_A0129"
FT   CDS_pept        134512..134856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73438"
FT                   /db_xref="GOA:Q2YCT3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT3"
FT                   /protein_id="ABB73438.1"
FT                   /translation="MDENPRIVIRRITRDGRTGAPEESLFRAGGGGGRLLTYLFLVPVF
FT                   IVMAVLGIFFFTAFLALFAVAAGGLAFRIWWLRRKLQKSGQAAEGDYVVIEDAEIVEER
FT                   VDKTKGRQGQ"
FT   gene            134929..136236
FT                   /locus_tag="Nmul_A0130"
FT   CDS_pept        134929..136236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0130"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73439"
FT                   /db_xref="GOA:Q2YCT2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT2"
FT                   /protein_id="ABB73439.1"
FT                   /translation="MIDAQYQYDYDLIIIGGGPVGMALALALRNSGLSVLLLEARGLPE
FT                   KAEDPRPLALSQGSRLVLQRLGVWKALSDVTPIFTIHVSNQGGLGRTVMMAREIGVPAL
FT                   GYVVNYDEVFRAMHKALQKCKMDYLTGAQVTHMEASDGFGRVEFEHEGITKKATARLLA
FT                   VADGGRLTAQIEGITQQVHDYEQWAIVARVKTEHFEEHLAEQVSRTELSDAKQSLARVR
FT                   TRPGMRSLQAKAAEDAPRSHQPGVAYERFTPEGPVALLPAGDGFALVWTISPDRVQEIL
FT                   GLDDAAFLERLHGHFGDRLGRFVEAGKRSGFPLALKYATPVTASRTVLIGNAAQTLHPV
FT                   AGQGFNLGLRDAWELAEEIMAFPAETGTPAMLARYSSKRRLDSNMGRTFTHSLVKLFSN
FT                   GNPFLSTVRGAGLSALDCLPQLKKFVARRMIFGARG"
FT   gene            136565..137578
FT                   /locus_tag="Nmul_A0131"
FT   CDS_pept        136565..137578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0131"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73440"
FT                   /db_xref="GOA:Q2YCT1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT1"
FT                   /protein_id="ABB73440.1"
FT                   /translation="MKIGSHTLKNNLIVAPMAGVTDRPFRQLCKSMGAGMAVSEMVSSN
FT                   SLLWGSEKTRRRANHEGEVDPISVQIAGADPAMMAEAARYNVAQGAQIIDINMGCPAKK
FT                   ICNVMAGSALLQDPPLVGRILDAVIGAVRVPVTLKIRTGWDTQHKNALSIARIAENAGI
FT                   QALAIHGRTRACAYTGHAEYDTIAAVKAEVRIPVVANGDITTPEKAKHVLDYTGADAVM
FT                   IGRAAQGRPWIFREIDHYLATGSHLPLPEVAEIHRVLVAHLHDLYSFYGEYSGVRIARK
FT                   HISWYTKGLVGSAGFRHAMNQLQSTDQQLSAVNDFFSELAGYGRRLTYVEAEELVA"
FT   gene            137575..137817
FT                   /locus_tag="Nmul_A0132"
FT   CDS_pept        137575..137817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0132"
FT                   /product="DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73441"
FT                   /db_xref="GOA:Q2YCT0"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCT0"
FT                   /protein_id="ABB73441.1"
FT                   /translation="MSIINENDIARCVRKTVEDYFNDLDGEKPHAIHEMVIRSVEKPLI
FT                   ELVMERAGGNQTRAAELLGINRNTLRNKMKQYQIK"
FT   gene            137927..139489
FT                   /locus_tag="Nmul_A0133"
FT   CDS_pept        137927..139489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0133"
FT                   /product="IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73442"
FT                   /db_xref="GOA:Q2YCS9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS9"
FT                   /protein_id="ABB73442.1"
FT                   /translation="MSIKQALISVSDKSGIVEFAQALHKLGVTILSTGGTARLLRDAGV
FT                   AVTEVGSYTGFPEMLDGRVKTLHPKIHAGILARRDLSEHVSALEKAEIPAIDLVVVNLY
FT                   PFSQTVAQPDCSLEEAIENIDIGGPTMVRAAAKNYQSVAVVTDPADYPALLDEMKTAGG
FT                   EVTPEFRFRLACKAFSHTAAYDGAISNYLTSIEGENAQRRTFPERLNLNFSLVQPLRYG
FT                   ENPHQQAAFYRDPQLVPGSLASYRQLQGKELSYNNIADADAAWECVKTFDSPACVIIKH
FT                   ANPCGVAISDSPLAAYKLAFATDPTSAFGGIIAFNRTLDASAAEAVMSQFVEVIIAPQM
FT                   TDEARQMLARKANVRVLTVPLQAGNNAHDFKRVGGGLLVQTPDNLNVTPNQLKVVTEVQ
FT                   PTAQQLQDLLFAWRVAKFVKSNAIVFCANGRTLGVGAGQMSRVDSARIASIKAGNANLT
FT                   LAGSVVASDAFFPFRDGLDVVVQAGAVAVIQPGGSVRDEEVIAAADEQGVAMVFTGVRH
FT                   FRH"
FT   gene            139749..141056
FT                   /locus_tag="Nmul_A0134"
FT   CDS_pept        139749..141056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0134"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73443"
FT                   /db_xref="GOA:Q2YCS8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS8"
FT                   /protein_id="ABB73443.1"
FT                   /translation="MKLLVIGGGAREHALAWKLLDSSRRRLPATVFVAPGNAGTELEKD
FT                   LKNVPITTIPELIEFARKESIAFTVVGPEAPLAEGIVDAFRFAGLKIFGPTQKAAQLET
FT                   SKDFAKAFMGRHGIPTADYATFSSAAKAHRYIDKKGVPIVIKADGLAAGKGVVVAVTLE
FT                   EAHAAVDKMLGGKSGKAGPKIVIEEFVEGEEISFIVMTDGRHVLPLASSQDHKRLKDGD
FT                   EGPNTGGMGAYSPASSITPTLHGKIMREVIQRAISGMEKEGERYIGFLYAGLMITPDGG
FT                   IKVLEFNCRMGDPEAEVILLRLKSNFITLIEHALSGNLDKIEAEWDRRAALAVVMAASG
FT                   YPDSPRKGDAIEGLSALPATLPVERDYHVFHAGTARGGENGEEIVTAGGRILCVAALGD
FT                   NFRMAQRRAYEIAEQIHFDGCQMRRDIGYRAINHRK"
FT   gene            141112..142011
FT                   /locus_tag="Nmul_A0135"
FT   CDS_pept        141112..142011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0135"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73444"
FT                   /db_xref="GOA:Q2YCS7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS7"
FT                   /protein_id="ABB73444.1"
FT                   /translation="MSTAQQAREFFTGLQQRIVEGLEKVDGTHFRRDEWERPEGGGGLS
FT                   CVLEEGNVLERGGVNYSHVFGGGLPASATAARPELAGRGFEAMGVSLVLHPRNPYAPTV
FT                   HLNVRYLEARKEGAEPVWWFGGGMDLTPYYGFEEDAVHFHQTCKDALQPFGNDFHPRFK
FT                   KWCDEYFYLKHRREPRGIGGIFYDDLSKPDFDSCFSLTKSVGTHFLDAYLPILERRKSV
FT                   PYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSLPPVVKWRYDWKPEP
FT                   GSAEDRLYTNFLIGKDWV"
FT   gene            142086..142161
FT                   /locus_tag="Nmul_AR0003"
FT   tRNA            142086..142161
FT                   /locus_tag="Nmul_AR0003"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala1"
FT   gene            142339..142740
FT                   /locus_tag="Nmul_A0136"
FT   CDS_pept        142339..142740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73445"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS6"
FT                   /protein_id="ABB73445.1"
FT                   /translation="MKLNDVAVRKAKPESKSYKMADGGGMYLEVMPNGSKYWWLKYRFG
FT                   GKEKRLACGVYPDVPLSLVRSWRDDACKLLAQGIDPGANCKSQKTVKQGQEANSFEVIA
FT                   RRRSKPWWPALGFLFTRDYIIDLHMLSIS"
FT   gene            142940..143203
FT                   /locus_tag="Nmul_A0137"
FT   CDS_pept        142940..143203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0137"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73446"
FT                   /db_xref="GOA:Q2Y9G8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y9G8"
FT                   /protein_id="ABB73446.1"
FT                   /translation="MKKRFTDEQIIGFLKQADGGIPVRELCRQHGFSDASFYTWRARFG
FT                   GMTVSDARRLRDLEAENAQLKKLLAESLLDAQALKVALGRKH"
FT   gene            143230..144060
FT                   /locus_tag="Nmul_A0138"
FT   CDS_pept        143230..144060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0138"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73447"
FT                   /db_xref="GOA:Q2Y8Y4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y8Y4"
FT                   /protein_id="ABB73447.1"
FT                   /translation="MAMLEQTNVSERRACLLVDISRTVLHYMSKVRLENEQLQGRMVEL
FT                   ASERRRFGYRRIHALLRREGVEANHKRIFRLYQAAGLAVKRRRRRGGVAVEREQLALPS
FT                   QPNEVWSMDFICDALANGRRIKVLTIVDDFTKESIDLVAEHGISGQHVVRVLEQASQFR
FT                   GLPLAIRTDQGPEFTSKALDQWAYKHGVQLKLIEAGKPTQNAYIESFNGRFRDECLNDH
FT                   WFTSLAEARIRISAWRRDYNEHRPHSALNYLTPAEFAANCRRQEEINGCERNGS"
FT   gene            complement(144447..145307)
FT                   /locus_tag="Nmul_A0139"
FT   CDS_pept        complement(144447..145307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73448"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS3"
FT                   /protein_id="ABB73448.1"
FT                   /translation="MPDPESMPKLTLFALASGRSGTSYLADFFSKNVQQCYSTHEPYLV
FT                   PGNPVLFGKPIDWNTRRDDNALLPVLMRKCGFIAKCKEPAYFESNHAFLKAFDRHAGTL
FT                   LKNVGFVHLVRHPAKVAKSELMREQLIRKVKMPFVDYKSDTGDRYFRWALTGKEAIYQH
FT                   YTGHTLSRFQFYLLQWIEIEYRAMQLLKRNQWQDRVFFIDVDAQLKDERVLRRMLQFFD
FT                   LRHKSAFDMNLRRNKTPFAGPTVITPQDEREIQAVMQNLPANYKTMLKREPYSKCSGWE
FT                   TFASL"
FT   gene            145691..146890
FT                   /locus_tag="Nmul_A0140"
FT   CDS_pept        145691..146890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73449"
FT                   /db_xref="GOA:Q2YCS2"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS2"
FT                   /protein_id="ABB73449.1"
FT                   /translation="MEIAGQPKKITALTRVRDTLAIPLAGIATFFYVLWQLVTEQQLFL
FT                   RTFLVERMGKRAVKKLPLGYWNVLALKSIMLCQHLSHNPNLLRDARKRTESRILQRLQD
FT                   RGVPRGQVLPITEYQPVQIEPHRFYREHVKRGVPCIMRGFVGNAPIDWTLDKLAERFPD
FT                   TIVQALDKRSKKMVNVSLREIAEDRRCNYIPQQLLLDQNPTFYEYFRIPRSHAYFPVMG
FT                   RPSKPVLSFLILGLGAGLNANYHCEEGPNWYLAVSGSKRWTLIESEYSWLLYPAALGNG
FT                   MRRFAEFIADKEGEPSDRDAYPLVEYAPRYEFELHPGDVLFFPAWMWHKTINLNEEGLG
FT                   VTCRYTAPTEISNRYFRALQLLSGGFWKSCVEVISCGIRGNIASLASDTDHNEQETVLY
FT                   "
FT   gene            147423..149114
FT                   /locus_tag="Nmul_A0141"
FT   CDS_pept        147423..149114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0141"
FT                   /product="Carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73450"
FT                   /db_xref="GOA:Q2YCS1"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS1"
FT                   /protein_id="ABB73450.1"
FT                   /translation="MGDGPVVLGVNRTQDASICLMHGSQLIYAIQKERLTRRKHHWGRL
FT                   DDFRNAYVPHLPDLGKPIDVLVECYSSDSEIKNFPAYEREMAETLKFAPGCRRKRISHH
FT                   LAHVYSVFHPSPFEEAAVMIIDGQGSPVSEFTEKWSGSDSVPQDWREVSSFYRADRGRI
FT                   ECIGKQLWDRNERCLVGLGMFYFLLTQAVFPGEGNEGKVMGLAPHGDPNALGLPPLQVE
FT                   GPQVTIPGRWMEILRDRSRFRYAADDTSRFADSANLSAAGQRAFEEAVLEVARWLHAQT
FT                   GAENLCFAGGTGLNCSTNDRLLRETPFQRVFIPPAPSDAGTSLGCAVYGLTEVGGMRCD
FT                   YRWENDYLGPEPHLSDIESVLNGADDLVVEHIEQSADLCGRIADLLADSKVVALYHGRS
FT                   EFGPRALGHRSILGDPRHGYVRDWINARVKEREWFRPLAPVVLLEQAEEFFDIRRPSPF
FT                   MQFAAPVWPKAADIIPAVTHVDCTARLQTVGEQDDPFLRTLLKAFEARTGVPVVLNTSF
FT                   NRKEEPIVETPAQALESFRRTPMHALAMPPYLVRKRIEPEAVTPVG"
FT   gene            149141..150487
FT                   /locus_tag="Nmul_A0142"
FT   CDS_pept        149141..150487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73451"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCS0"
FT                   /protein_id="ABB73451.1"
FT                   /translation="MIRGYPASAGVVPGDSLVLHIATDAPRFRVVFYRWGEGLLRVSET
FT                   DWLAGKYAPPRSAAEDWQWPSYAFPVPHDWLSGVYIAHLEEPGGNAVSLAMESAAVLFV
FT                   VRGSGRSKLLYKIPLATYHAYNCTGGGCFYVNPPRSEDPPGARLSLLRPGGGIGGETWG
FT                   ALDYYDLSSPRQTFAHWDARFIRWLLRNGYQPEFCTDLDIHSDPDLCGRYRLMLSVGHD
FT                   EYWSETIRDRTEDFVSKGGNVAFFGANLCWWRIHILHGGAAMLCHQGGPHGALDHWWPS
FT                   TGVARPEDSLTGVSYRNGGGWWDGPRNTGGYIVQDPEHWVFAGTGLGRGDAFGDKTSPP
FT                   LVGYECDGAPLDDFDKASGLAVLSSNAGNTGTPEGFRVLAASVLDGNWQELPPREAYPA
FT                   REGIHAATMGIFSRNGAVFTAGTTDWAQVLENPLVDAITRNVIDQLLRE"
FT   gene            complement(150565..152610)
FT                   /locus_tag="Nmul_A0143"
FT   CDS_pept        complement(150565..152610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0143"
FT                   /product="ATP-dependent endonuclease of the OLD family-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73452"
FT                   /db_xref="GOA:Q2YCR9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR9"
FT                   /protein_id="ABB73452.1"
FT                   /translation="MTIHILPVKEKDTDFMNKQPLQDMLLLPRISDIPEIPEPQDHAEA
FT                   TSNSESPVESPVDSPVDAPAPGEAIDDRIIHPMHLTRFLVTNFRSVENSGWIEVDSVTA
FT                   LIGVNESGKTNLLVPLWKLNPAVGGEIVPASDYPKKQFGPVRQAPESFHFITAEFEAGE
FT                   LGEELCGKLEISSEEASLIAVKRYFNGDYSISFPRREELGEIRRSSGEEAEDVVDTVIH
FT                   SLPKFVYYSEFGNLDSEIYLPHVVQNLQRTDLGPREAAKSRTLRVLFKFVGLEPGEILE
FT                   LGRDFPRRKGRRREPTVEEIREIAMKKRERSILLQSAGGLLTEKFRNWWKQGDYKFRFE
FT                   ADGSHFRIWVSDDRRPEEVELESRSTGLQWFLSFYLVFLVESGGEHQNAVLLLDEPGLS
FT                   LHPLAQRNLFAFFDSLAKVNKILYTTHSPFLLDAEHLGRARKVYVSANGTTQVTSDLRS
FT                   VEKDVRQAGAAYVVHSALNLNIAESMVTGCQPVVVQRVSDQYYLSTIKTLLIGANKIAP
FT                   KRELLFPPAGASKTVGVIASIISGRDEPLPKVVLRDDEAGKQINAELKSDLYSDAQERI
FT                   FSTDNYVLFSNSTTEDLIPAPFFAQVIDRWERNTDTAFADVLVNGKPVVAQVQAWAEAQ
FT                   DLVLRDEWRVEVAKRVKEQALKKGIGAFDAGTIARWAKLFQELIRN"
FT   gene            complement(152774..153217)
FT                   /locus_tag="Nmul_A0144"
FT   CDS_pept        complement(152774..153217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0144"
FT                   /product="Cytidine/deoxycytidylate deaminase, zinc-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73453"
FT                   /db_xref="GOA:Q2YCR8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR8"
FT                   /protein_id="ABB73453.1"
FT                   /translation="MSQHETFLREAVRLAKNNRERGSRPFAAVLVVEGQAVSTGVNDVV
FT                   QSNDPTTHAEMEAVRAASRKLGRPDLRGSIVYASGHPCPMCLAAMVIAGVDAVYYAFDN
FT                   DDAEPYGFSSKATYQKLSLPLKPPPLPLIRLDLGLSAAELYGA"
FT   gene            complement(153308..154165)
FT                   /locus_tag="Nmul_A0145"
FT   CDS_pept        complement(153308..154165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0145"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73454"
FT                   /db_xref="GOA:Q2YCR7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR7"
FT                   /protein_id="ABB73454.1"
FT                   /translation="MQFKIREGRQADAGAAGMICYEAFRTISQQHGFEPDFPSFEVARD
FT                   LLLGLLSRPDVYSVVAESEGRIIGSNFLWQDSAIAGIGPLTVIPETQSDRVGRGLMEDV
FT                   LEHARNKHFAGVRLVQAAYNNRSLSLYTKLGFEVREPLATLQGAPLQIDISGYNVRPAR
FT                   AEDANACDALCRKIHGHDRGQELRHAIGQQTAMVVEHGGHITGYATLIGFTGHAVGESN
FT                   EDLKALIGAAAAFAGPGFLLPTHNSELFRWCLQQGLRVVQPMNLMSLGLYNQPAGSFLP
FT                   SILF"
FT   gene            154328..155083
FT                   /locus_tag="Nmul_A0146"
FT   CDS_pept        154328..155083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0146"
FT                   /product="Protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73455"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR6"
FT                   /protein_id="ABB73455.1"
FT                   /translation="MVTATFRFYEELNDFLVPERRKREFSCPCARAATTKHMIEALGVP
FT                   HTEVELVLVNGESVGFDRILEHGDRVAVFPKFEMVDVAPLLRVREHPLRVTRFIADAHL
FT                   GGLAHLLRMTGFDTLYDNNYHDRQIELLAAQEKRIVLTRDRELLKRRSITHGCYVRTLK
FT                   PPEQLCEIFDRLDLAHSIKPFTLCLNCNAPLRPVEKSVVLERLPPSVRERFDHFSTCDI
FT                   CHRVFWEGSHWQRMRTMLEECIKPNRFGG"
FT   gene            155336..155411
FT                   /locus_tag="Nmul_AR0004"
FT   tRNA            155336..155411
FT                   /locus_tag="Nmul_AR0004"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA-Lys1"
FT   gene            complement(155500..156180)
FT                   /locus_tag="Nmul_A0147"
FT   CDS_pept        complement(155500..156180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73456"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR5"
FT                   /protein_id="ABB73456.1"
FT                   /translation="MKKIKLMCVVLLMLGLIPGVSVWARGGGGGGHGGGVFGGGGHIGG
FT                   GGHMGGGGHMGGGGMHFGGGGHIGGGGWAHGGGMHYGGGEHFGGGVGYYRGGGVGRYRG
FT                   GGFGYYRGPRGFYRGYGYGLGFGFGGYGLGLGLGYGLGYGALAYGPPYYPYPPMYPYPI
FT                   AVPVPAAPPVYIQQNLPEQNDTQNTAQLPSGYWYYCRESEGYYPYVKDCPGDWVQVAPQ
FT                   PPPP"
FT   sig_peptide     complement(156106..156180)
FT                   /locus_tag="Nmul_A0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(156242..156661)
FT                   /locus_tag="Nmul_A0148"
FT   CDS_pept        complement(156242..156661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR4"
FT                   /protein_id="ABB73457.1"
FT                   /translation="MHLPLLTSSANRLVLSVIFFLAFTSSVVLAQARQSAQAPQPIEAI
FT                   MKNMVSAILANSLADFVSPGDEAFQAGMTKEMLSSINQSLASRLKQGYTTIFLTTLRQQ
FT                   GFDVYVWKVVFKDGNDDVLIFMALKDQKVGGFWLR"
FT   sig_peptide     complement(156569..156661)
FT                   /locus_tag="Nmul_A0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 31"
FT   gene            complement(157188..157667)
FT                   /locus_tag="Nmul_A0149"
FT   CDS_pept        complement(157188..157667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73458"
FT                   /db_xref="GOA:Q2YCR3"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR3"
FT                   /protein_id="ABB73458.1"
FT                   /translation="MKLSGALRTLAVFEAAKGALVLLVGFDLLSLVHHDIQQAVEHLLA
FT                   HTHLNPASRYPHIFIDLANQLTNTRLLLIAAGAGAYSLARFIEAYGLWRARRWAQWFAA
FT                   ASGAIYVPFELFELYERVTWLSLGALTLNLAIVAFMLHHLFHAGGKKMANAPSSN"
FT   gene            complement(158058..160496)
FT                   /locus_tag="Nmul_A0150"
FT   CDS_pept        complement(158058..160496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0150"
FT                   /product="Spermidine synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73459"
FT                   /db_xref="GOA:Q2YCR2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR2"
FT                   /protein_id="ABB73459.1"
FT                   /translation="MSLPRPPFIAIGLLSACVLAYEVLLTRLFSIVLWHHFAYMIISAA
FT                   MLGYGASGTALTLLREKINGYIGPIYLAAAIGLAFLMPAAFLLAQEIPFNPLELLWDPF
FT                   QLTHLLSIYLLMMLPFFCAGTGIGLILSHFGQQAGRIYAFDIMGAGIGSMCVIGVLFLT
FT                   PPHNLLIVLAALALFAAAVATIEMRIRPEWLWIALLGLAFLVLLAIPPEGFRVHPSPYK
FT                   DLSQALNITGAQVIGERSSPLGQITVVESPRVPFRYAPGMSLNALEEPPDQLGIFVDGD
FT                   GPSVLTRFNGRREPLSYLDQLTSALPYHVLQRPHAGPHVLVLGAGAGSDVLQALYHGAI
FT                   RIDGVELDRNVIDLVEKRFHDFGGDIYTLPQVHIHEAEARGFVNATRSRYDLIQVALLD
FT                   SFGVAAAGVYGLSESYLYTVEAFQTYLRRLMPGGVLAITRWLTLPPRDALKLFATAITA
FT                   LERSGVDNPGARLVMIRGWKTVTLLVKHSNFTVAEIEAIRKFCRERSFDTTYYPGMRPE
FT                   EANRYNVLAQPYFFEGATALLAGDRQTFIDRYKFFIEPATDDQPFFFRFFKWDSLRELF
FT                   ALREQGGMPLLDWSYPLLVATLIQAFIASVVLILAPLLASKARRALPPAKVALYFLAIG
FT                   LAFMFMEIAFIQKFILFLAHPLYAVAGVLSAFLAFAGVGSWLAGRLQKRFRKSGHLTVA
FT                   VMAIGVLALLYLAILPSLFDTLIHLSDPAKIAISVALIAPLAFCMGMPFPTGTMRLAFT
FT                   AREAIPWVWAINGFASVVGAVLATLLAIHLGFTFVILLAVAIYSLAALALRGFPEGVAE
FT                   "
FT   sig_peptide     complement(160434..160496)
FT                   /locus_tag="Nmul_A0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.950 at
FT                   residue 21"
FT   gene            complement(160502..161212)
FT                   /locus_tag="Nmul_A0151"
FT   CDS_pept        complement(160502..161212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0151"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73460"
FT                   /db_xref="GOA:Q2YCR1"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCR1"
FT                   /protein_id="ABB73460.1"
FT                   /translation="MNWQFATAFGALMYFGCVIPLSAAEYEALRQKMVREVIAASGNSP
FT                   PGASVVAAMEKVERHRFVPAWLSIFAYRNHPLPIGHGQTISQPLIVARMTELLKLKKDD
FT                   KVLEIGTGSGYQAAVLAEIAKTVYTIEIIEPLGNEAAGRLQSLGYDNVKTRIGDGYYGW
FT                   PEAAPFDAILVTAAASHVPPPLLKQLKPGGRMVVPLGAPFMTQYLMLVEKQPDGSVTTH
FT                   QIVPVRFVPLRGGH"
FT   sig_peptide     complement(161141..161212)
FT                   /locus_tag="Nmul_A0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.921 at
FT                   residue 24"
FT   gene            complement(161395..161859)
FT                   /locus_tag="Nmul_A0152"
FT   CDS_pept        complement(161395..161859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0152"
FT                   /product="proline-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73461"
FT                   /db_xref="GOA:Q2YCR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCR0"
FT                   /protein_id="ABB73461.1"
FT                   /translation="MEIFMTKIKFGCFALTLFMAAPMSPAWAGGGHGHGHHGHHHHGHH
FT                   HHRHGGGGGWGYGVGIGLGLGLLGYGLSSYAARPSYPPAYSYPPAGYGYAPVVSVPAAP
FT                   PVYIQQGVVQAPPQPQASNYWHYCRNPEGYYPYVKSCPGGWLQVAPQPGQ"
FT   sig_peptide     complement(161773..161859)
FT                   /locus_tag="Nmul_A0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            162176..162592
FT                   /locus_tag="Nmul_A0153"
FT   CDS_pept        162176..162592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ9"
FT                   /protein_id="ABB73462.1"
FT                   /translation="MKMRILAILLAAAIAYATPVVARNGGGKHDGHQGVEHANAGGTAS
FT                   EHMGQHGMENSNAQWSTDAARGQDRADWRNQDGRGNGHGAGDEDQAGKGKHKGSHDHGG
FT                   SDKGKKDKSSKGSKGHNGHEGHKGHKGHGKDADY"
FT   sig_peptide     162176..162244
FT                   /locus_tag="Nmul_A0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 23"
FT   gene            162661..163308
FT                   /locus_tag="Nmul_A0154"
FT   CDS_pept        162661..163308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73463"
FT                   /db_xref="GOA:Q2YCQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ8"
FT                   /protein_id="ABB73463.1"
FT                   /translation="MSNEAVNYWKFATIGILLVGASVASTLFLTGRDSDSKPELAASAA
FT                   ETEAVSAGGETPVSEAGKKPLASVPEPAPIAQAAPEPPKRPRVTQSNQNAAAAVPPSPS
FT                   YAPPAAYPPQPVRSSYPSQSVMNECNRYASEQVNSKAEEVLKNAALGAALGAAVGAAGG
FT                   AIAGGGKGAGKGAAIGSITGVAGGTLYGLNETKSHDGQYQAAYSSCMRAKGY"
FT   gene            complement(163235..163657)
FT                   /pseudo
FT                   /locus_tag="Nmul_A0155"
FT   gene            164173..164859
FT                   /locus_tag="Nmul_A0156"
FT   CDS_pept        164173..164859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0156"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73464"
FT                   /db_xref="GOA:Q2YCQ7"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ7"
FT                   /protein_id="ABB73464.1"
FT                   /translation="MEYQENSISLLQDELIGSAAFVSELRLKGHGAMKKNILAALLLPA
FT                   ERMDLRLRHLPFEARMAMAIIALSTLVAWPLSAADSADEIIRAKAISIVDGDSISVVIN
FT                   QELVRVRLAGIDAPEGTQPFAIDSRQSLHDLCFWVEAELSSISKDYYGRMLAKVKCNGV
FT                   NVNAEQVRRGMAWVADQSVGERELVQLQEEAQAGKRGLWSYESSIPPWEWHSRGWYSQR
FT                   SWSGPR"
FT   gene            complement(164920..165114)
FT                   /locus_tag="Nmul_A0157"
FT   CDS_pept        complement(164920..165114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73465"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ6"
FT                   /protein_id="ABB73465.1"
FT                   /translation="MFGFNNLKQLDDRVVLKPVLIISDLGKLVELRAGLRPDDRIIENT
FT                   LDGISNGDRVRISSISSRN"
FT   gene            complement(165600..166439)
FT                   /locus_tag="Nmul_A0158"
FT   CDS_pept        complement(165600..166439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0158"
FT                   /product="Protein of unknown function DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73466"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ5"
FT                   /protein_id="ABB73466.1"
FT                   /translation="MNKKLINLSMAAVLLGGPAIGYSATLDTFSADGVLQNFTGFDWHS
FT                   NGGGWVQGFDLTGASKAGDSDTFTLTYQAFAGVINTTSPTNNLFVSSPGPETGTYEITT
FT                   FQTLTQTAICQNDGCSSIQIITNSGSWEIFLDSSPNADQSTGTGFLDGVNILSGTWDSG
FT                   FSTFAATGAIPGPAVLGTGGGFLFGTVTFTNSTYINPALSGTQFQASLQFPGQSAPEYT
FT                   RPAAFNGVATGADTASSFVIQTDGSQGFTAAEVPEPGILALMGIGLLGFAFTGRRRT"
FT   sig_peptide     complement(166368..166439)
FT                   /locus_tag="Nmul_A0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.617 at
FT                   residue 24"
FT   gene            complement(167297..167752)
FT                   /locus_tag="Nmul_A0159"
FT   CDS_pept        complement(167297..167752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ4"
FT                   /protein_id="ABB73467.1"
FT                   /translation="MEDIITVRFETGDEARAAAASLADSVNKNDIFILSNNQPGALDSD
FT                   RDAVRTNDQGGAKGAAKGMATRAASRGIAASITSPVTGEPAGAVAAAAGSYTGSLAGTA
FT                   GGLGGEGESANKIPHEQAGLMLAVRVANANNKQRIIDCLRQHVGRGH"
FT   gene            168967..169290
FT                   /locus_tag="Nmul_A0160"
FT   CDS_pept        168967..169290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73468"
FT                   /db_xref="GOA:Q2YCQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ3"
FT                   /protein_id="ABB73468.1"
FT                   /translation="MMRRAFIPAVIAVFITGIVILGFAAALYHSLFFYKADGVMSRETA
FT                   KRLGLLRDDPASFPAELAFRKSETGGYFYRKGGGTAFIDETSYTTIDLIAGCERLGGCQ
FT                   LRK"
FT   sig_peptide     168967..169041
FT                   /locus_tag="Nmul_A0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.815 at
FT                   residue 25"
FT   gene            complement(169506..169916)
FT                   /locus_tag="Nmul_A0161"
FT   CDS_pept        complement(169506..169916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0161"
FT                   /product="adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73469"
FT                   /db_xref="GOA:Q2YCQ2"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ2"
FT                   /protein_id="ABB73469.1"
FT                   /translation="MPASELFDPVPKESFVKALSDTAAQWNEESDWQGDERNVVLALAR
FT                   IWFSVSTGEIARKDAAASWLLERLPHEHRAVLMVALAAYLGTARDDLAEPTEQVASFVP
FT                   YSKAMIESICHYIRHRCKRNRMATPQGRTTSI"
FT   gene            170422..170775
FT                   /locus_tag="Nmul_A0162"
FT   CDS_pept        170422..170775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73470"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ1"
FT                   /protein_id="ABB73470.1"
FT                   /translation="MQTDLWNEELEQSRELLKNFLKTLPEADQQITLIRVFLRRIESLA
FT                   TGSIYKIFSRCIQYLGTSRAVFFPDAIFVDEISLAHLFAVDYDIAWIVNVGYFPLAGQH
FT                   KYPWQKPDWSDHL"
FT   gene            complement(170832..171245)
FT                   /locus_tag="Nmul_A0163"
FT   CDS_pept        complement(170832..171245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0163"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73471"
FT                   /db_xref="GOA:Q2YCQ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCQ0"
FT                   /protein_id="ABB73471.1"
FT                   /translation="MRITNKPILLVEDDQVDMMKVTRALKEIGVTNQVVHRENGEDALN
FT                   YLRDEDSEKPCLILLDLSMPIINGLEFLQAVKKDGRLRRIPVVVLTTSDDQQDKLNGFN
FT                   FGAAGYMGKPVDYTQFVKVIRSIDTYWTISQMP"
FT   gene            complement(171712..172614)
FT                   /locus_tag="Nmul_A0164"
FT   CDS_pept        complement(171712..172614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0164"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73472"
FT                   /db_xref="GOA:Q2YCP9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP9"
FT                   /protein_id="ABB73472.1"
FT                   /translation="MSGIRAPRVGLVLGSGSARGWAHIGVIRALEQAGVRPDLVCGTSI
FT                   GSLVGAVYAAGELDRFEQWVLGLGVREVIAYIDISLGSGLLKGERLMSFFRDKFPDRPV
FT                   QDLALPFAAVATSLHTGAEVWLREGSTLEAVRASIALPGLFSPVLCEGSVLVDGGLVNP
FT                   VPVSLARAMGADVVIAVDLSFDMLGRHLRAEPPPDASAGDVMDWIRKLQESLGALLPAH
FT                   SAEIPKMPSMLDVLASSINIMQVRINRSRMAGEPPDLIIAPRLAHLGLLDFHRAREAIE
FT                   EGKQAVERVAHSLSDLNRM"
FT   gene            complement(173234..173473)
FT                   /locus_tag="Nmul_A0165"
FT   CDS_pept        complement(173234..173473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0165"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73473"
FT                   /db_xref="GOA:Q2YCP8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP8"
FT                   /protein_id="ABB73473.1"
FT                   /translation="MDWVGKGKTNAEIGSILSISEFTVRNHLYHIFQKLGVYNRTQAAS
FT                   KVAQTWGMRSEQHINGAPDTLFPQTNNPPLAGEL"
FT   gene            complement(173494..173874)
FT                   /locus_tag="Nmul_A0166"
FT   CDS_pept        complement(173494..173874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73474"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP7"
FT                   /protein_id="ABB73474.1"
FT                   /translation="MQILSAGEIDHGVSIPMDRLHSYFRVIQEGLGVRRHLDLLRWLQG
FT                   EIQHHLPHEILIVAWGNFASNFIQHDIVSSLPSARTAYFETTELSSRVQKLYRHWTRLR
FT                   RIAPFPHLSARRLIHSVARVMG"
FT   gene            174264..174983
FT                   /locus_tag="Nmul_A0167"
FT   CDS_pept        174264..174983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0167"
FT                   /product="Protein of unknown function DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73475"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP6"
FT                   /protein_id="ABB73475.1"
FT                   /translation="MKLNTIHFKKIAASAPLLILTLALLANPAHAVDWTEIGDAGQLLS
FT                   TAQMPTGDEGRLRNIYGTISTNNDVDLFRIYISNPTTFSAGISSTSGNLDSGLILFNEG
FT                   GYALYGNDDAMLGTRVSSLPAGHVNGPQGPGWYNLAIFALGTPPVSGDGFTPDHYMFPN
FT                   VSSPYTQILTPTGPGGAAPLAGWAQLDDTVAISEDYRIRLSGVTVSPVPEPETYAMLLA
FT                   GLGLMGTMIRRRKGFIG"
FT   sig_peptide     174264..174359
FT                   /locus_tag="Nmul_A0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(175290..176138)
FT                   /locus_tag="Nmul_A0168"
FT   CDS_pept        complement(175290..176138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0168"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73476"
FT                   /db_xref="GOA:Q2YCP5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP5"
FT                   /protein_id="ABB73476.1"
FT                   /translation="MKAIADTMGVARSRLVERMKPQEKSFRCRYNKADDAWLLPLIREI
FT                   VDCRATYGYRRICALLNRKLERMGKPAVNHKRVYRIMRQNGLLLARYTGKQRVLSHEGK
FT                   VITLRSNLRWCSDGFEIPCWNGQVVRVAFALDCCDREVISHVATTGGITGEMVRDLMTE
FT                   SVERRFGTVDLLPHRVEWLSDNGSCYTASETTAFAKDMGFISCFTPVRSPESNGMAEAF
FT                   VKTFKRDYVYVHDRPDAKTVMAQLDQWFEDYNEFHPHKGLKMKSPRQFIRSQLLTASCP
FT                   V"
FT   gene            complement(176135..176542)
FT                   /locus_tag="Nmul_A0169"
FT   CDS_pept        complement(176135..176542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0169"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73477"
FT                   /db_xref="GOA:Q2YCP4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP4"
FT                   /protein_id="ABB73477.1"
FT                   /translation="MPGAMHSASGLDRIEIVTGIERRRRWSLGEKLKAVEESRLPGMSV
FT                   SYVARKYGIAPSLLFRWRKLMAEGGQEAVRSGDAVVSAAEVKELKKRIRELERVLGKKT
FT                   LENEILTEAVKLAHEKKLISRMPLLPPDDLP"
FT   gene            177163..178338
FT                   /locus_tag="Nmul_A0170"
FT   CDS_pept        177163..178338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0170"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73478"
FT                   /db_xref="GOA:Q2YCP3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP3"
FT                   /protein_id="ABB73478.1"
FT                   /translation="MIKKEKHKTIIMLGTSPEGHGGIATVVGNYGDCGVLKKWKVKYVV
FT                   THVQGSGFAKACAAGVAMQQLLCMLVTGRIGLLHVHMSSRASTWRKSLFLLMGMVFRVP
FT                   YLIHLHSPNFVDFFEHECGERRKRLIRFLLSRALYVIALSQGWAKDIKKISPAARTVIL
FT                   FNSVPLPAARLREKEMEESSNALCDPPLILFLGHVGKRKGTFDLIRAVALLSENFRLII
FT                   GGDGELQRAQMLSEELGVSDKILFAGWLGKAEKDHLLARAAIFVLPSYHEGVPMAILEA
FT                   MSWGIPIVTTPVGGIPEVVTEGQEGLLVNSGDIVGLAHALARLLAAPSLRREFGERGRH
FT                   KIESKFSIKVLQPQLEQLWIDSGVSEPEPRPEPELVMQRGEVPAPEIQPKV"
FT   gene            complement(178346..179500)
FT                   /locus_tag="Nmul_A0171"
FT   CDS_pept        complement(178346..179500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0171"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73479"
FT                   /db_xref="GOA:Q2YCP2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041364"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP2"
FT                   /protein_id="ABB73479.1"
FT                   /translation="MSTPPIVIIGSGIGGYTVAREFRKLDTTTPVLIISADHGGFYSKP
FT                   MLSNALATGKTPASIVTASAEKMAEQLKLTIRPYSRVSAIDPSSKTITLQDGEKVSYSK
FT                   LVLAMGADPIRLPLEGEGAKDILSVNDLEDYQRLRDALGGKKDVTILGAGLIGCEFAND
FT                   LATAGYRVRVIDISVHPLGRLLPQAGGAFMQHRLEAAGVVFHLGATAEYVERIHESFRL
FT                   TLASGETLQTEIVLSAVGLRPRIHLAQAAGLGVNRGIVVNRSLQTHNEHIYALGDCAEV
FT                   EGRVLPFVMPIMHAARGLAPTLAETPTPIRYPAMPVLVKTPACPAVVSPPAAGAQGEWL
FT                   VEEDESGVKALYKTAEGKLLGYALLGASTKEKNALAAELPAVME"
FT   gene            179913..180842
FT                   /locus_tag="Nmul_A0172"
FT   CDS_pept        179913..180842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0172"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73480"
FT                   /db_xref="GOA:Q2YCP1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP1"
FT                   /protein_id="ABB73480.1"
FT                   /translation="MTGRTKIGFIGLGIMGKPMASHLLRGGHTLFLHSRSGVPGELLTQ
FT                   GGQACSSPAEVAQNADLIITMLPDTGDVERVLFGDKGVAEGLSAGRSKGGIVMDMSTIS
FT                   PVETRKFAAEINELGCEYVDAPVSGGDIGARNGTLTIMVGATSSAFVQVKPVLEFMGKT
FT                   ITLIGPTGTGQVCKLANQIIAALTIEAVGEGLLFASKAGADVRKVRQALMGGFAYSRVL
FT                   EVHGERMIERAFEPGFRVELHRKDLGLALSHARTLGVSLPGTATVQELLNACIAHGGAG
FT                   WDSSALVRMLEKLANHEIETIEGSHDES"
FT   gene            180867..182324
FT                   /locus_tag="Nmul_A0173"
FT   CDS_pept        180867..182324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0173"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73481"
FT                   /db_xref="GOA:Q2YCP0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCP0"
FT                   /protein_id="ABB73481.1"
FT                   /translation="MNDALELVKKLRTFLPAESVLHETEDVRPYECDGLSAYRQTPMIV
FT                   ALPRTEDEVAGILKICDALKIPVVARGAGTGLSGGALPHPQGVLLSLAKLKNILEIDPA
FT                   ARTARVQPGVRNLAISEAAAPYGLYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTVH
FT                   NILKLRVLTIEGELLEMGADGLDAPGYDLLALMTGSEGMLGIVTEVTVKLTPRPEKAQV
FT                   VLASFDDIRDAGNAVANVIGAGIIPAGMEMMDKITTGAVEEYVHAGYNVEAAAILLCES
FT                   DGAEEEVAEEIERINEIMRQSGATEVRISRDEAERARFWAGRKAAFPAAGRVSPDYYCM
FT                   DGTIPRKNLASVLTGIEALSAEYGLRCMNVFHAGDGNLHPLILYDANHPGELELTEEFG
FT                   AKILRMCIEAGGTITGEHGVGIEKINQMCSQFKTGELEMFHAVKAAFDPASLLNPGKAI
FT                   PTLRRCAEQGAMHVHRGKEKFPELPRF"
FT   gene            182374..183468
FT                   /locus_tag="Nmul_A0174"
FT   CDS_pept        182374..183468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0174"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73482"
FT                   /db_xref="GOA:Q2YCN9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN9"
FT                   /protein_id="ABB73482.1"
FT                   /translation="MQEIVDQLAATIRAAAASNVPLRIRSGGTKDFYGQQDKGRDVAPE
FT                   GILDPTAFAGIVDYEPTELVVTARTGTPLAQLETELNGRGQMLAFEPPHFGAGATLGGC
FT                   IAAGLSGPRRASAGAVRDFVLGVRMLDGRGDDLSFGGRVMKNVAGYDIPRLMAGSLGTL
FT                   GLLLEVSLKVLPLPAEERTLRLSMNEAVAIETMNRWAGKPLPVSATCFCEGELTVRLSG
FT                   ATSAVRAARAVLGGEEIVENSSFWKSIREQVHPFFRSGKQLWRLSIKSTTAPLSLPGKQ
FT                   LIEWGGAVRWLSVDAEMDNDAVETLVRKTAKEAGGHATLFRSRTPAAAVFHPLPPAMMN
FT                   IHRQLKEKFDPMRIFNRGRLYPEL"
FT   gene            183469..184818
FT                   /locus_tag="Nmul_A0175"
FT   CDS_pept        183469..184818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73483"
FT                   /db_xref="GOA:Q2YCN8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN8"
FT                   /protein_id="ABB73483.1"
FT                   /translation="MQTNLADFIKDTPEGKEAEAILRTCVHCGFCLATCPTYQLLGDEL
FT                   DSPRGRIYLMKQMLEGEPVTEKTQLHLDRCLTCRACETACPSGVRYGHLVDIGRGLVEK
FT                   KVGRSLAAGSMRYVLRQALPNPTLFASLLKVGRTVRPLLPNGLKDSIPAAPMEESRPFH
FT                   AARHERRMLVLQGCVQPALAPNINAAAARVLDKLGISLISAPDAGCCGAVSYHLNAQRE
FT                   GLDYMRRNVDAWWPYIAPKPEKEPGMKPGTKGRATEGAKEETRGVEAIVMTASGCGATV
FT                   EEYGHLLRHDPAYAEKAARISELTRDISEIVEAEMPALVSLLSKSTASRENPRQKLAFH
FT                   SPCTLQHGMRIRGVAEKILAAAGFDLTYVPDAHLCCGSAGTYSILQPELSQQLLKNKVT
FT                   ALESGHPDRIATANIGCLMHIRSGAALPVEHWIEILDETLEAAWPGTIED"
FT   gene            185213..187543
FT                   /locus_tag="Nmul_A0176"
FT   CDS_pept        185213..187543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0176"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73484"
FT                   /db_xref="GOA:Q2YCN7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN7"
FT                   /protein_id="ABB73484.1"
FT                   /translation="MSFVNKPMAKKISPDPLPPRVVRLLRESASLALLGVALYLVLIFY
FT                   GYERADPGWSHSGDGPAQNPGGMVGAWLSDLMLYLLGVSAWWSVLFFLFLVWWMYRRID
FT                   GSIFDRRPWFVSMIGFLLLLVASSGMEALRFYSLKVVLPQMPGGVLGFLLSKSLSQVLG
FT                   FTGATLALLILIAIGFSLFTGLSWLRLIEQIGASIEGFFLLVWRSIESVFLFIGRGWRS
FT                   RQDRHVGAVSAIRREELVEVEKKRLLEHPPLHIEQPVVALPKPRKVTRQKQAPLSSDLP
FT                   DPTLPPLRLLDEPPKKEVETLSTETLEFTSRLIERKLMDFGVEVKVVAAYPGPVITRYE
FT                   IEPAVGVKGNQILNLVKDLARSLSVVSIRVVETIPGKTCMGLEIPNPKRQVVRLSEILS
FT                   SQAYADMGSPLTIALGKDIGGHPVVADLAKMPHLLVAGTTGSGKSVAINAMLLSLLYKA
FT                   TPEQVRLILVDPKMLELSVYEGIPHLLAPVVTDMRQAASALRWGVAEMERRYKLMSALG
FT                   VRNLGGYNQKIREAIKSEKPILNPLSLTPEAREPLEEMPVIVVVIDELADLMMVVGKKV
FT                   EELIARLAQKARAAGVHLLLATQRPSVDVITGLIKANIPTRVAFQVSSKVDSRTILDQM
FT                   GAEALLGQGDMLYLPPGSGYPQRVHGAFVADQEVHRVVEYLKEHGEPRYVDGVLDASDE
FT                   EGGGSGNGGVGGQEGGESDPLYDEAVAIVLRSRRASISLVQRHLRIGYNRAARLIEEME
FT                   RAGLVSAMQSNGNREILVPAGNE"
FT   gene            complement(187831..188661)
FT                   /locus_tag="Nmul_A0177"
FT   CDS_pept        complement(187831..188661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0177"
FT                   /product="ammonia monooxygenase subunit C"
FT                   /EC_number="1.13.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73485"
FT                   /db_xref="GOA:Q2YAW6"
FT                   /db_xref="InterPro:IPR006980"
FT                   /db_xref="InterPro:IPR023349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YAW6"
FT                   /protein_id="ABB73485.1"
FT                   /translation="MATTMGTSSPAKTSGRDYDMSLWYDSKWYKFGLITMLAVAIFWIW
FT                   YQRTFAYSHGMDSMEPEFEKVWMGLWRVHMIVMPLFALITWGWIWKTRDTKEQLDNLDP
FT                   KLEVKRYFYWMMWLGVYLFGVYWGGSFFTEQDASWHQVIIRDTSFTPSHVVVFYGSFPM
FT                   YIVCGIASYLYAMTRLPLYSRGTSFPLVMAIAGPLMILPNVGLNEWGHAFWFMEELFSA
FT                   PLHWGFVILGWSGLFAGGIAAQIITRYSNLTDVVWNGQSKVILNNRIVPYDKAF"
FT   gene            188945..189568
FT                   /locus_tag="Nmul_A0178"
FT   CDS_pept        188945..189568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0178"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73486"
FT                   /db_xref="GOA:Q2YCN5"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCN5"
FT                   /protein_id="ABB73486.1"
FT                   /translation="MKLSEKFCVFLFFLLFTSTTHATGIGSLKSFMENARTVRADFAQT
FT                   VLDKSRHIVQTASGAMQFERPGKFRWIYEKPYEQLIVGDGERIWFYDHDLAQVTVRKLD
FT                   AAIGSSPAALLAGNNDIEKNFHLLEIGLQGNIEWVEATPKTRESTFERVLLGFTLEGIL
FT                   RVMELHDNFGQVTVFEFSGVEQNRKLPPELFKFSPPAGVDVISE"
FT   sig_peptide     188945..189013
FT                   /locus_tag="Nmul_A0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            189561..190874
FT                   /locus_tag="Nmul_A0179"
FT   CDS_pept        189561..190874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0179"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73487"
FT                   /db_xref="GOA:Q2YCN4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN4"
FT                   /protein_id="ABB73487.1"
FT                   /translation="MSDLFAQAQPAAPLAEQLRPHELKDVVGQPHLLGPGKPLRLAFES
FT                   GKPHSMILWGPPGSGKTTLARLMASAFDAEFIALSAVLAGVKDIRDAIERARAVLHQSS
FT                   RHTILFVDEVHRFNKSQQDAFLPFVEQGLVTFIGATTENPSFEVNGALLSRAQVYVLTA
FT                   LSTTELGTLFDRARKLALAELDFTPDARSLLIEYADGDARRLLNLLEQLKTAAAAEGIS
FT                   RIDADYARERLSRAARRFDKGGDEFYDQISALHKSLRGSHPHATLYWMCRMLDAGADPR
FT                   YIARRLIRASVEDIGLADPRALRIALDASETYERLGSPEGELALAQAALYLACAPKSNA
FT                   AYLAYNKTRSFIGEDKSRRVPEHLRNAPTRLMKEMGFGRDYRYAHDDPDAYAAGEHYFP
FT                   EGMPEIEFYRPTSRGFESKISERLAYLRELDKQAKKES"
FT   gene            190904..192274
FT                   /locus_tag="Nmul_A0180"
FT   CDS_pept        190904..192274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0180"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73488"
FT                   /db_xref="GOA:Q2YCN3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCN3"
FT                   /protein_id="ABB73488.1"
FT                   /translation="MLDIHLLRTQLDHVARLLAERNYVFPLAEFSALEAERKNLQTSTQ
FT                   ELQARRNGASKQIGNAKSRGEDASAILAEVAHLGDELKQAESRLDQVQAALQHILLQIP
FT                   NLPHSSVPEGRSESDNREVRRWGTPPTFDFSPADHVSIGERLGLLDFPTAAKISGARFS
FT                   LLTGSLAHLHRALAQFMLDVHVREHGYTETYVPYLVNAESLRGTGQLPKFKEDLFEVPR
FT                   RKTAEPFLENQPVAATLPSNSNSPQGGQDDDDLYLIPTSEVPLSNIVRDRIVDPELLPI
FT                   KLTAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQIVHPAHSYKALEELTGHAEAILQ
FT                   KLKLPYRVMALCTADMGFAAAKTYDIEVWLPQQGTYREISSCSNCEAFQARRMQARFRN
FT                   EKGKPELLHTLNGSGLAVGRTLVAILENFQNADGSVSIPKVLQGYMGGTERLVPHNA"
FT   gene            192328..193038
FT                   /locus_tag="Nmul_A0181"
FT   CDS_pept        192328..193038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73489"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN2"
FT                   /protein_id="ABB73489.1"
FT                   /translation="MQNVPGSENVHAAIEDTSTLEAEVRSRMTQGENIEQEVRDLTVKA
FT                   LSRQGHDQDSLRHVMGAVLKGVREGAQQKLQSSSIQAQTTLSPVRDAVAGLDSALAQLA
FT                   AASKLTLEEAAGRAQTFSKEELTRLRANLESIENLFFETLQESASAAQDLVEVTLRDII
FT                   LHAKRNGTAVGSQLKDALEALNHQLKSTTYSQLEAGIHLTQAITDTLRQAAANVLTEVA
FT                   ERVKPSDKTRGHHG"
FT   gene            complement(193159..193728)
FT                   /locus_tag="Nmul_A0182"
FT   CDS_pept        complement(193159..193728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73490"
FT                   /db_xref="GOA:Q2YCN1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN1"
FT                   /protein_id="ABB73490.1"
FT                   /translation="MAETSTNIRASMAPELQTSGWLNTPHPLTLASLRGKVVVLHTFQI
FT                   FCPGCVQMGIPQAQRIHQEFDPNRVAVIGLHTVFEHHEVMGREALEVFAYEYRLRFPIG
FT                   IDKYEGTAKGVPMTMRAYQMQGTPTLILIDKTGHIRLHKFGHVSDLTVGFSIGALLAEE
FT                   FDESAVMESSANGGENPACDTEGCKI"
FT   gene            194765..195898
FT                   /locus_tag="Nmul_A0183"
FT   CDS_pept        194765..195898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0183"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73491"
FT                   /db_xref="GOA:Q2YCN0"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCN0"
FT                   /protein_id="ABB73491.1"
FT                   /translation="MSSKAAAGVAGIVAVAWNSGLALAAADPYQLNLPEPQTVIAQQIY
FT                   DQHTLVLWICLAIFVGVFGVMFYSVIQHRKSKGYKAANFHHSTTVEIIWTAIPFLILIG
FT                   MAFPATKTVIAMKDTSNPDITVKATGYQWKWGYDYLTGEGEGIGFLSALATPKAQIENA
FT                   APKGENYLLEVDKPLVVPTGKKVRVLITANDVLHAWWVPALGVKQDAIPGFIRDVWFNI
FT                   EKPGTYRGQCAELCGKEHGFMPIVVEAVEPEKYAAWVAEQKTKLAAVAVDVNKEFGLDE
FT                   LKAKGEAVYNANCAACHQANGQGVPGTFPAIAGSKVATGPKDGHINIVMNGKSGTAMAP
FT                   FKHLSDVDIASVITYQRNSFGNSTGDAVQPSEINQHR"
FT   sig_peptide     194765..194839
FT                   /locus_tag="Nmul_A0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            195918..197498
FT                   /locus_tag="Nmul_A0184"
FT   CDS_pept        195918..197498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0184"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73492"
FT                   /db_xref="GOA:Q2YCM9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM9"
FT                   /protein_id="ABB73492.1"
FT                   /translation="MAAVHDHDVAHAHDHHPTGLMRWLTTTNHKDIGTLYLWFSFIMFL
FT                   TGGVMALTIRAELFQPGIQIVNPEFFNQLTSLHGLVMVFGAIMPAFVGFANWQIPMMIG
FT                   APDMAFARMNNWSFWLLPPAALLLLSSFFVPGGATAGGWTFYPPLSVQMGIGTDMMIFA
FT                   IHILGASSIMGSINIITTILNMRAPGMTLMKMPMFVWTWLITAYLLVLVMPVLAGAVTM
FT                   LLTDRNFGTNFFNAAGGGDPVMFQHIFWFFGHPEVYIMILPAFGIVSEIIPTFARKPLF
FT                   GYSSMVYATASIAILSCIVWAHHMFTAGMPVTGQLFFMYATMLIAVPTGVKVFNWTATM
FT                   WRGSMTFETPMLFAVGFIFLFTLGGFSGVVCAVVPIDIQVQDTYYVIAHFHYVLVSGAL
FT                   FALFGGAYYWLPKWTGHMYDETLGKWHFWLSMFFFNLTFFVQHFLGLAGMPRRIPDYAL
FT                   QFADFNMISSIGAFGFGLSQLLFLYVVLKCIRGGAKASSEVWEGGKTLEWTLPSPAPYH
FT                   TFETPPVIR"
FT   gene            197618..198175
FT                   /locus_tag="Nmul_A0185"
FT   CDS_pept        197618..198175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0185"
FT                   /product="Cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73493"
FT                   /db_xref="GOA:Q2YCM8"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM8"
FT                   /protein_id="ABB73493.1"
FT                   /translation="MNVTEANSVVLRKLLIFTVIMFGFGFALVPFYEKICEVTGINNLL
FT                   QADTLAENTQVDMARWVTVELDANTRGLPWQFKPLQSSVRVHPGELTQVVYEVRNNSDR
FT                   EISGQAIPSYSPQLLGKHLKKLECFCFSKQVLKPREVRQMPVQFLIEPGLPTDINTVTI
FT                   SYTFFELGNDNTASLDINANQL"
FT   gene            198172..198378
FT                   /locus_tag="Nmul_A0186"
FT   CDS_pept        198172..198378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0186"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73494"
FT                   /db_xref="GOA:Q2YCM7"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM7"
FT                   /protein_id="ABB73494.1"
FT                   /translation="MKDDNKQPPKGTLLQITKAVFWAFFGVRKQTDLDSDASSLTPAQV
FT                   IIGGLIGAALFVMTLVLVVKIVT"
FT   gene            198409..199263
FT                   /locus_tag="Nmul_A0187"
FT   CDS_pept        198409..199263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0187"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73495"
FT                   /db_xref="GOA:Q2YCM6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM6"
FT                   /protein_id="ABB73495.1"
FT                   /translation="MSQQGGGHYYVPAPSTWPITGSIALLFMGFGAALSVNRIPLGYGL
FT                   LATGFAILVYMLFGWFSTVARESESGKFNKQVDKSFRWGMSWFIFTEVMFFGAFFGALY
FT                   YMRMHSVPDLADLDNKILWPDFTAEWPTAGPGITEKFMPMGPWGLPAFNTLLLLTSGVT
FT                   VTWAHWALKLNKRGQLKLGLFLTFALGFLFVGLQAYEYGHAYSEMNLKLTTGAYGASFF
FT                   MLTGFHGFHVTVGSIMLFVIWCRVLKGHFSPENHFGFEGVAWYWHFVDVVWLGLFIFVY
FT                   WLI"
FT   gene            complement(199295..199486)
FT                   /locus_tag="Nmul_A0188"
FT   CDS_pept        complement(199295..199486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0188"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73496"
FT                   /db_xref="GOA:Q2YCM5"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM5"
FT                   /protein_id="ABB73496.1"
FT                   /translation="MKIVIVLLLFLIFASLGSALYYLVKDKGHDTRVVKSLTLRIGLSL
FT                   FLFTLLMLGTYFGVIPLE"
FT   sig_peptide     complement(199412..199486)
FT                   /locus_tag="Nmul_A0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.421 at
FT                   residue 25"
FT   gene            199622..200263
FT                   /locus_tag="Nmul_A0189"
FT   CDS_pept        199622..200263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0189"
FT                   /product="SURF1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73497"
FT                   /db_xref="GOA:Q2YCM4"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM4"
FT                   /protein_id="ABB73497.1"
FT                   /translation="MVQLGNWQLSRAQEKESRQERLDRLSQEPTITLPDHPVKLEDFQY
FT                   RQVEAQGEYVPGYTIYLDNKIYKGIAGYQIVTPLRIGNSEMHVLVNRGWIAATRDRSKL
FT                   PEVTTPGGKILVSGIATTAMQKTLELSPDQVSGRVWENLDLERYRSSTGLKLQPVMILQ
FT                   KDQANDGFVREWPRPDSGSAKNIGYALQWFAMALAVLIIYLVLSVKRERY"
FT   gene            200241..200846
FT                   /locus_tag="Nmul_A0190"
FT   CDS_pept        200241..200846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0190"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73498"
FT                   /db_xref="GOA:Q2YCM3"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM3"
FT                   /protein_id="ABB73498.1"
FT                   /translation="MSNESVTKKNRRTLILLALVLSAPFVASYMLYFWNVRPQTVNYGD
FT                   LIEVRQLKGTGLNDADRTIFRMRDLRGKWVLMSIDSGACDEQCQKKLYYMRQVRTYQNT
FT                   EMDRIERLWLIDDEQKPSPEVLSDYEGMHVILAKNSELLKEVPAVGSQHDHIYLIDPIG
FT                   NLMMRFPKDPDPGKMAKDIKRLLKVSQLEHAMGTDMKH"
FT   sig_peptide     200241..200327
FT                   /locus_tag="Nmul_A0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.956 at
FT                   residue 29"
FT   gene            200970..201866
FT                   /locus_tag="Nmul_A0191"
FT   CDS_pept        200970..201866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0191"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73499"
FT                   /db_xref="GOA:Q2YCM2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCM2"
FT                   /protein_id="ABB73499.1"
FT                   /translation="MATTSIAWQQTASRVQQFYRLTKPRVVSLIVFTAVIGMFLSVPGV
FT                   VPLDTLIFATVGIAFVAGAAAAVNCLVEQKIDAVMARTRGRPLPRGTVTSPETFVFLAL
FT                   VGGAGLLILHQLVNPLTMWLTLGTFVGYAIIYTVILKPMTPQNIVIGGASGAMPPVLGW
FT                   AAVTGEVSADALLLFLIIFAWTPPHFWALALYRKLEYAKVGMPMLPVTHGDKFTRLHVL
FT                   LYTLILIAVTLMPYATQMSGLIYLAGAIVLDVIFLYYAVKIYLNYSDQLARSAFRYSIL
FT                   YLAGLFAVLLVDHYIRF"
FT   gene            201876..202493
FT                   /locus_tag="Nmul_A0192"
FT   CDS_pept        201876..202493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0192"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73500"
FT                   /db_xref="GOA:Q2YCM1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM1"
FT                   /protein_id="ABB73500.1"
FT                   /translation="MRHRPHYYRLVVWIAAALLTAPLLSACSKTEKPAFLSTDITGADF
FT                   GKDFNLTDHNGKMRTLADFKGQVVTVFFGYTHCPDACPATMGNLAAAMDMLGADASRVQ
FT                   VLFITVDPERDRPEVLKAYLSAFNPSFLGLYGDERAIKKTTKEFNVVYQKQQGGAHQHD
FT                   SVDHSTGTYIYDTKGKLRLYVSNDKGADVFAHDISQLLKTSG"
FT   sig_peptide     201876..201956
FT                   /locus_tag="Nmul_A0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.866 at
FT                   residue 27"
FT   gene            complement(202579..204015)
FT                   /locus_tag="Nmul_A0193"
FT   CDS_pept        complement(202579..204015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0193"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73501"
FT                   /db_xref="GOA:Q2YCM0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCM0"
FT                   /protein_id="ABB73501.1"
FT                   /translation="MLKKTSRLSSSASWNDLSFHPSLTLSTTHIARLYKLFPPDRIYTD
FT                   PVDCYAYAYDNTRKVFPPDAVVFPLSALEVQAAVKFGNETGIPLVPRGRGTGTSGGSLP
FT                   ESGGIALSLERMVRVTKIDPANRVLVAEPGVINQTVQDIARRHGFFWPPDPSSAAFSSI
FT                   GGNLATSAGGPRAVKYGTTRDHVLGVKAVTGKGQVIRTGCYTTKGVVGYDLTRLLIGSE
FT                   GTLAVITEATLKLTPLPQALGGVTAYYSDLAGCTDAIVRIMTLPQTPSALEFLDAGSLN
FT                   LIRSRFPGMLPADAHAMLMIEVDGTEHSVAESRNAVLSACGGSGLIQATPTADAATLWR
FT                   ARKTLSPLLRDIAPKKINEDVVVPVSALPEFLLGLTRLSAKHRLSNVNFGHAGNGNIHV
FT                   NLLVNPDSTGEMQRAEMCLNEIFDLVIELNGTLSGEHGVGSEKRAYIGKEIDPVTMELM
FT                   KEIKRVFDPNNILNPGKLFP"
FT   gene            complement(204026..204613)
FT                   /locus_tag="Nmul_A0194"
FT   CDS_pept        complement(204026..204613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0194"
FT                   /product="hypothetical protein"
FT                   /note="Transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73502"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL9"
FT                   /protein_id="ABB73502.1"
FT                   /translation="MQYLDLKSLLLVFFLLPLLSGCGLIAAGGMAAGVGTGIAMSQDRR
FT                   TSGMFVEDESIEFRSGQRISEKFSSNVHVNVTSFNRNVLLTGEAPSETIKEEIGDLVSN
FT                   VENVRHVTNEITVGSPSSFTSRGNDTLITSLVKGHFMDSGRFQANHVKVVTEEGIVYLL
FT                   GLVKGEEAENAEELAKRVDGVKKVVKVFEYME"
FT   sig_peptide     complement(204518..204613)
FT                   /locus_tag="Nmul_A0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.651 at
FT                   residue 32"
FT   gene            complement(204830..205189)
FT                   /locus_tag="Nmul_A0195"
FT   CDS_pept        complement(204830..205189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0195"
FT                   /product="Protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73503"
FT                   /db_xref="GOA:Q2YCL8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCL8"
FT                   /protein_id="ABB73503.1"
FT                   /translation="MTLRLKGNQAERYAEAFLAGHRLVLVQRNYRCRFGEIDLIMRDGE
FT                   TLVFVEVRMRTNRNFGDAGSSITLSKQRKVVRAARHYLLSLRTEPCCRFDAVLLSGNEG
FT                   RDIEWIRNAFDVNYS"
FT   gene            205311..206177
FT                   /locus_tag="Nmul_A0196"
FT   CDS_pept        205311..206177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0196"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73504"
FT                   /db_xref="GOA:Q2YCL7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL7"
FT                   /protein_id="ABB73504.1"
FT                   /translation="MDQSKAIVIPATLYVVATPIGNLRDITLRALDVLAAVDVVAAEDT
FT                   RTTKHLLARYAISKTLFALHRHNESALFAKIAGLLSQGKTVAIVTDAGTPAISDPGGLI
FT                   VRFVREQGFKVVPIPGCNAAACALSVAGISNPHFLFYGFLPTSSGPRRRALANLKPHPY
FT                   SLIFYEAPHRILECIGDMTEVFGRNRRITFARELTKVFETIHGCALGEALAWLEADSDR
FT                   RKGEFVLILSGAEPPKETELSEQARSTLQLLMHELPLKQAVRLTAEISGESKNRLYSLA
FT                   LSLQPHS"
FT   gene            206265..206576
FT                   /locus_tag="Nmul_A0197"
FT   CDS_pept        206265..206576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73505"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL6"
FT                   /protein_id="ABB73505.1"
FT                   /translation="MATVIGGASGGSSPSIFIFLERSTMKTPATFYHAGCPVCVEAEHQ
FT                   IAEALDPDRYEVELVHLGEQKDRIAAAEAAGVKSVPALVINGAPFHINFGAPMSALKS"
FT   gene            206881..207348
FT                   /locus_tag="Nmul_A0198"
FT   CDS_pept        206881..207348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0198"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73506"
FT                   /db_xref="GOA:Q2YCL5"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL5"
FT                   /protein_id="ABB73506.1"
FT                   /translation="MELILWRHAEAEEGVPDSARELTDKGRKQADLVAAWLKPRLPKNT
FT                   RIIVSPTQRTQQTASALSKDFETVGEIGPGVSPKAVLKAAGWPDAKGAVLVVGHQPTLG
FT                   EVAALLMSGDPGQWTIRKGAIWWFAQKKGNHNLGELLLQAVVSPDTLRAGD"
FT   gene            complement(207403..207630)
FT                   /locus_tag="Nmul_A0199"
FT   CDS_pept        complement(207403..207630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73507"
FT                   /db_xref="GOA:Q2YCL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL4"
FT                   /protein_id="ABB73507.1"
FT                   /translation="MALSEVGRPLRLANIIFGAWLIPAPLLLTGYTGLGAVANVTAGVL
FT                   LILLALPVGPIRSHYGAWDRWNSIGAVRRN"
FT   gene            complement(207827..208342)
FT                   /locus_tag="Nmul_A0200"
FT   CDS_pept        complement(207827..208342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0200"
FT                   /product="PRC-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73508"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL3"
FT                   /protein_id="ABB73508.1"
FT                   /translation="MAYTDRDTYGMYKNYGKEGKGPGPRLMGADTLIGEDVYNTRDEDL
FT                   GDIKEIMLDMNNGKIAYAVLSFGGLMGMGDKLFAVPWGALTLDTENKRFILDVDKERLD
FT                   SAPGFDKDDWPDMADTSWQNTINSYYGTKTYTESSRTKQPTDTPDTPYEQTPYTTIQSS
FT                   GMDSGRVK"
FT   gene            208738..210636
FT                   /locus_tag="Nmul_A0201"
FT   CDS_pept        208738..210636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0201"
FT                   /product="potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73509"
FT                   /db_xref="GOA:Q2YCL2"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCL2"
FT                   /protein_id="ABB73509.1"
FT                   /translation="MTNQQMPSGHSLERQPLSLLCLAALGVVYGDIGTSPLYVMKTVFD
FT                   PIHGLAVTESNVIGIISLIFWTIMIVVSLKYVTLILRADNHGEGGIMALLSLASSSVTD
FT                   RPRLHNILFLIGAFGAALFFGDGVITPAISVLSAVEGLEVATPLLQPYVLPITVVVLIA
FT                   LFMLQQRGTGGIGALFGPVMVIWFVSLGLVGLINIAGAPQIVAAFNPMYAFAFCISNGW
FT                   LAFIALGAVVLAVTGGEALYADMGHFGAKPIRLAWYGGVLPALTLNYLGQGALLLANPA
FT                   AISNPFFLLFPSWALYGAVGLATAATVIASQSVISGVFSVTRQAIQLGFLPRMQIRHTS
FT                   ERKIGQIYIPFVNWTLLSVVLMAVLGFGSSSNLASAYGVAVTTTMVIETTLTFFVLRYV
FT                   WNYPFLLGILVTAFFLAIDSAFFSATILKVAQGGWFPLVIGSVIFFIMITWSRGRQMLV
FT                   DHLRSVAIPLQSFLESLIAHPPTRVAGTSVFLTANPDGVPHALLHNLAHNQVLHERVVF
FT                   LTVTYQETPWVPVEQRISIKPLMENCYQITVRYGFKDEANLPYALELCEPHGLVFEPLR
FT                   TSYFLSREIVVPSPGTGMSLWRERLFAAMVRNASNAAEYFKLPANRVLELGARVEI"
FT   gene            210885..214049
FT                   /locus_tag="Nmul_A0202"
FT   CDS_pept        210885..214049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0202"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and Chase sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73510"
FT                   /db_xref="GOA:Q2YCL1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL1"
FT                   /protein_id="ABB73510.1"
FT                   /translation="MDTEIHNPHIPGGRPPSRPAIAALTFVIFMSLTLASWSVVQDLQE
FT                   RHENTRFDKRVAEVIHKIEHHFSGYEQVLKGALGHLLASPSVSRNEWRTYVNALRINDR
FT                   YPGIHGIGFAKYIPRSGLAAHTEEVRAEGFPSYKVWPGTPRQEYTSIIYLEPFTGSNLR
FT                   AFGYDMFSNAVRRAAMSRARDTGEVALTRKVKLVQETGEDIQAGVLMYLPYYGAANLPK
FT                   TVEERRASLGGYVYAPFRMVDFVRATLGSELDILDLRIFDGKAMAEDSLLFDSVKHRSG
FT                   PSPVPKFKRVIPISLYGQTWALEASSRPAFEKAIKNYEALLVLLGGFVVSMLTAMVSFV
FT                   LSGNKEKAAALGHVNKKLLLAMEEQQATTRELSNAKLRTERILESITDAFYTLDREWRF
FT                   TYVNKEAENLLQRNREDLLGRVCWEEFKETAGTTFDREYHRALMENRTVTFEEFYVPLD
FT                   EWFEVHAYPSEEGLTVYFRDITERKESEQARQEAHVRIRQQASLLDKATDAIIVFGMDN
FT                   CIEFWNQGAERLYGWTSEEVMGREVEMLYDNVAVFDEANRALLSSGEWRGELAQRRRDQ
FT                   SMLNVEAHWTLVRNDDGEPQAIFAINTDITQRKSAENEILHLALYDSLTGLPNRRLLLD
FT                   RLGHALAVSARNQRMGALLFIDLDNFKLLNDTLGHDMGDLLLRQVAPRLSSCVRESDTV
FT                   ARLGGDEFVVILMGDFGEDHDEALTQISTICERIRSAFIQPFNLDPYIHHITPSIGIAL
FT                   FNDQSQTTNELLKRADLAMYQAKASGRNAMRFFDPDMQAAMNARAILESELYKSWERNE
FT                   FILHYQLQVDSRGIIGAEALVRWQHPRRGLLPPSEFIPQAEETGLILPLGEWVLETACN
FT                   QLASWALQPETVQLNLSVNVSSLQFCQPDFVEQVISILDRTGANPQRLKLELTESILVH
FT                   DMDDTIAKMMTLKARGVGFALDDFGIGYSSLYYLKRLPLDWVKIDRSFVRDVLTDNNDA
FT                   TIVRTILLLAKSMGLAVIAEGVETGAQKDFLASHGCTAYQGYLFSRPLPLEQFERFVQP
FT                   AAGGAV"
FT   gene            214241..215470
FT                   /locus_tag="Nmul_A0203"
FT   CDS_pept        214241..215470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0203"
FT                   /product="Exodeoxyribonuclease I subunit D"
FT                   /EC_number="3.1.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73511"
FT                   /db_xref="GOA:Q2YCL0"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCL0"
FT                   /protein_id="ABB73511.1"
FT                   /translation="MKLFHTSDWHIGRTLYGRKRYEEFEAFLTWLAETIQRNEIDVLLV
FT                   AGDIFDTSAPSNRAQELYYRFLWKIAASPCRHVVIVAGNHDSPSFLNAPRALLKALDVH
FT                   VIGSPSASLEDEVLVLRNEQGVPELIVCAVPYLRDKDIRVAEAGESVEDKERKLLVGIR
FT                   DHYAAIAALAEQKRVELGVDIPIVATGHLFAAGGQTIEGDGVRDLYVGSLAQVSAGIFP
FT                   ECFNYLALGHLHVPQKVNGSEIMRYSGSPLPMGFGEARQQKSVCQVEFHSTAASVQLID
FT                   VPVFQKLERIKGDWDSISTQIRKLSETGSQAWLEVIYEGEEVIGDLRERLEIAITDTQM
FT                   EILRVKNNPVIDRVLGKIHEEETLDDLSVNDVFERCLTVHEVPEDQRPELLRAYQEALS
FT                   SLYEDDMQAE"
FT   gene            215482..218748
FT                   /locus_tag="Nmul_A0204"
FT   CDS_pept        215482..218748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0204"
FT                   /product="ATP-dependent dsDNA exonuclease (SbcC)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73512"
FT                   /db_xref="GOA:Q2YCK9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCK9"
FT                   /protein_id="ABB73512.1"
FT                   /translation="MKILQVRFKNLNSLMGEWEIDLTHPAFTSDGIFAITGPTGAGKTT
FT                   ILDAICLALYGRTPRLSKVTKSGNEIMSRQIGECFAEVTFETQAGRFRCHWSQHRARKK
FT                   PDGELQAPKHEIAHADSGKIFESKIKGVADRIEAATGMDFDQFTRSMLLAQGGFAAFLQ
FT                   ALPDERAPILEQITGTEIYSKISIRVHERQREEREKLNLLQAETAGIVILEQEQEKDIQ
FT                   QELELKQKEESALTRKLMDTDKAITWLKAVDGLRREIEDLTAEASKLQADIDIFKPERD
FT                   KLSRAIQAASLEGSYATLTAIRTQHADEQKAVKTEEAVLPQLASSAKEQAESLKLAEQQ
FT                   STRAKAELEAALPLIRKVRSLDQTLADQKKAISKDEDSCRKDTKQIDADREVKLKEQVK
FT                   RADAEKNLKVAEDYLKENARDEWLISGLAGVEEQLENLLSRQKEIAKKEVDKEKAVTAL
FT                   EQATRKLAACRKQCEARKQELENVSKNLQQGKDKLNQLLGDRLLREYRAEKETLLREMV
FT                   FLKKIAELEDHRARLEDGKPCPLCGATEHPFAEGNVPIPDEIERKIGALTELISKAEDH
FT                   ETAIRHFEEDEGTARKNLMDGEKQEITAVNDKKTAGQVLAGLQEYLEKLQTDITGLKQT
FT                   VSAKLQPLGIEEILDSNVSALLESLRERVKAWQIQIKRKTDIEKQIGDFDSELKRLDAV
FT                   IETQSNALNEKRECLQSLKEDCAAGCKERKELYGDKDPDDEERRLNKSISVSEEAERKA
FT                   RVLHHDLQQKLNAAKTQIESLKKRIGQRDPELKELEAGFTEALGLAGFSGEKQFLEARL
FT                   PIGQRDALSARAKNLDGHQIDLKARQKDREARLATEAARKITDKSLEELEPQFKDSEES
FT                   LKQLRDTTIRLKHKLNENAAAKERLEAKQTAIGAQKIECRRWENLHELIGSADGKKYRN
FT                   FAQGLTFEMMIGHANRQLQKMTDRYLLVRDDTEPLELNVVDNYQAGEIRSTKNLSGGES
FT                   FIVSLSLALGLSHMASKNVRVDSLFLDEGFGTLDEEALDTALETLASLQQEGKLIGVIS
FT                   HVPMLKERISTQILVIPQTGGRSEISGPGCRRNITGQISI"
FT   gene            complement(218904..218980)
FT                   /locus_tag="Nmul_AR0005"
FT   tRNA            complement(218904..218980)
FT                   /locus_tag="Nmul_AR0005"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg4"
FT   gene            219119..219676
FT                   /locus_tag="Nmul_A0205"
FT   CDS_pept        219119..219676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0205"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73513"
FT                   /db_xref="GOA:Q2YCK8"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCK8"
FT                   /protein_id="ABB73513.1"
FT                   /translation="MSDVEDEGHSTPIQTPGQLIVVVLAAFIVPVVVLSLIGRFAIGES
FT                   SMDPSSPAFSEEAVARRLHPVGKLVIAGDSTQSAAQTGEGTVVAAAPPATASAAPAAED
FT                   PAEKAKKIYTASCSACHATGAAGAPKVGDNAAWAPRIKAGTETLYTSALKGKNAMPPKG
FT                   GNAGLSDDDVKAVVDYMVSQSK"
FT   gene            219806..220633
FT                   /locus_tag="Nmul_A0206"
FT   CDS_pept        219806..220633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0206"
FT                   /product="Bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73514"
FT                   /db_xref="GOA:Q2YCK7"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCK7"
FT                   /protein_id="ABB73514.1"
FT                   /translation="MAIYAVGDLQGCYREFRELLDLVRFDETKDKLWLVGDLVNRGPDS
FT                   LSVLRFVKELNDSAIMVLGNHDLHLLLVAEGCAELSRSDTLQNILDAPDRDELLDWLRR
FT                   QKLLHVDGNYVMVHAGLLPSWSIEQAQVLAALVESALRGSEFHEFCRQMYGNRPDHWNE
FT                   TLHGYERLRVIVNAMTRMRVCTPHGRMDFAHKGSVKDIPPGYLPWFDVPERASRKATVI
FT                   CGHWSALGLEIRANLMALDTGCLWGGSLTAVRLEDRKVFQTECGAGGATRHWQ"
FT   gene            complement(220554..221231)
FT                   /locus_tag="Nmul_A0207"
FT   CDS_pept        complement(220554..221231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0207"
FT                   /product="lyso-ornithine lipid acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73515"
FT                   /db_xref="GOA:Q2YCK6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCK6"
FT                   /protein_id="ABB73515.1"
FT                   /translation="MAQKWSVRLLSILGVRVRHQGILPAAGTQRVMLAANHVSWLDVYS
FT                   IISVCPARFVAKSEIRGWPLFGWLSNNVGTLFIERTKRRDTARINDHISEALNNGDRVA
FT                   VFPEGGTSDGTVLHHFHASLLQPAVTVSAMLHPVAIRYTDTAGNISKAAAYFRISLLES
FT                   VRQVLSQPHIDVELVFTEAIDSHGKNRRELARSAEHAIANALSLPLPHTPSGKPSDPPD
FT                   EQP"
FT   gene            complement(221481..221939)
FT                   /locus_tag="Nmul_A0208"
FT   CDS_pept        complement(221481..221939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0208"
FT                   /product="Rickettsia 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCK5"
FT                   /protein_id="ABB73516.1"
FT                   /translation="MKQHILAITFLCSGALLLNGCVAGQGGGDYARGEARQEQSVRTGV
FT                   IESVREVRLEGTRSGIGTVAGGVAGGIGGAQIAHGWLGALGALAGAVGGGLLGQVAEEG
FT                   VTGRKGVEITVRLDNGSLVAITQAADEEFRPGDRVRILSGGGVSRVTH"
FT   sig_peptide     complement(221865..221939)
FT                   /locus_tag="Nmul_A0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.469 at
FT                   residue 25"
FT   gene            complement(221952..222887)
FT                   /locus_tag="Nmul_A0209"
FT   CDS_pept        complement(221952..222887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0209"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73517"
FT                   /db_xref="GOA:Q2YCK4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCK4"
FT                   /protein_id="ABB73517.1"
FT                   /translation="MHTLICGSIAYDTIMVFGDHFRNHILPEKIHILNVAFLVPDMRRE
FT                   FGGCAGNIAYNLQMMGGSPLIMATVGDDYEPYAKRLSDLNLVQTHIRHIQGSFTAQAFI
FT                   TTDLADNQITAFHPGAMNSSHENHIAAAENVSLGIVAPDGRDGMLQHAREFHEAGIPFM
FT                   FDPGQGLPMFNGEELLDFIRKADYVAANDYEAQLLQERTGLTLEALAKLVKGLIVTKGA
FT                   QGSTVYADGQQIEIPCVKPDRVADPTGCGDAYRAGLLYGIAKGMDWQSAGRLGSLMGAL
FT                   KIGQRGGQNHRFSRDEIDQRYYEVFGNRIL"
FT   gene            complement(222914..224416)
FT                   /locus_tag="Nmul_A0210"
FT   CDS_pept        complement(222914..224416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0210"
FT                   /product="glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73518"
FT                   /db_xref="GOA:Q2YCK3"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCK3"
FT                   /protein_id="ABB73518.1"
FT                   /translation="MLIFEHSRPGRRNYSQSPKAAEATDIPEKLLRKTLPLLPEVSEMD
FT                   AVRHYTRLSQKNFSIDTHFYPLGSCTMKYNPRACNSLAMLPQFLARHPRSPESTGQGFL
FT                   ACMYELQEILKDVTGMAGVSLTPMAGAQGELIGIAMIRAYHESRGDTARTEIIVPDAAH
FT                   GTNPATAVMCGYKVVEIATDKEGNVDMAALKAAVGPKTAGLMLTNPSTLGVFEENVAEM
FT                   SRIVHQAGGLLYYDGANLNAILGKVKPGDMGFDVIHINLHKTFSTPHGGGGPGSAPVGV
FT                   APRLLPFMPVPIVAFENGTYRWQTEKDIPQSIGRLSAHMGNAGVLLRAYVYVRLLGAEG
FT                   MHRVAEFAALNANYLMAELRKAGFEIAYPNRRASHEFIVTLKDLKEKTGVTAMNLAKRL
FT                   LDKGYHAPTTYFPLLVPECLLIEPAETESKETLDAFVTAMKEILEETRTQPDLVKSAPH
FT                   TTPVRRLDDVKAARELDLAWKAPTRNITRTETLTPIPTVSVA"
FT   gene            complement(224579..225076)
FT                   /locus_tag="Nmul_A0211"
FT   CDS_pept        complement(224579..225076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0211"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73519"
FT                   /db_xref="GOA:Q2YCK2"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCK2"
FT                   /protein_id="ABB73519.1"
FT                   /translation="MVTLAGNPIKVEGTFPKVGDKAPDFSLVNRDLKDVTLADFAGKKK
FT                   VLNIVPSLDTPVCAMSTRKFNEQASNMENTVVLIIAADLPFAMSRFCDMEGLDKVVPLS
FT                   TMRGAEFMKNYGVAITDSPLAGITARAVVVLDENDKVTHAQLVPEIKEEPDYEAALKAL
FT                   ES"
FT   gene            complement(225133..226491)
FT                   /locus_tag="Nmul_A0212"
FT   CDS_pept        complement(225133..226491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0212"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73520"
FT                   /db_xref="GOA:Q2YCK1"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCK1"
FT                   /protein_id="ABB73520.1"
FT                   /translation="MPFIPHTEEDIQAMLASIGANSIDELFDEIPPALKTGSLKRVPPG
FT                   LSEMEISRLMLERAEQDGRYLNFIGAGAYEHHIPAAVWQIATRGEFYSSYTPYQAEASQ
FT                   GTLQLLYEYQTMMASLTGMDVSNASMYDGASALAEAALMAVRSHRTSRRILIPQTVHPV
FT                   YRSVVRAIVKNQGIEVVEVPYDKLSGQTSLDGLKNFGSEEFAALVIPQPNFFGVLEDVD
FT                   TLTDWAQSRDAFAIAVVNPMALAMLTPPGEWGEKGADIAVGEGQPLGIPLSSGGPYFGF
FT                   MACKQPLVRQMPGRIIGRTTDQEGSDGFVLTLQAREQHIRRSKATSNICTNQGLMVTAA
FT                   TIYLALLGPEGLRRTAAQSHANTAALLEKLEKLKGVKRVFSGPVFHEAVISLPRPSASV
FT                   LQALEARRILGGLNLKEYYPELGDAVLVCATETKTSGDMENYVTQLGEVIRNS"
FT   gene            complement(226582..226971)
FT                   /locus_tag="Nmul_A0213"
FT   CDS_pept        complement(226582..226971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0213"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73521"
FT                   /db_xref="GOA:Q2YCK0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCK0"
FT                   /protein_id="ABB73521.1"
FT                   /translation="MSIPNDLKYTKSHEWVRLEDDGTATIGITQHAQELLGDMVFVETP
FT                   AVGRQLKQGDECAVVESVKAAADVYAPITGEVTAANPELASAPEKINQDAYAAWLFRLK
FT                   PANTADLEKLLDSAGYQKLLESEDH"
FT   gene            complement(227013..228095)
FT                   /locus_tag="Nmul_A0214"
FT   CDS_pept        complement(227013..228095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0214"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73522"
FT                   /db_xref="GOA:Q2YCJ9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ9"
FT                   /protein_id="ABB73522.1"
FT                   /translation="MKTTPLNQTHRDMNAKMVDFGGWDMPLHYGSQLDEHHKVRSDAGM
FT                   FDVSHMLAVDIEGESARAFLRQLVANNIDKLTQLGKALYSCMLNPDGGVIDDLIIYFLT
FT                   ESHFRMVVNAGTADKDMAWMLSQRDRIAPGLEITPRRDLAMIAVQGPNARAKVWQVLPG
FT                   SQTDTENLKLFQAAFFDKYFIARTGYTGEDGFEITLPAADATNFWNKLHAAGVAPAGLG
FT                   ARDTLRLEAGMNLYGQDMDETINPLEAGLGWTVDLKSDRDFIGKQALLDRPVTQQLTGL
FT                   VLLDRGVLRSHQKVVTQNDGGEGEITSGGFSPTLNQSIALARLPLDVSPGDEVQVVVRD
FT                   KRLKAKVVKYPFVRNGKILV"
FT   gene            228637..230349
FT                   /locus_tag="Nmul_A0215"
FT   CDS_pept        228637..230349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0215"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73523"
FT                   /db_xref="GOA:Q2YCJ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ8"
FT                   /protein_id="ABB73523.1"
FT                   /translation="MYLDHFGLSRQPFSQSPAIDRNCFYEGGGRGATLDALIYVLTHGE
FT                   GEEGMITLTGESGSGKTVLCQALIKWLSDSMRVIYSAKKNPSQEALLNSIMDELKFQSE
FT                   KEGLLLPPSPTDGDELQEILAAVQAGDRQVVLLIDEAHTLPAETLEALGLLYERASSHH
FT                   KLLQIVLVGEPGLERTLASQQLTKIRKAIRHQYVLQLLDREAAREYLLYRMSTIAGYEG
FT                   PDIFSPAALRLIDVAAGGLLRQLNVIADKSLMAAFLAQASSVEAVHVRKVITDLGLKPP
FT                   LDWRDKRNRPNFVGHLIAGAGATSCAAVVIVLGVAGWQASHPQPAGIGNTSASLPFEAA
FT                   APSTLSAPTVTISPTTIATTRSNVLANTPSSSSISAATSLPSSGSNKESGGKMTSASTT
FT                   PGKIATDKAGTDKANKETAARIGTDKTLPGSGKAAATGAAPQSGLAAEGQPAGDAANTI
FT                   AGVDLAGYRLLKQRVEATLGAFSKADRNLYTIVLYTTSNAQPDRIERFLARARALVELS
FT                   NVYVYPLSRNRSGFIVTYGLYPDEYEASMAVAGLPEKYQTAFDPELRTLGELK"
FT   gene            230469..231764
FT                   /locus_tag="Nmul_A0216"
FT   CDS_pept        230469..231764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0216"
FT                   /product="Glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73524"
FT                   /db_xref="GOA:Q2YCJ7"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ7"
FT                   /protein_id="ABB73524.1"
FT                   /translation="MPTPHLDTALSGPILDLERCILNAMPSIEQWLRNEWQTHAAPFYC
FT                   SVDLRNSGFKLAPVDTNLFPGGFNNLNREFMPLCVQAMMAAIDKICTGARSVLLIPESH
FT                   TRNIFYLQNLAALHAIMRHAGIHVRIGTLLPEITAPTALDLPGGNKLTLEPIQRKGNRV
FT                   VLEDFDPCVVLLNNDLSTGTPAVLQNLEQTVIPPLHAGWTSRRKSHHFTAYDNVSQQFA
FT                   SLIGIDPWLINPYFASCGKINFREKKGEDCVANTVDEILHQIREKYAEYGVRKDPFVIV
FT                   KADAGTYGMGIMTVKDGAQVRTLSRKQRNKMAVVKEGLEVTDIMVQEGVYTFENVDDAV
FT                   AEPVIYMIDRYVVGGFYRVHTERGVDENLNAPGMHFVPLAFEDTCLLPDREAQPGCSAN
FT                   RFYAYGVIARLALLAAAQELEKSEARIEAIMA"
FT   gene            232027..232977
FT                   /locus_tag="Nmul_A0217"
FT   CDS_pept        232027..232977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0217"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73525"
FT                   /db_xref="GOA:Q2YCJ6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ6"
FT                   /protein_id="ABB73525.1"
FT                   /translation="MRFAFVLDHLDSIKTRKDSSVAIMREAAARGHTLFSMQQGDLAWQ
FT                   RGNTVGFARPLELTGEDSQGRLWYRVDEPEEIPLQEFDAVLMRKDPPFDMEYIYSTYLL
FT                   ELAETRGAHVINSARAIRDHNEKLAVAKFSEYAVETLVTRSESLLRHFLAEHDDIILKP
FT                   LDGMGGASVFRVHREDHNIGVIIETLTHYGTKTIMAQRYIHEITDGDKRILLIAGEPVP
FT                   YTLARIPKPGEFRGNLNVGATGIAQPLSPRDREIAEALGPVLFNEGLMLVGLDVIGDYL
FT                   TEINVTSPTGMREISDQTGFNVAAMMVDALEMMPR"
FT   gene            233018..233410
FT                   /locus_tag="Nmul_A0218"
FT   CDS_pept        233018..233410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0218"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73526"
FT                   /db_xref="GOA:Q2YCJ5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ5"
FT                   /protein_id="ABB73526.1"
FT                   /translation="MIGILIISHGNLGESLVESANHVMGKKLPNLAHIGIHPEDDPDVI
FT                   LSKAVGSIRELDSGEGVLVLSDICGATPCNIATRLVASTERVICLAGVNLPMLVRALTY
FT                   RAEPLEGVAEKALAGGRDGVFRINPS"
FT   gene            233414..233683
FT                   /locus_tag="Nmul_A0219"
FT   CDS_pept        233414..233683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0219"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73527"
FT                   /db_xref="GOA:Q2YCJ4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ4"
FT                   /protein_id="ABB73527.1"
FT                   /translation="MQYKEIKILNKLGMHARASAKFTQLASRYRSDVWLSRNDRKVNAK
FT                   SIMGVMMLAANQGATLIIETAGEDEIEAMQALVQLIEDRFGESE"
FT   gene            233680..235407
FT                   /locus_tag="Nmul_A0220"
FT   CDS_pept        233680..235407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0220"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73528"
FT                   /db_xref="GOA:Q2YCJ3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ3"
FT                   /protein_id="ABB73528.1"
FT                   /translation="MSFVLHGVGVSEGIAIGHAHLASHAALEVAHHVVPEDQVTNEISR
FT                   LDTAFTTVRKELQALHDTVVSGPAAAEYEAFLDLHRMILDDPTLSTAAKAYIAQNQCNA
FT                   EWAITQQMGVLMAQFEEIEDPYLRERKTDVIQVVERVLKVLLGHPGYIPPSQKRDGDSV
FT                   LVAHDLSPADVLQYKQYSFTAFLTDLGGLTSHTAIVARSLNIPSVVALHHARRLIREND
FT                   ILIVDGNQGVVIVDPDEHVLAEYRLRQSELELEKQKLKRLRTTVAATLDGTVVELYANI
FT                   ELPQDVDQVKENGATGVGLFRSEFLFLNRDSLPDEEEQFEAYRTVARKMRGMPVTVRTF
FT                   DLGADKNLDHAKRVAANPALGLRAIRLSLAEPQMFNIQLRAILRASRYGQIRILVPMLS
FT                   NVAEITQTLHLIQSAKQSLRNEKIPFDEKVQVGGMIEIPAAALSLDIFMRKLDFLSIGT
FT                   NDLIQYTLAIDRADDTVAHLYDSLHPAVLRLVAHVIRSANRASIPVSVCGEIAGDVVFT
FT                   RLLLGFGLRVFSMHPVQLLTVKREVLRANLPDLIPITQKILKTADPEKIHALLAKLNA"
FT   gene            235602..236735
FT                   /locus_tag="Nmul_A0221"
FT   CDS_pept        235602..236735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0221"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73529"
FT                   /db_xref="GOA:Q2YCJ2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCJ2"
FT                   /protein_id="ABB73529.1"
FT                   /translation="MLMQDSNSFSTVTPQVARFDTPLHLKSGAVLDSYELVYETYGELN
FT                   AARSNAVLVCHALSGNHHLAGLYDDNPKSAGWWNNMIGPGKSIDTQKFFLIGVNNLGGC
FT                   HGSTGPASIDVRTGKCYGPNFPVVTVEDWVQTQVRLADYLGIDQFAAVAGGSLGGMQAL
FT                   QWTLDFPERVRHALVIAAAAKLTAQNIAFNDVARQAIITDPDFHGGDYYSHGVIPRRGL
FT                   RLARMLGHITYLSDDSMAAKFGRELRNGALAFGYDVEFEIESYLRYQGDKFASQFDANT
FT                   YLLMTKALDYFDPAFPHNNDLSAAFRFARANFLVLSFTTDWRFSPERSRAIVRALLDNE
FT                   LNVSYAEITSSHGHDSFLMEDRHYHRLVRAYMDNVVV"
FT   gene            236732..237352
FT                   /locus_tag="Nmul_A0222"
FT   CDS_pept        236732..237352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0222"
FT                   /product="Methionine biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73530"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ1"
FT                   /protein_id="ABB73530.1"
FT                   /translation="MKKSLGMNSSLNAARPDFALIAAWVKPGAKVLDLGCGDGSLIRFL
FT                   RDSRGSRGYGVEIDDANVLACFNNGVNVIQSDLESGLQSFESGSFDYVVLSQTLQAVKN
FT                   TENIIKEMLRVSKEGIVSFPNFGYWKNRLQVLSGHMPVSEALPYQWFDTPNIHNCTLGD
FT                   FEEFCGQHGARILERRVMSGNRQITFMPNLLGMLAFYRFEQQK"
FT   gene            complement(237385..238770)
FT                   /locus_tag="Nmul_A0223"
FT   CDS_pept        complement(237385..238770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0223"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73531"
FT                   /db_xref="GOA:Q2YCJ0"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCJ0"
FT                   /protein_id="ABB73531.1"
FT                   /translation="MMPATLSSWLHAFRIYTHPRVLGMLSLGFSAGLPLLLVMGTLSFW
FT                   LREAGIDRSTIGHLSWIGLAYGFKWMWSPLVDRLPLPLLTQWLGRRRAWLLLSQIVIAL
FT                   ALIGIALTDPLRNLSHTVFFALAAAFASATQDIALDAYRIEAVAPRLQGAMAATYQAGY
FT                   RLAMILASAGALWIAAAAGSSADIYDYATWRIAYLSMAACMSVGIITTLIIREPEVPFT
FT                   RLISENEDRARAAIAHWRISAALKQMLAWLYGAVIAPFRDFIVRYGGQALLILALIAVY
FT                   RISDVVMGVMSNPFYVDMGYTKDEVATVSKVYGVLMTIAGAALGGVLTAKIGIMRTLFL
FT                   GAILSATTNLLFVWLAARGHDLTGLIFTVSADNLSAGIASSAFIAYLSGLTNSAYSATQ
FT                   YALFSSVMLLLPKFIAGFSGDFVDAYGYASFFTGTALLGLPVLVLVWLAGRARFKRAES
FT                   PEN"
FT   gene            complement(238833..239612)
FT                   /locus_tag="Nmul_A0224"
FT   CDS_pept        complement(238833..239612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0224"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73532"
FT                   /db_xref="GOA:Q2YCI9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI9"
FT                   /protein_id="ABB73532.1"
FT                   /translation="MRIITLNLNGIRSAANKGFFRWLPLQDADIVCVQELKAQVGDITG
FT                   EVVSPDGYHGYFHCAEKRGYSGVGIYTRQKPGGVTEGLGVPEIDAEGRYLRVDFGQLSI
FT                   ISIYFPSGSAGEHRQAVKYFFMEQFFPMLEKLAACGSEIILCGDWNIAHKEIDLRNWRS
FT                   NQKNSGFLPQERAWLTDVFQELGFVDVFRRINPEPDQYTWWSNRGQAWAKNVGWRIDYQ
FT                   IATPGIAGKANAVSIYKTERFSDHSPLIIDYDYSLSA"
FT   gene            239636..240322
FT                   /locus_tag="Nmul_A0225"
FT   CDS_pept        239636..240322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0225"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73533"
FT                   /db_xref="GOA:Q2YCI8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCI8"
FT                   /protein_id="ABB73533.1"
FT                   /translation="MSDFRKEFIEFAIGRNVLCFGEFQTKAGRISPYFFNAGLFNDGES
FT                   LGKLGQFYAKAILAAQLPFDMLFGPAYKGIPLVSSIAIALADGGNNYPFCFNRKEAKDH
FT                   GEGGNLVGAPLAGRVLIVDDVISAGTSVRESVEYIHAAGATPAGVAIALDRMERGKGEL
FT                   SAVQEVRCMYGIPVTSIVNLENIVDYLREQGNLAHHLPAVEEYRARYSSRMVEPIECGG
FT                   GTPRAG"
FT   gene            complement(240330..240803)
FT                   /locus_tag="Nmul_A0226"
FT   CDS_pept        complement(240330..240803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73534"
FT                   /db_xref="GOA:Q2YCI7"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI7"
FT                   /protein_id="ABB73534.1"
FT                   /translation="MRRSVLVISALIFCLSACAGLRPQEPLRISVAGLEPLEGKGMEAR
FT                   FAVSLRIQNHGAVPLDYDGVALDLDVRGMRFASGVSDQQGTIPRFGETVIIVPVTVPAT
FT                   AIIRHAFRLTAGDHRKTDYELRGQLGAPGFAIGRHFDVKGEITLPALPAEGAR"
FT   sig_peptide     complement(240744..240803)
FT                   /locus_tag="Nmul_A0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            complement(241013..241249)
FT                   /gene="rnpB"
FT                   /locus_tag="Nmul_AR0006"
FT   misc_RNA        complement(241013..241249)
FT                   /gene="rnpB"
FT                   /locus_tag="Nmul_AR0006"
FT                   /product="RNA component of RNaseP"
FT   gene            241503..242099
FT                   /locus_tag="Nmul_A0227"
FT   CDS_pept        241503..242099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0227"
FT                   /product="ORF4 protein"
FT                   /note="similar to Nitrosospira sp. NpAV ORF4 in GenBank
FT                   Accession Number U92432"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73535"
FT                   /db_xref="GOA:Q2YCI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI6"
FT                   /protein_id="ABB73535.1"
FT                   /translation="MKKIFEWAAGLAGAMMIALVVVPAHAQLMLAHEGHHSGDCAIKSG
FT                   AFPVSFSAYEKPKGELPPTHAYCDHVPETGELYFTVDLTDPESREIPIAMRLVMEGHGE
FT                   GGHEIMSIPAKPYPSGSITFTVNLEELGQYALLLETEKDGKMTPAVRIPVHVGGGGGHD
FT                   GHGGGIGMTEIALIVGVAGVAAFFLLRRRTSAKMS"
FT   sig_peptide     241503..241583
FT                   /locus_tag="Nmul_A0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(242379..243566)
FT                   /locus_tag="Nmul_A0228"
FT   CDS_pept        complement(242379..243566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0228"
FT                   /product="serine palmitoyltransferase"
FT                   /EC_number="2.3.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73536"
FT                   /db_xref="GOA:Q2YCI5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI5"
FT                   /protein_id="ABB73536.1"
FT                   /translation="MSLLDKLDAVAAARKALLPEGVEVFGTPIEEVYSSTEARIGDHRI
FT                   LFLGTNNYLGLTFAQECRDAAQEAIHNEGTGTTGSRMANGSYSGHRALEREFAEFYQCG
FT                   SCIVFTTGYQANLATISGLAGAGDIVLIDGDSHASIYDGCRLSGAEIIRFRHNDAADLE
FT                   KRLRRLGERSRSTLIIAEGIYSMLGDRAPLADIVKVKDAYNSTLLLDEAHSLGVLGETG
FT                   QGLVEETGLLDRVDFITGTFSKSLGGIGGYCVSNHPQLDQLRYVSRPYIFTASPTPATI
FT                   ASTRAALKLLREGVELRRQLWKNVHQLYSQLKELGYRLGPEPSPVIATILETPQQALAL
FT                   WKGLLEQGIYVNLVLPPATPEGNSLVRCSVSAVHTSEQMDHVGKTFAMLRETIFQ"
FT   gene            complement(243563..243817)
FT                   /locus_tag="Nmul_A0229"
FT   CDS_pept        complement(243563..243817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0229"
FT                   /product="Phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73537"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI4"
FT                   /protein_id="ABB73537.1"
FT                   /translation="MLNDYNDVLQKLCHHLEQLAGPEVEITPQSDLINELAIDSVKLLN
FT                   LIMEIEDEFDISVPINALADVQTVHELANLIYRIKSQKQ"
FT   gene            complement(243847..244761)
FT                   /locus_tag="Nmul_A0230"
FT   CDS_pept        complement(243847..244761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0230"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73538"
FT                   /db_xref="GOA:Q2YCI3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI3"
FT                   /protein_id="ABB73538.1"
FT                   /translation="MSESWVAVTGATGFIGNALLQSLIKEGWKVRALTRRARVDDESTQ
FT                   WIEGDLHDRDALRKLVTGVSAVVHCAGQVRGSSLESFVRTNVEGTANLMQASLEQNPPP
FT                   RFLLVSSLAARQPELSWYATSKHMAERLIDERSAGMACAIFRPTAVYGPGDKEMSPLFR
FT                   ITRRGILPMVGQPEMRFGLLHVADLVAAITCWLSTAVPVQGTYELDDGMPGGYDSQAVA
FT                   TIAQEVWKRPVRCVFFPAPLVSLIANINLWSARMLSYSPMLTPGKVRELRHPDWVCDID
FT                   PLTRALPGWRPCIHLRDALPQAV"
FT   gene            complement(244769..246595)
FT                   /locus_tag="Nmul_A0231"
FT   CDS_pept        complement(244769..246595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0231"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73539"
FT                   /db_xref="GOA:Q2YCI2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI2"
FT                   /protein_id="ABB73539.1"
FT                   /translation="MSSTIAKLNAPLTQAFNPQLSSEQPAAAIPTPTYNTQAQRLADFD
FT                   TLIAALEYAAAGTAGYNFYDAKGNLRSVLPYQALRQNAQTAARQLLRLGLARGDRVAII
FT                   ADTTPEFVEIFYACRYAGLVPYAMPVPVNLGSHAVYVRQLRGMLEAGQASAALANADYV
FT                   DFLKEAAEGSQYLRWVGTPEQLGELPASITELAPNSPDEIAYLQFTSGSTRMPRGVVIT
FT                   EGALMSNLQGIVRHGLNIRAGDRCASWLPFYHDMGLVGMVMAPMVAQVSVDYLATRDFA
FT                   IRPLQWLRLISRNRATVAFSQPFGLKLCTLRVRDSDLEDLDLSSWRAAGVGAEMIRPDT
FT                   LRNFAEKFAPAGFDARAFLPCYGLAESTLAVTFSEVGQGFQSLRVDAATLVDRKMAVRL
FT                   QVEGRKYSEFVNCGRALPGHIVKVIDEAGQQLPDLRVGSVLVQGSSIMTGYFNNPEDTG
FT                   KTLKPGNWLDTGDLGFLFEGDLYITGRRTDVIIVNGRNIRAQDIEELAEQQPEVRTREA
FT                   SAFGITDANDVTTIVLVIECRLTSITDRQSLTSRLQRLVYMAFGVNCLVELVPPHTLPR
FT                   TSSGKLSRFAARQGFIQRTQMTDQLSAESGDK"
FT   gene            complement(247289..247633)
FT                   /locus_tag="Nmul_A0232"
FT   CDS_pept        complement(247289..247633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73540"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI1"
FT                   /protein_id="ABB73540.1"
FT                   /translation="MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLF
FT                   DWRDMLSYTIDVAWEDIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRD
FT                   YAAAKTWLEG"
FT   gene            complement(247736..248833)
FT                   /locus_tag="Nmul_A0233"
FT   CDS_pept        complement(247736..248833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0233"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73541"
FT                   /db_xref="GOA:Q2YCI0"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCI0"
FT                   /protein_id="ABB73541.1"
FT                   /translation="MVDLIDVCQLAPTQLPVDWYLDSQILELEKRILFDQGPGYVGHEI
FT                   MVPNIGDYYVPEWMDNAKMLVRNKDGIELLSNVCRHRQSLLLKGSGNTRNIVCPVHRWT
FT                   YDLKGTLLGAPHFPENPCLNLSNSPLQNWNGLLFQGRRNVARDLGNLQVLKNFDFSGHV
FT                   LERLQIDEYACNWKTFIEVYLEDYHVEPYHPGLGNFVDTAALEWEFGEWYNVQTVGINN
FT                   ALTRPGTPVYAKWHEQLLLQTAGEIPRHGAIWMLYYPNVMMEWYPHVLVVSTVLPTGTE
FT                   RCTNVVEFYYPEDIALFEREFIEAEQAAYRETAAEDDEICRLMTEGRRALYKQGVSEVG
FT                   PYQSPMEDGMVHFHKFLRREIEPHI"
FT   gene            249074..249328
FT                   /locus_tag="Nmul_A0234"
FT   CDS_pept        249074..249328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0234"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73542"
FT                   /db_xref="GOA:Q2YCH9"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH9"
FT                   /protein_id="ABB73542.1"
FT                   /translation="MTKPVDPVKFSPPEGFEAALAELESIVLEMEAGQMPLEESLEAHK
FT                   RGTELLQYCHSKLQDAQQQVRLLEANTLKNFSPSGIDDR"
FT   gene            249318..250211
FT                   /locus_tag="Nmul_A0235"
FT   CDS_pept        249318..250211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0235"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73543"
FT                   /db_xref="GOA:Q2YCH8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH8"
FT                   /protein_id="ABB73543.1"
FT                   /translation="MTADFQDWARSHQVRIENSLQTLLPAADVAPERLHEAMRYTVLGG
FT                   GKRVRPLLAFAAGELNKANEERVTIAAIAVELIHVYSLVHDDLPCMDDDVLRRGKPTCH
FT                   IEYGEAIALLTGDSLQSLAFQLLAEYSLADTPKMQLEMIRRLAQAAGSRGMAGGQAVDL
FT                   ASVGRTLSLPELEFMHIHKTGALIRAAVMLGAYCGSRLDEAQLAALDHFAKCIGLAFQV
FT                   VDDVLDAEATTAALGKTAGKDAENNKPTYVSILGSKRARELAEELRREAYASLEMFEAA
FT                   AGRLRQVTDFIIHREF"
FT   gene            250271..252115
FT                   /locus_tag="Nmul_A0236"
FT   CDS_pept        250271..252115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0236"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73544"
FT                   /db_xref="GOA:Q2YCH7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCH7"
FT                   /protein_id="ABB73544.1"
FT                   /translation="MHPLLNTITDPVKLRALDRKLLPQLADELRQFLVESVAKTGGHLS
FT                   SNLGTVELTIALHYVFNTPYDRLVWDVGHQTYVHKILTGRREGMSKLRMRGGIAGFPRR
FT                   DESEYDAFGTAHSSTSISAALGMAVASQWEGKKRSVVAVIGDGAMSAGMAFEALNNAGA
FT                   MDTNLLVILNDNDMSISRPVGALNNYLARLMSGQFYATARRAGEKMLGVVPHVLELAKR
FT                   AEEHVKGMVTPSTLFEEFGFNYIGPIDGHDLDVLVSTLNNIRNLRGPQFLHVVTRKGAG
FT                   YKAAEDDPILYHGVTRFNPDAGIIPKASVKPSYTQVFGDWLCDMAALDQRLVGITPAMR
FT                   EGSGMVRFSHEYADRYFDVGIAEQHAVTFAAGLACDGLKPVVAIYSTFLQRAYDQLIHD
FT                   VAIQNLPVVFAIDRAGLVGADGPTHAGSFDLTYLRCIPNITVMAPSDENECRQMLYTAF
FT                   QMNTPAAVRYPRGSGSGVAQQKEMQMLPLGRGEIRREGAEIALLAFGSMLQPCLEAAEE
FT                   LNATVANMRFVKPLDDDLVASLAANHELLVTVEENTVMGGAGSAVLESLSARGRTVPVL
FT                   QLGLPDTFLDQGDPSQMLSECGLDREGIVHAIRARFPK"
FT   gene            252177..252968
FT                   /locus_tag="Nmul_A0237"
FT   CDS_pept        252177..252968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0237"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73545"
FT                   /db_xref="GOA:Q2YCH6"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCH6"
FT                   /protein_id="ABB73545.1"
FT                   /translation="MNKMLIADVQSVADTRRIAIDKAGIRAIRHPVRIMDKAGVQHTVA
FT                   VFNMYVNLAHHLKGVHMSRFVEMLNEHDSVISVETFEKLLISMVKKLEAESGDIEMRFP
FT                   YFIGKTAPVSGIKSLMDYDVTFIGQTRNGESRFTLKVVVPVTSLCPCSKEVSDDGAHNQ
FT                   RSHISISIRANHFVWIEDLIRIAEDQASCELYGLLKRSDEKYVTEKAYGNPKFVEDAVR
FT                   DIASVLDRDERIDAYTVEAENFESIHNHSAYALIECDKLKN"
FT   gene            253129..253205
FT                   /locus_tag="Nmul_AR0007"
FT   tRNA            253129..253205
FT                   /locus_tag="Nmul_AR0007"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA-Pro1"
FT   gene            253241..253317
FT                   /locus_tag="Nmul_AR0008"
FT   tRNA            253241..253317
FT                   /locus_tag="Nmul_AR0008"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg2"
FT   gene            253378..253452
FT                   /locus_tag="Nmul_AR0009"
FT   tRNA            253378..253452
FT                   /locus_tag="Nmul_AR0009"
FT                   /product="tRNA-His"
FT                   /note="tRNA-His1"
FT   gene            254443..255246
FT                   /locus_tag="Nmul_A0238"
FT   CDS_pept        254443..255246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0238"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73546"
FT                   /db_xref="GOA:Q2YCH5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR017470"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH5"
FT                   /protein_id="ABB73546.1"
FT                   /translation="MGFFPPFTDDHLQRYFRILQEGTAVRRHFDLLKWLQGEVQHYLPH
FT                   EILLAAWGDFGSNNVQYDIISPLPGLRTAQLQLARLSPLLRVSYNRWIEVGRIPCVSRV
FT                   CEAQLDVSGILQGDGAAHCPFGRALRNMRSSLFHGISDERGHHDCLYVVFSSKDKLDDS
FT                   TLIAMEILLPYLDTALRRVTPLPQHSCRPSLLADAPEYDLHGLSEREVEIMTWVRKGKT
FT                   NAEIGSILRISSYTVKNHLHQIFRKLDVYNRVQAISKIEQRVGHG"
FT   gene            255239..256657
FT                   /locus_tag="Nmul_A0239"
FT   CDS_pept        255239..256657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0239"
FT                   /product="sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73547"
FT                   /db_xref="GOA:Q2YCH4"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH4"
FT                   /protein_id="ABB73547.1"
FT                   /translation="MAEANPTFSASTVTARQVKGPLANNMLSAVESVLDPAVLTLSLWL
FT                   ISTSFEGELLPPYLILSVIVFSISFPGASHLRSSVKVLIFDVLYTWFWMALLLFFLGFA
FT                   TGYIAQFSSQVLITWLWAAPLSQIGVHLLFRIAAPYLLMLQGPPQRAIIVGMNEQGVAL
FT                   ARRIHETRYSNMELSGFFDDRNESRLSHARNNPLLGRLRELPEFVKEHRIQFIYLSLPM
FT                   ASQPRILHVLEELKDTTASIYFVPDMFITDLIQARSGTVCGTPVIAVCESPFTGSNGMV
FT                   KRASDIILSLLILLLISPLLLLIAVAIRLDSPGPIIFKQRRYGLDGEEILVYKFRSMSV
FT                   CEDGNTIRQAQRNDNRITRVGAFLRSNSLDELPQFINVLQGRMSIVGPRPHAVAHNEIY
FT                   RNLIKGYMIRHKVKPGITGWAQVNGYRGETRTLDKMQARIDHDLDYLRNWSLRLDLHII
FT                   CKTILVVLKDRAAY"
FT   gene            256863..258104
FT                   /locus_tag="Nmul_A0240"
FT   CDS_pept        256863..258104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73548"
FT                   /db_xref="InterPro:IPR017465"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH3"
FT                   /protein_id="ABB73548.1"
FT                   /translation="MLDMQQAMAQQTTPHPPRMVPDKTFSVTAGTTFTYDSNVFRLSPL
FT                   VNPIALTGQPRRADQIIITSATLGFNKRYSMQRFEVTGTLVDNRYMNFDFLDFLGKNYN
FT                   AAWHWYVTPYLHGRLTSRHSEALNNFANLSGFLNGTNRNLRTLDNYHFDGVLELNRAWH
FT                   LIGGLDHSIMKNSRLTIQDFNNKVTSVEGGIRYVSSSGGSLTYRVRSGRGEFINRPAPL
FT                   PEFLFDTRFDEMEHDLRMHWPVTVKTSIEGRIGYLDRKHAHFSQRDFAGFVGDLNISWM
FT                   PTSKVQVMGGWSRQLSNYQTAPFAFQHSIFERFSSSYIATNRFSIAPTWQITEKTALRV
FT                   RYDYVLSDFHGAVVPLPTESRSDQMHSGLVALDWRPLNTLYLSAAFHRDHRSSNHRGFG
FT                   FDSTAGSVSATLNF"
FT   gene            258346..259338
FT                   /locus_tag="Nmul_A0241"
FT   CDS_pept        258346..259338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73549"
FT                   /db_xref="GOA:Q2YCH2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR014274"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH2"
FT                   /protein_id="ABB73549.1"
FT                   /translation="MAQQIDHMKMNRQKFITPLLLPLLVLGLAACDKKESSQPASQVAA
FT                   KVNSGEISVHQLNYVLARATRNSANSPENASRIRREVLDRLVDQELAVEQAINKKLDRS
FT                   PEVLMALDNARREILARAYLEQITAATPKPTVEEAKTYYSEHPQLFAERRIYNIQEIVL
FT                   PSSAGVADELREMLDSGKPMEDIAKWLKGKDIKFAAGSATRSAEQIPLEILPKIHPLKP
FT                   GQGLLIQGPQSITLMRIAAAQTAPITEAAALPRIQQFLGNQRAAEAARGEIKALKAKAN
FT                   ITYMGEFAVPDKNASGGENSVSSVASARDSSSPQADNPGLEKGAAGLLR"
FT   gene            259367..260161
FT                   /locus_tag="Nmul_A0242"
FT   CDS_pept        259367..260161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0242"
FT                   /product="Polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73550"
FT                   /db_xref="GOA:Q2YCH1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR017478"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH1"
FT                   /protein_id="ABB73550.1"
FT                   /translation="MFQILVRTLILLSMLFSVKVFAESPDYPLGPGDILRIQVFQNPDL
FT                   TTETRVSESGSITFPLVGALEVGGLSVASAENKLAAALKKGGFIKQPQVTIVLLQMRGS
FT                   QVSVLGQVNRPGRFPLETLSRVSDMLAAAGGTTPLGDDFAIVTGTRNGQAFRKVIDIPA
FT                   LYLEERSDEDIILAGGDTIYVHRAPVFYIYGEAQRPGAYRIERGMTVMQALAQGGGPTP
FT                   RGSEWWLRLHRRNADGVVEKLSPDMTDAVQPNDIIYVRESIF"
FT   sig_peptide     259367..259435
FT                   /locus_tag="Nmul_A0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            260176..261567
FT                   /locus_tag="Nmul_A0243"
FT   CDS_pept        260176..261567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0243"
FT                   /product="Lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73551"
FT                   /db_xref="GOA:Q2YCH0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR017468"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCH0"
FT                   /protein_id="ABB73551.1"
FT                   /translation="MTLQQFLLILRARYKVVLYILLFTVIATLVVSLLLPKQYTAGTAV
FT                   VVDIKSPDPVAGMVLPGLTSPTYMATQVDVINSDRVAERVVKMLRLDESPVVKEQWEED
FT                   GSKGELTTWLANLLKRKLDVKPSRESNVIYIEYTGNDPNFAAAVANAFAQAYIDVNLDL
FT                   KVAPARQYAHWFKGQTAAARDELERAKAALSAYQQETGLVATEERLDYEVAKLNELSSQ
FT                   LTLIQAQTSDSSSKRKAAEDPDTLAEVIQSPLINSLKSDIARLDAKLQESSAYLGPNHP
FT                   QTKRTQSELASLRGKLSAETRKIHSSIGTSYEVGKRKEQELLEAMERQKGRVLELNRQR
FT                   DQMSVLQGDVEAAQRNFEGISQRSALTRLESLSVQTNITPLNPASVPSEPSSPKLLLNT
FT                   LISIFLGTLLGVSAALVMELMNRRVRSVEDIVEAIEIPVLAVMSGPSRNKLSSRLPKLP
FT                   NPETS"
FT   gene            261588..262517
FT                   /locus_tag="Nmul_A0244"
FT   CDS_pept        261588..262517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0244"
FT                   /product="Protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73552"
FT                   /db_xref="GOA:Q2YCG9"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR017479"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG9"
FT                   /protein_id="ABB73552.1"
FT                   /translation="MNPVSASLPAIKRSQNSNSRESFFAGRTQIIGNSSSIGAILVNAG
FT                   RLSEENVTRILEAQVQQQNHFGEAAICLGLLTEDDVRFALSRQFNNLYLPAGDSSLSHH
FT                   LIAAYKPFSPVVEHLRSLRSQLMLRWFEPDTDRNVLAIVSPGLGEGRSFIAANLAIVFS
FT                   QLGKSTLLIDANLRAPRQQEFFKVNTGGGLSSYLAGRAGLESIVRIPSLLGLSVLPAGA
FT                   VPPNPQELIGRPVFADLLQSVGCEFDVVIVDTPSASEYGEAQIIATEASAALIVLRKNH
FT                   TSLSRTVDLARRFQQTGAAVVGSVLNDF"
FT   gene            complement(262694..263026)
FT                   /locus_tag="Nmul_A0245"
FT   CDS_pept        complement(262694..263026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73553"
FT                   /db_xref="GOA:Q2YCG8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG8"
FT                   /protein_id="ABB73553.1"
FT                   /translation="MLLVLGILTGLFAGGAHPVAVNLVPSPWDKLVHAVIFAVLTGAIG
FT                   GAASGIPGWRRVGLAFLGATLIGLFDECHQMYLPGRKPGWDDFAADVTGSLIGIALLRA
FT                   EWRRRN"
FT   sig_peptide     complement(262961..263026)
FT                   /locus_tag="Nmul_A0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.680) with cleavage site probability 0.320 at
FT                   residue 22"
FT   gene            263073..263987
FT                   /locus_tag="Nmul_A0246"
FT   CDS_pept        263073..263987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0246"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73554"
FT                   /db_xref="GOA:Q2YCG7"
FT                   /db_xref="InterPro:IPR013426"
FT                   /db_xref="InterPro:IPR017544"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG7"
FT                   /protein_id="ABB73554.1"
FT                   /translation="MIINSSIIFNRKNPPAEPRNLMLIWLPIIAGLIVLYLPSLVDLFR
FT                   GVWSTDQQAHGPIVLSIACWLIYRKWPEMWHQSESEPSAPAAGWPIFIFGLILYVIGRS
FT                   QEILLFEIGSVIWLLAAIVLLMRGSRALKVQWFPLFFMLFMIPLPSAFVDALTMPMKMA
FT                   VSYVAETILFWFNYPIARTGVILQIGQYKLLVADACAGLHTLFTLEALGLLYLNLVRHD
FT                   SLFRNVALAIFIVPISFTANVIRVMVLTLITYHFGDEAGQGFLHGFAGMVLFLSALLLI
FT                   IGVDSLLQMAVRLRVRSNALGDA"
FT   gene            263984..264667
FT                   /locus_tag="Nmul_A0247"
FT   CDS_pept        263984..264667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73555"
FT                   /db_xref="InterPro:IPR014263"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG6"
FT                   /protein_id="ABB73555.1"
FT                   /translation="MMMNPWLRNCLLLVLMLAASGLALALKPTQKIADQGPAVDLEKII
FT                   PKEFGDWREEQHNFIQMVDPQQKELIERIYTQTLSRTYANSNGYRIMLAIAYGDDQRDS
FT                   MQTHYPEVCYPAQGFELISREKGSVVSPTGSIPVVQLVTSLEKHRIEPVTYWVMIGDMP
FT                   IVQGWKKKLAEMQYGLRGLIPDGLLFRVSSIDEDNRHAFEMHQAFINDILAAMPVIQRK
FT                   RFSGT"
FT   sig_peptide     263984..264061
FT                   /locus_tag="Nmul_A0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            264728..266191
FT                   /locus_tag="Nmul_A0248"
FT   CDS_pept        264728..266191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73556"
FT                   /db_xref="GOA:Q2YCG5"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG5"
FT                   /protein_id="ABB73556.1"
FT                   /translation="MSLAVKSLSAVKSSYAGTIIRIGAQFGAQILIMRQLDPELVGAFG
FT                   YVLLLHGILALIIDQGYGWSLIQGHFNDKREIAIVFSRIMLLSFIGMLCVFAISYPAAD
FT                   YLENELVGSMFRYSAPSCLFIGFFSISQAALRAELRFREIQIATTGAYLIAYPIVGVTM
FT                   ALGGFGVWSLVAAWYVHYILQVVIGHYYSPHSLKLANPFLPTKSGPMGRQVAGINVLNW
FT                   AVDNTGGVFIGGLGASALGNFNAAMMLARTPALHAVQTLQSILFSTASAIGADQQRIKR
FT                   LYLAVLAAVSFIVFPTYGYTFTHAELVIKIVFGSKWLDAADIFSALSIGMIAFSLSLLS
FT                   GAILTATGDQKTVLYSQMACLMVMIFGLSLTINVSLVYVGLAITVAYTVRLSLQLKAIA
FT                   VRGGITLKEFLATLRGPFFVAIIMAMPVTLFGDSTLEVIPTELLALALKGLVLLVLFKV
FT                   FPSFFFSLASIDLLSRFHAGRQVVHMLGI"
FT   gene            266239..267717
FT                   /locus_tag="Nmul_A0249"
FT   CDS_pept        266239..267717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0249"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73557"
FT                   /db_xref="GOA:Q2YCG4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG4"
FT                   /protein_id="ABB73557.1"
FT                   /translation="MLTVIILSIAVFVFALGSIVAMSAVAGAASRWPGQMFSYLMWMIV
FT                   MAGVGGILVSGRILRIDEEALVMGAVGEAGGTIIAKLLLSAVIGVSLALCVTWILLSSK
FT                   RKAGGNRFEQRRLNSPNDIVIAFMVFYIAFSILPLIFGKSHQFHVSLFYPFFVFIALFL
FT                   WMRLSKVDPVIVAKQCLGFIVLTSLVMAVLIPQLAVQPSYVGLIPGFNSRLWGLTAGAN
FT                   SLGSVAGTLLVLEAAEPSARRWLGNGIFFTAALALVLTQSKTSILAAFLGLLIIFGYRL
FT                   VTGLQGKSLNGRNENLILIILIAFFILFITAVSAWVMFFDTSVFTSLERSLDSRAVSKL
FT                   ATASGRTWIWEVALRGGMENPLFGQGLGFWSLENRLRWGLGGAVHAHNLFLDVFARSGF
FT                   VGLSTLLVFLYFVFRYSVRATRYTHGGSIALAVIFLVRATFEVPLQPNAILGAESMAML
FT                   AFFLYVIDRGAKQRDKANEPVQVRAHFLRAGNFR"
FT   sig_peptide     266239..266325
FT                   /locus_tag="Nmul_A0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.652 at
FT                   residue 29"
FT   gene            267714..268838
FT                   /locus_tag="Nmul_A0250"
FT   CDS_pept        267714..268838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0250"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73558"
FT                   /db_xref="GOA:Q2YCG3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG3"
FT                   /protein_id="ABB73558.1"
FT                   /translation="MKKPRVVLVALHFAEYALNLALAVAESREVLLVLYRGNADRELGP
FT                   DWLKGIRHPSLMLLILDRPRSPLMILGNARRLVRAIQQFKPDVIHYQEDPRDEVILGLY
FT                   FLRSIPIVLTVHDPTPHSGTDSNRLRYSRFRLYLPLMRRAADIAITHGGLLADNLIKAF
FT                   PHFKDKVQPIPHGPLGLFSGTQPSHPSGFRLLFFGRIFEYKGLSYFVDSVIMLRDKGYP
FT                   VIGVVAGFGTDLARHRQRMEEAGCFEILDRYIAAKEVPDLFLDSFAVVLPYVDGTQSGV
FT                   AAMALGFARPVVASAVGSIPELVRNGENGLLVPPSDSIALSEAIETLLNDTQLWEQLTA
FT                   GAQRLRDQELSWESIADKTIRVYELAGKMRLAST"
FT   gene            269102..271420
FT                   /locus_tag="Nmul_A0251"
FT   CDS_pept        269102..271420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0251"
FT                   /product="Heparinase II/III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73559"
FT                   /db_xref="GOA:Q2YCG2"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012364"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032518"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG2"
FT                   /protein_id="ABB73559.1"
FT                   /translation="MFRKPTLQALAVASLLAHTQVGCQQLPPEKIDNRMSDWAEPTAAE
FT                   QIPVTPANGAIVKQNPPDFDWRRINLSAEYVLVLQHEGGKRYEWRTPRNWYLPSASLPP
FT                   GKYSWQVRPIGPGSGVGESAWRRFTISEDAIPFVVPDNEDLLRELRNKPRPRSFVRGKD
FT                   ESKSRSLVQSERSNVVATVKNQVKKKMAQPALAAPPKLVDRKVGKGAGWANSLFAIRNY
FT                   VSGEAYQLRATAFLWQLNHDPALLAEALRTGDALAALDPNGPTGHKSQDQASRDIAIGL
FT                   ASAFDWLGDAVPAESQQLWLKAIAARGQAIYDDLLGGQRRFELARYDSHGWTNLGYLAD
FT                   LSALMVGTLPVADNWFNDSFRFYIHTVSPWGGEEGGWANSSAYAIWSLNLGIIPRWDSI
FT                   RAATGINIYKKPWSQGLLKYFVYFEPPSSPIQLFGDGAEMPPDFSQIKGYASRQDSPLA
FT                   AWYFLNIDKREYPLQVLEAPIPLPVEGIKPEPPRANSIAFHDIGWVAMHSAIVDPLRTS
FT                   VYFRSSPYAAFGHSHADNNSFVLVSRDEPLLIASGYYDWEGSPHWKQWYWQTKAHNAIT
FT                   FDGGKGQAEKTGSGKMTAKGQLTEFQSNGKVDFTEGDATPAYEGALQQARRRLWYLRNK
FT                   NVLIIHDSLRSATPRQFEWNIHALNPFEIKEPGSIEVKQKAARACINMLQPHAIEFAQN
FT                   NRFDAPPQIPPSRNENDQGGARTTNDQWHGRFQTKERMAAVEFLAVVDIDCKNIPIEMG
FT                   NFESNRKIKVGDESIHVAR"
FT   sig_peptide     269102..269161
FT                   /locus_tag="Nmul_A0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.367 at
FT                   residue 20"
FT   gene            271673..272494
FT                   /locus_tag="Nmul_A0252"
FT   CDS_pept        271673..272494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0252"
FT                   /product="2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1
FT                   4-benzoquinol methylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73560"
FT                   /db_xref="GOA:Q2YCG1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG1"
FT                   /protein_id="ABB73560.1"
FT                   /translation="MQNPRRICVADPNHRLSQKRFTRNSRDIFICPDCGCIMADVDFDH
FT                   DQYESGDYYTMQHKTVQSIEEVWGFRWRYILDQILKINGRSSLLDVGAGNGYFVALASR
FT                   EFSFDASGLEISQEEVQFAADVLNIGLIREDLTQHNLDYDVVTCLNVLEHVVDPQLFLS
FT                   HLVNRVKPGGLLVITTPNPACIHRKVKGLKNWNMIAPPHHINLFTKESLYILLMRYGLI
FT                   QLDYQTISTYVNFVRGFDTENLLLRRLFFNLLKIFDLGADHFFIVKKPSQC"
FT   gene            273034..274110
FT                   /locus_tag="Nmul_A0253"
FT   CDS_pept        273034..274110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0253"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73561"
FT                   /db_xref="GOA:Q2YCG0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCG0"
FT                   /protein_id="ABB73561.1"
FT                   /translation="MLGTDSTGRGGIASVVTLLQEEGFLDQQNVKYITSHREGTHFKKL
FT                   AIMFSATGKVLWYCMFAKPAIVHVHSASGASFIRKSIFLAVARLFRCQTVFHLHGGRFP
FT                   HFASEESGVLLKWWIRRTLERSSTVIALSESWAAFLSTCAPAAAIQIVPNSVRLAKISS
FT                   KQRGEAGRILFLGHVGKGKGIFELLKALSLLKDSLPYIRLVVCGDGCLDSVQKMADELG
FT                   IASNVEFRGWVDASQKAEELARASVFVLPSHDEGLPMAMLEAMAAERAIIVTPVGGIPE
FT                   VIRDRENGLLVPPRDADALAQALKEVLENPLLRQMLAENALRTIESRFSTPVILGQLSL
FT                   LYERLRGGSRGEVVAFIK"
FT   gene            274497..275330
FT                   /locus_tag="Nmul_A0254"
FT   CDS_pept        274497..275330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0254"
FT                   /product="Methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73562"
FT                   /db_xref="GOA:Q2YCF9"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF9"
FT                   /protein_id="ABB73562.1"
FT                   /translation="MNKVFAPLKRISVSVGKRLAPDAYALFKFKSLGRDFHEPELRLLP
FT                   YLCDSRKTSLDIGASEGLYMAHLLKLSAYCIAFEARPGQAARLKSILTRVTHRASVESV
FT                   ALSDSTGETKLRTLVEDPGRSTIEISNLLEDEDGSNLTEVTVPVRRLDDYALDNVGFAK
FT                   IDVEGHELAVLKGGEDTVRRHRPSLLIEIEDRHRKNAIRDVTDFLADLDYSGFFILNDL
FT                   VRPLNEFDRELHQDSRNIGGWKSHWERKGVYINNFIFVPSEKRQEFTRFVLREKW"
FT   gene            275475..276497
FT                   /locus_tag="Nmul_A0255"
FT   CDS_pept        275475..276497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0255"
FT                   /product="Protein of unknown function DUF354"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73563"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF8"
FT                   /protein_id="ABB73563.1"
FT                   /translation="MRIWFELTNSPHVNMFAAMIRDLEQDHEIIITSRPLANTIDLLDL
FT                   HGFKHEVVGLHYGGRLTAKLLGFPVRVMQLRQFLAKRQIDVAISQSSFHSPGVSRLLGV
FT                   PSIYMNDNEHALGNIPAFICASKIMVPEFLSLGKLKKQGANPRKVIHYPGVKEGIYLWE
FT                   LDARLSKEGGWQRKAKSRKVVYVRPEPWTAQYYKGKRNFLDDLLLGMQDHVDVVLLPRG
FT                   KEQSIHYQKPQFSRIRVVATALDIADIAPDCDLFIGAGGTMTREMAVLGIPTISVYQDE
FT                   LLDVDRYLLKVGAFAHKPELMVEDALRYLELTESRPPNRELLEKGKTAYDMIKNEVLNS
FT                   "
FT   gene            276520..277626
FT                   /locus_tag="Nmul_A0256"
FT   CDS_pept        276520..277626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0256"
FT                   /product="oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73564"
FT                   /db_xref="GOA:Q2YCF7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF7"
FT                   /protein_id="ABB73564.1"
FT                   /translation="MVRLAVVGLGKMGLSHYAMINAHPDVKVEAVCDSTGYVLDVLNKY
FT                   TGVRTYTDFDVMLRDIELDAVIIATPSRSHGQMVEVALNENLHVFCEKPFCLDITEGER
FT                   LARIAAERGLVNQVGYHNRFVGAFQEVKRLLDAGAIGAVTHVLAEAYGPVVLKPKGSTW
FT                   RTQRTEGGGCLYDYAAHPINLVNWYLGAPQSVGGSVLNKIFSKDTEDEVFSTLYYEEGK
FT                   SVQISVNWSDESYRKMTTKVTIWGTQGRIYADRQECQVYIRDGVNIPAGYQRGWNVRYT
FT                   TDLTEAVWFYLRGEEYSAQLDYFVRCIEEKEGGGNINSFEEAVITDRVMSMMVADAEKR
FT                   PPVTSGIAPRQAPGKKFGLLFGGRKAVS"
FT   gene            277657..278523
FT                   /locus_tag="Nmul_A0257"
FT   CDS_pept        277657..278523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73565"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF6"
FT                   /protein_id="ABB73565.1"
FT                   /translation="MDRLLFGDNQFFGVNHMSEEKARAQMMRFQDLTAVIDVLDNAYDE
FT                   GVTSFMCTTHDRIAMVCDHMRSNPQRYKDFQFLPCMPYAHKYANAVTEDGMIGALKRFL
FT                   PEEGIVNAALRGGMSLARKDIEGITTLLVDAEMKMFAGLNTPVIFLQNVVVDLLLGLDF
FT                   KAAFRIFADHIKSRYNAEPGFITMNMPKLLDALEEVGIENPIVCANINKIGFRMCGGFE
FT                   AYERALDEKKFRAIAMSVFASGAVPPREAIEWVCQQPNIQAIVFGASSKTNIRNTKSLV
FT                   EEFWRIN"
FT   gene            278542..279675
FT                   /locus_tag="Nmul_A0258"
FT   CDS_pept        278542..279675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73566"
FT                   /db_xref="InterPro:IPR025975"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF5"
FT                   /protein_id="ABB73566.1"
FT                   /translation="MVRVTTLVLCFALTFPFSFAYADIVFDGRLSKGDFSGYRALEANG
FT                   TRFGGALASNGIPSRLDRVRDPAGSGQLVMRATHIDGDLPIYGGYRSELSTFHDPIGSE
FT                   RWYSWGYYLPETFATAKNNVVIAQIHNTPDIMETNSRNPTLAVLVQGERIKLINVFDYD
FT                   KITAPAGTRPTVGVDYERRELASWDLHPGRWTFLDLHVKWAGNDTGFLEFWKDGTLLFQ
FT                   EKNHINTFNDERGVWFKSGLYDWSPSPDPVSTYFSGVIIRDEKEMFQSMLMSRMLESNI
FT                   SLNPLLRWSVEQDLRDMIGDAIARRMLRPAENLIYKHNETLHDAVTGDGKEMFQSMSVS
FT                   LVPEPDIYLMMLVGGAAIGFFTYKRRTTLLTENPVPA"
FT   sig_peptide     278542..278610
FT                   /locus_tag="Nmul_A0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.834 at
FT                   residue 23"
FT   gene            279672..280787
FT                   /locus_tag="Nmul_A0259"
FT   CDS_pept        279672..280787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0259"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73567"
FT                   /db_xref="GOA:Q2YCF4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF4"
FT                   /protein_id="ABB73567.1"
FT                   /translation="MKKIYLVAGARPNFMKIAPVVRALQTRKCLEFKIIHTGQHYDREM
FT                   NDVFFEELGIPQPDVFMAAGGGTHAQQTARIMMAFEEFCEADPPDAVLVVGDVNSTLAC
FT                   SIVAKKLHIPVAHVEAGLRSGDITMPEEVNRIVTDSISDWFFVTEPSGIDHLKREGKPD
FT                   SAIHYVGHVMIDNLLYQLEKLEDHDISSLETSPFKAKLAINGSRYGVVTLHRPSNVDNV
FT                   EMITRLCGALREIAVELPLIFPVHPRTRGNLEKFGIELGPNITLLGPQAYMPFLNLWKD
FT                   AAVVLTDSGGLQEETTALGVPCVTLRDNTERPITVEEGSNVLAGTDPVRIIGEVRKILH
FT                   GEGKRSQRPHLWDGKAAERIVDVLVREVSQA"
FT   gene            281091..282152
FT                   /locus_tag="Nmul_A0260"
FT   CDS_pept        281091..282152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0260"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73568"
FT                   /db_xref="GOA:Q2YCF3"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF3"
FT                   /protein_id="ABB73568.1"
FT                   /translation="MILVTGGAGYIGSHTCLELLNAGLDVTVFDNFCNSHPEALRRVER
FT                   ITGKKLRVVQGDCRDRSSVTKALHESQATAVIHFAGLKAVGESVKQPLAYYDNNVVGTL
FT                   RLLEAMNECGVKTLVFSSSATVYGEPRRLPLTEDHPLSATNPYGRSKLMIEEILRDVYR
FT                   SDSSWRCAILRYFNPVGAHPSGLIGEDPRGTPDNLMPFVAQVAIGRREYLNVWGNDYPT
FT                   PDGTGVRDYIHVVDLALGHLKALEALENPEVRNAEAVDRQGGCLTVNLGTGTGYSVLEM
FT                   IRAFEKASGQKVSYRIASRRPGDIASCYAEPGLASDLLGWRAKRGLEEMCVDTWHWQNQ
FT                   NPEGYGSESSHLD"
FT   gene            282254..283699
FT                   /locus_tag="Nmul_A0261"
FT   CDS_pept        282254..283699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0261"
FT                   /product="mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73569"
FT                   /db_xref="GOA:Q2YCF2"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF2"
FT                   /protein_id="ABB73569.1"
FT                   /translation="MQSLVPIVLSGGSGTRLWPLSRQKYPKQLLSFIGEDSLLQATLRR
FT                   MEGLTDVELGAPLVICNEEYRFVIAEQLRLMGTKGNILLEPVGRNTAPALTLAALAAMR
FT                   DGGDPVLLVMPADHVIVDVPCFQMAIRAGMGLAAGGAVVTFGITPDSPETGYGYIEAGE
FT                   ALGKGGASRIARFVEKPDRATAQTYLETGSYFWNSGLFMMTASVWLAVIDACRPDISTA
FT                   CRAAWEKGVVDGDFLRVNKEEFLRCPSDSIDYAVMERLAHDDSLPAGVFIPLSAGWSDV
FT                   GSWDSLWQVLPKDHQGNVSQGDVLLNDCRNVLALSEHRLVACVGIEDMVVIETPDAILV
FT                   AHMNKTQHVKKIVDDLKRKGRPESELHRKVFRPWGWYDGVDSGERFQVKRIVVKPGASL
FT                   SLQMHHHRAEHWIVVHGTAQVTRGDTTYLVSENESTFIPLGTRHRLQNPGCVPLEMIEV
FT                   QSGSYLGEDDIVRFEDVYGRKES"
FT   gene            283861..284481
FT                   /locus_tag="Nmul_A0262"
FT   CDS_pept        283861..284481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73570"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF1"
FT                   /protein_id="ABB73570.1"
FT                   /translation="MQDRLATSMYMTIRRYKMTKFPVKHAIAVAVLAGASMGAQADTMT
FT                   DLGTLSTSTPTTFSGIVGPTHAGFSDIFTFTPQEPNFGAGATVVNLPLSFGGFSFDTAL
FT                   ATMSLVSAGADGIAGNSDDSVLQSVVLPSPGNSQDSLTLHWDTPMSGLHYLNITGVAVG
FT                   SEGGIYSGAIAAAIPEPETYAMLLAGLGLMGAVVRRRGMRKTS"
FT   sig_peptide     283861..283986
FT                   /locus_tag="Nmul_A0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 42"
FT   gene            complement(285113..285189)
FT                   /locus_tag="Nmul_AR0010"
FT   tRNA            complement(285113..285189)
FT                   /locus_tag="Nmul_AR0010"
FT                   /product="tRNA-Val"
FT                   /note="tRNA-Val3"
FT   gene            285301..286032
FT                   /locus_tag="Nmul_A0263"
FT   CDS_pept        285301..286032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0263"
FT                   /product="ribosomal large subunit pseudouridine synthase F"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73571"
FT                   /db_xref="GOA:Q2YCF0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCF0"
FT                   /protein_id="ABB73571.1"
FT                   /translation="MEKIRLSKLMSQKGLCSRREADDYIERGWVFVDGERISQLGIKVF
FT                   PTQEIKLARMAQAQQCDQITVLLHKPVGYVSGQPERGYKPAISLINRESEFQDSKASSS
FT                   FSPLNLKGMAPAGRLDIDSSGLLVFTQDGRIARKLIGAESEIEKEYLVRAEGEVSQRTL
FT                   NLLSHGLSLDGQALKRAVVVQQNKDQLRFILKEGRKRQIRRMCELVGLKVTGLKRVRIG
FT                   KVRLGELPLGKWRYLRPGEEF"
FT   gene            286146..287207
FT                   /locus_tag="Nmul_A0264"
FT   CDS_pept        286146..287207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0264"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73572"
FT                   /db_xref="GOA:Q2YCE9"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE9"
FT                   /protein_id="ABB73572.1"
FT                   /translation="MILVTGGAGFIGANFVLDWLERSDEAIINLDVLTYAGNLENLKTL
FT                   EGDKRHVFVQGDIGNSDLLIHLLKDYRPRAILNFAAESHVDRSIHGPEDFIQTNIVGTF
FT                   RLLEASRDYWSRLKENEKQQFRFLHVSTDEVYGSLAKDEMPFTETHRYEPNSPYSASKA
FT                   ASDHLVRAYHHTYGLPVLTTNCSNNYGPYQFPEKLIPLMIVNALAGKSLPVYGDGQQIR
FT                   DWLYVKDHCSAIRRVLEDGIPGQIYNIGGWNEKPNIEIVETICSLLDTFRPREGHSYRN
FT                   LIKYVADRPGHDRRYAIDASKIERELGWRPAETFETGISKTVQWYLDNAAWVTHVQSGA
FT                   YRHWVEKNYKERA"
FT   gene            287207..288109
FT                   /locus_tag="Nmul_A0265"
FT   CDS_pept        287207..288109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0265"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73573"
FT                   /db_xref="GOA:Q2YCE8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE8"
FT                   /protein_id="ABB73573.1"
FT                   /translation="MKILLFGKDGQVGWELQRSLAPLGEIVALDFGSQEYCGDFTRCDG
FT                   IADTVRTVVPDVIVNAAAYTAVDKAESEPERVRIINALAPAILAREAGKLGAWLVHYST
FT                   DYVFDGGGSAPRVETDPPAPLNMYGITKLEGEQAILTADCNHLIFRTSWVFAARGSNFA
FT                   KTMLRLAQQRDSLNVIDDQVGAPTGAELLADITAHVIRISRQRQNISGLYHLAAAGETS
FT                   WYGYANFVLNFARQRGVKLTAAPENVFPIASNEFPSAARRPKNSRLDTAKLQSTFDLSL
FT                   PSWETGVARMLTEILEKPL"
FT   gene            288106..288993
FT                   /locus_tag="Nmul_A0266"
FT   CDS_pept        288106..288993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0266"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73574"
FT                   /db_xref="GOA:Q2YCE7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE7"
FT                   /protein_id="ABB73574.1"
FT                   /translation="MIQRKGIILAGGSGTRLYPVTKAVSKQLLPIYDKPMIYYPLSTLM
FT                   LAGIRDILIISTPQDTSRFEQLLGDGGGWGLNLQYAVQNSPDGLAHAFIIGRDFIGRDS
FT                   SALVLGDNIFYGHDLHLQLQRAMERQEGATVFAYHVQDPQRYGVVAFDANHRVSSLEEK
FT                   PAQPKSNYAVTGLYFYDNQVVDIASDLKPSARGELEITDVNRTYLKHNQLNVEIMGRGY
FT                   AWLDTGTHESLIEASNFIETIEHRQGLKVACPEEIAFRQGFISSEQLEKLAQPLAKNGY
FT                   GQYLKRLLEEQVVT"
FT   gene            288990..289541
FT                   /locus_tag="Nmul_A0267"
FT   CDS_pept        288990..289541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0267"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73575"
FT                   /db_xref="GOA:Q2YCE6"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE6"
FT                   /protein_id="ABB73575.1"
FT                   /translation="MKVIATSIPEVMIIEPKVFGDSRGFFFESFNQENFRQATGLDVRF
FT                   VQDNHSRSVKGVLRGLHYQVRRPQGKLVRVVRGAVFDVAVDIRRSSPTFGHWVGVELTE
FT                   DNYRQLWLPPGFAHGFYVLSDIADFLYKTTEYYFSDFDRSILWNDPGIAIGWPIEAGVS
FT                   PVVSSKDEKAARLVHAEVFE"
FT   gene            289580..290752
FT                   /locus_tag="Nmul_A0268"
FT   CDS_pept        289580..290752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0268"
FT                   /product="Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73576"
FT                   /db_xref="GOA:Q2YCE5"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE5"
FT                   /protein_id="ABB73576.1"
FT                   /translation="MWKGSRWRVRSSRYQTKNSEYPEMMQIQPGQEFPLREAHNLVRDL
FT                   MTPNPWIYWLDFLFHISLGWTAFLIILSMPLFSFWQLLAMLVATFAFYRAAIFVHELAH
FT                   LRKGTFGFFRIIWNVTCGIPLLVPSFTYDGVHNDHHRRDVYGTAGDGEYIPFATLKPMV
FT                   MVGYVLLSFILPLFFIVRFLLLTPLSYFIPPLRRILWERASSLTIDMNYKRAPNAIRND
FT                   RHWRIQEFGAFLFITAVVTCIALGILTPWFLVFWYVIAMFIFFINSLRTLSAHAYRNPG
FT                   DGPMGFAEQYLDSINVPGNFLTGLWAPVGLRYHATHHLFMSMPYHNLAEAQRRLVNGLS
FT                   DNTLYLTTVRAGMWDALRRIWEEAVANTRRNAASATVVELDDSVGRHRNA"
FT   gene            complement(290758..291105)
FT                   /locus_tag="Nmul_A0269"
FT   CDS_pept        complement(290758..291105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73577"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE4"
FT                   /protein_id="ABB73577.1"
FT                   /translation="MTKEKGKGWLQTGFVLAPTRFQPALPLYPAYSAKPLEPLDAYRIT
FT                   QAKETITPLLTYMEAGRGGCPQPDLPRLNQEQSSLHRTALEHVSAPNLEAVEIRNQKEC
FT                   LMNRISGACNK"
FT   gene            291260..292534
FT                   /locus_tag="Nmul_A0270"
FT   CDS_pept        291260..292534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0270"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73578"
FT                   /db_xref="GOA:Q2YCE3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE3"
FT                   /protein_id="ABB73578.1"
FT                   /translation="MVAVVGLGYVGLPLAVEFGKKRKTIGYDLSSSKIASYKQFIDPTG
FT                   EVSSDDLKAAKQLHVTTDPAELSQADYIVVAVPTPVDAAHQPDFRPLIGASETVGKHMK
FT                   RGAIVIYESTVYPGATEEVCIPVLEKHSGMKWKDDFHVGFSPERINPGDKQHTLTKILK
FT                   VVSGDDEDTLEKIAALYESIITAGVHRASSIKVAEAAKVIENTQRDLNIALMNELAIIF
FT                   DKLDIDTLEVLQAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAEMVGYIPQVILAGRR
FT                   INDSMAKFVAEQTIKHIIKADINVRSARVNVLGLAFKENCPDLRNSKVADLISELKSYG
FT                   IEIHVHDPVASIEEARHEYGVELESWEDLPRADAMIVAVAHRQFTEMPLTQFQTKITDK
FT                   GCFIDVKSQFDPAALREAGLNVWRL"
FT   gene            292552..293604
FT                   /locus_tag="Nmul_A0271"
FT   CDS_pept        292552..293604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0271"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73579"
FT                   /db_xref="GOA:Q2YCE2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE2"
FT                   /protein_id="ABB73579.1"
FT                   /translation="MAAYPKWLRHLQDHSYCWLVTGVAGFIGSNLLEALLKHNQKVVGL
FT                   DNFSTGYLRNLEQIRDLVGEKAWGNFSFIEGDICQLETCTNACQGVDFVLHQAALGSVP
FT                   RSIQDPIRTNEANISGFLNMLVASRDAQVRRFIYAASSSTYGDHPDLPKVEAVIGRPLS
FT                   PYAVTKYVNELYAEVFARCYGLDSIGLRYFNVFGPRQDPNGAYAAVIPQWVSALIRNQT
FT                   LYINGDGETSRDFCYIDNVVQANLLAALSDNTGAVNQIYNVAVNERTSLNQLYGMMREL
FT                   LLEKFPELENHRPTYVDFRKGDVRHSQADITKATQLLGFEPSHRIGEGLRQAMGWYIAH
FT                   LGAMQEAAGV"
FT   gene            complement(293649..294263)
FT                   /locus_tag="Nmul_A0272"
FT   CDS_pept        complement(293649..294263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73580"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE1"
FT                   /protein_id="ABB73580.1"
FT                   /translation="MKVIPGIAILVISLIAPDLHATSSAYCGELINVHDYIGGDKQLLG
FT                   TVEQHHFTSNIESLRHGNTGTLGGDLSYTLMLFPNHHRALAAFSKLSLRDKTLKPAGAK
FT                   YSVGCFFDRAIRFKPNDAVVRMVYGDYLLKAGQTDKATEELGIAIDLEPENPTINYNLG
FT                   LLYLKQKNYEQAKTYAKKAYELGFPLPGLKNQLKQAGKWDE"
FT   sig_peptide     complement(294198..294263)
FT                   /locus_tag="Nmul_A0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.782) with cleavage site probability 0.781 at
FT                   residue 22"
FT   gene            complement(294505..295383)
FT                   /locus_tag="Nmul_A0273"
FT   CDS_pept        complement(294505..295383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0273"
FT                   /product="esterase/lipase/thioesterase family active site
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73581"
FT                   /db_xref="InterPro:IPR017531"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCE0"
FT                   /protein_id="ABB73581.1"
FT                   /translation="MMNYEERPIVFCCGSDCLYGILTLPEQAASRGILILVGGPQYRAG
FT                   SHRQFTLLARHLAANGIPVFRFDFRGMGDSEGDARTFENVKDDVRSGIDRLFAEIPSLN
FT                   ELVILGLCDAASAALFYAYQDPRVTGLVLLNPWVRTEEGSARAYLKHYYISRIFDRELW
FT                   GKIWSGNFNYAASARSLFGTIGTVVAERGEIAPPAAKNNCKSGCEAAPLPERMFQGLER
FT                   FQGRVLLILCGNDLTAQEFSELVKGSQKWKKLLASPHFSRFSLPEANHTFSRREWRDQI
FT                   ARWTKEWLYSW"
FT   gene            complement(295380..296231)
FT                   /locus_tag="Nmul_A0274"
FT   CDS_pept        complement(295380..296231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0274"
FT                   /product="esterase/lipase/thioesterase family active site
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73582"
FT                   /db_xref="GOA:Q2YCD9"
FT                   /db_xref="InterPro:IPR017532"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD9"
FT                   /protein_id="ABB73582.1"
FT                   /translation="MKMDPGSIHAEPFFLQTELGQRFCLFHQPHPGRKCQGTILYVHPF
FT                   GDEMNKARRMAAVQARAFAAIGWGVLQMDLFGCGDSSGEFRDARWDIWKQDLARARLWL
FT                   ESRLAVPVSLWGLRLGALLALDFAQDAANAVDRIILWQPVISGETFLSQFLRLRMAGEL
FT                   FSTVSEEKSTGTAMLRKQMEEGETLEIAGYELAPGLANAIDGLKAAELAVGKSAVHWFE
FT                   IIPEPGRSMTSAGAKITEKWKQKGVDLHVHLIPCQPFWATQEISECAELISATTSVFAL
FT                   AA"
FT   gene            complement(296228..296479)
FT                   /locus_tag="Nmul_A0275"
FT   CDS_pept        complement(296228..296479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73583"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD8"
FT                   /protein_id="ABB73583.1"
FT                   /translation="MQHIEEVRNILSDVLSLGERRNSLNADSPLLGAIPELDSMAVVNV
FT                   ITALEDHFDITVDDDEISAKTFETVGSLTQFVEQKLAE"
FT   gene            296883..298358
FT                   /locus_tag="Nmul_A0276"
FT   CDS_pept        296883..298358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73584"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD7"
FT                   /protein_id="ABB73584.1"
FT                   /translation="MKKLKEFRKLKSGEDSAGSSNVRPAGPILPVLFVAASFPVCMGQV
FT                   NAETSFERLSSLLAGTPQGGWVKASTNLFSDAWATGADAAPGPTSAVVRAWSSFAWDSA
FT                   RGDLLLWGGGHGNYVGNEMYVWDGATGSWGRGSLASRIDSKGFIVDNAAPQSAHTYDNN
FT                   VYLPANDMFLTFGGAAAPGGGAFLQTDGTNVSVAGPFMWDPRKADPNKVGGTTGSGWNT
FT                   THIAQGGNMWLDRHVSTATHIDGTTAYRMENGKDVVYVTADMAASGFPSLYRYTAGDVR
FT                   SGGQDTWERVGRSWNTVGYQGAGTIDTDHNLYIRTASPRPSYASDLTIWDLDNANPDHN
FT                   WDIGINLVKADGSDFVMTPYFGIDYDSANNSIVLWDGRDGGGTVWSANVLTDADGNIGS
FT                   HTTWVVHEIESATGDHPLGNHETGVLGKWKYDPTLGAFIALDEAAKTADGKWDAAVWLY
FT                   KPVAGPVPEPQAYALLLAGLGLIGWAVRGRRAG"
FT   sig_peptide     296883..297026
FT                   /locus_tag="Nmul_A0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.649) with cleavage site probability 0.602 at
FT                   residue 48"
FT   gene            298881..300002
FT                   /locus_tag="Nmul_A0277"
FT   CDS_pept        298881..300002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0277"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73585"
FT                   /db_xref="GOA:Q2YCD6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD6"
FT                   /protein_id="ABB73585.1"
FT                   /translation="MATLKVVVILPTYNERDNIGIMIDALEVQAREFLHDMHLLVVDDD
FT                   SPDGTAEVVRAKQTVYPNVHLLRGKKAGLGAAYIRGMIHAMDELHADVVFEMDADFSHK
FT                   PEDVPRLMAALDGGADFVIGSRYVKGGSIPQEWGFLRRMNSLGGNIVARYVAGMYRIRD
FT                   CTAGFRAIKTNLLRKIIFDDLRVQGYAFQVALLHKAVSLGAVIKEVPVDFVDRAKGESK
FT                   LGISDIIEFILNAWWIRLHSSKTFIKFAIVGLSGVIVNLGVFTLLLQANVNKYLASPIS
FT                   IEISIITNFLLNNYWTFRWRTSQDHIRVKGLKFNMVSLVSLGVSYSTFVVLSVLFPDVS
FT                   PEIHQLVGIAPAMFINYFLNSYWTFKNTPAPKD"
FT   gene            300168..301526
FT                   /locus_tag="Nmul_A0278"
FT   CDS_pept        300168..301526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0278"
FT                   /product="Glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73586"
FT                   /db_xref="GOA:Q2YCD5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD5"
FT                   /protein_id="ABB73586.1"
FT                   /translation="MNTLPDPESNIEGIHRFRRRHRIAAPLFQLLDSHVFLPACFILFV
FT                   ALRVALIFFVPVEMTSDASWYFNRAVGIASGGGYSEAGYPTAYWPVGYPGFLGILFYLF
FT                   GRDQLVGQIANLVMAALSFFLQLELTRRIFRSEAAARLGVLLLTLYPNHVAYTSFILTE
FT                   VYFTFLLLLGVYLYITRSRWLWIWVCGIVFGLAALTKPQAVFLPGLLVLFHVFSAERKD
FT                   RLRQHLIKGFAIYLAMAMVLVPWAVRNTMIFGELVLISTNGGATLLTGNHPTASGGYEE
FT                   NDPLVAQRNFSVQDQVESDRRAKKLATDWIRENPVRFVELIPLKIWHLWSRNGEAEWAY
FT                   QAGYRYYEQYSGAFRTMRWINQIFYALLLVGSFAAAFLLIRHPDKVAWPWVLVGYCLMI
FT                   YLTLISVVFSGQPRFHFPAMPWAIMYAAWAAVMITVNQTRERYDAYVSRTSDF"
FT   gene            301733..302683
FT                   /locus_tag="Nmul_A0279"
FT   CDS_pept        301733..302683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0279"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73587"
FT                   /db_xref="GOA:Q2YCD4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD4"
FT                   /protein_id="ABB73587.1"
FT                   /translation="MPLEISIVSTMYRSRPFLDRFLAESLQALSAIKCDHFEILLVNDG
FT                   SPDESLAYALERRRDIPQLVVVDLARNFGHHAAIQAGLRHARGNLVFLIDCDLEVSPLV
FT                   LAEFYSKLRETKSDVVFGYQDVRKGGRFEQISGGLFWKGFNLLSDVKIPENILTERIMT
FT                   RRYVEALLQMGDRNLFLGGMMSWTGFQQIGLPVVKKQREGRSTYTLLRRIGLMINAVSS
FT                   FSAQPLIWLFNIGVVITLLSFSFAFYLVLRKLLFDDTLMGFTSVMTMMMLSLGILTTAM
FT                   GLVGIYLGKVFNQVQNRPNYIVRNIFTADDQPATD"
FT   gene            302781..303497
FT                   /locus_tag="Nmul_A0280"
FT   CDS_pept        302781..303497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73588"
FT                   /db_xref="GOA:Q2YCD3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD3"
FT                   /protein_id="ABB73588.1"
FT                   /translation="MSLENEQDPTAYDRTYVLDNRLTLQWYPQRVVAMAQTGSMLELGL
FT                   GHGYSTEYFAKTFQRYQVIEGSQEMIDRFREHFAIEGVDIAQGYFEDFETDERFDAIGM
FT                   GFVLEHVDNPAAIIRRYAQFLSPGGSIYIAVPNAESLHRRLGHAAGLLPDMYALSSADL
FT                   EFGHKRYFSLESLVEMVEGEGLEIRKVEGLLLKPITTQQILDLNLSEAILQAMLKVGVD
FT                   YPELCNSLLIQASKLR"
FT   gene            303549..303974
FT                   /locus_tag="Nmul_A0281"
FT   CDS_pept        303549..303974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0281"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73589"
FT                   /db_xref="GOA:Q2YCD2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD2"
FT                   /protein_id="ABB73589.1"
FT                   /translation="MQFSMQAFALRFHHFGLASRRPEQTLKFLKGLGHEVARQVYDPLQ
FT                   NVNLWLCPHSSMPTVELVAPAEGQGPLDAILTQASESIYHLCYETENLKASLEALKAGG
FT                   FRVICVSPPKPAILFDDRRVSFYMIKDFGIIELLESR"
FT   gene            303990..305768
FT                   /locus_tag="Nmul_A0282"
FT   CDS_pept        303990..305768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0282"
FT                   /product="FkbH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73590"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD1"
FT                   /protein_id="ABB73590.1"
FT                   /translation="MFTAVSSFPGDIPPTLSDLISTSDTMDAAMSSTAPAYRFGFLRNV
FT                   TLEGIEPYLRYHMLRMGLRPELIFGGYGSIRQDLILPDSPLVKYCPDLLVTAFMLEELD
FT                   PHYGLPGWNASHCREELSTIFDALAASDAPTISLNTFIVPFRSETGTLIAAQDIASEVI
FT                   RLNDFVRTFVREHSPRFCIMDWDRLAHRIGEAEAMDYRYWYISKAPFKRSFLDALAREL
FT                   TKVVLALKGHTKKCLVLDCDNTLWGGVVGEDGIEGIHLDGHDYPGRAYYDFQKTVLQLA
FT                   ERGVLITLCSKNNEQDVLDVLDKHPWSLLKRNHLSGFRINWDDKAANLVELAKELNLGL
FT                   DAFVFVDDNRRELELIRQVLPQVTTLQVPDRLYEYPALLQRDGLFDTLITSQEDKLRTS
FT                   LYQTEAQRKAERNQHPDLESYLLSLQLVVNIQVATDREAMRVVQLTQKTNQFNLTTRRY
FT                   SDHDIARFRSSKDACVYTLSASDRFGSLGLVGVFIVQRRQETAVVDSLLMSCRALGRRL
FT                   EIAFVLECMRRVVADWGILAWEAEYLSTAKNSQVADFWSTLGFALLEQAEGYRRYRLQA
FT                   AMPEIDPPSFIHIERE"
FT   gene            305777..306013
FT                   /locus_tag="Nmul_A0283"
FT   CDS_pept        305777..306013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0283"
FT                   /product="acyl carrier protein, ACP"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73591"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCD0"
FT                   /protein_id="ABB73591.1"
FT                   /translation="MSDIENRTRDVMAKVLQIAPQDISPDISRKNLPAWDSLKHMNLIL
FT                   ALEEEFGIEFSDKEIADLNSLHLLVDALRTKHS"
FT   gene            306010..306690
FT                   /locus_tag="Nmul_A0284"
FT   CDS_pept        306010..306690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0284"
FT                   /product="transferase hexapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73592"
FT                   /db_xref="GOA:Q2YCC9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC9"
FT                   /protein_id="ABB73592.1"
FT                   /translation="MNGQSDRPLVIFGVGELAQLACYYFTHDSPRRVAAFTVDRTHFRE
FT                   NQCMGLPVLAFDEVDTRYAPEEYDMFVALGYTRLNRARAEKCVEAKSRGYRLATYVSSR
FT                   SVTWPDLIVGENCFIMEGNVIQPFVRIGNNVIIWCGSLVSHHVEIDDHCFIAAHAVISG
FT                   HVKIGAHSFIGVNATLRDKITLAERTLLGAGALVTASTDENTAYLTAPSQEAGVPSHRL
FT                   QSLL"
FT   gene            306703..307431
FT                   /locus_tag="Nmul_A0285"
FT   CDS_pept        306703..307431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73593"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC8"
FT                   /protein_id="ABB73593.1"
FT                   /translation="MQARHNKVAILQSNYIPWKGYFDLIHDVDLFIFYDDVQYTLRDWR
FT                   NRNRIKTPRGVDWLTVPTNGTRQHLICEVEFTDPRWQSKHWETLRHNYGKTPYFERYRP
FT                   FFEDVYLGRRWDHLSQLNQYLIEQISHQFLGITTIFADSRRYRATGEKQARIVDLLTKA
FT                   AASLYVSGPAARSYIDEAHFSRIGIELVWKDYGGYPEYPQSHPPFEHAVTILDLLFHTG
FT                   PEAPYYIWGWRANVDSNNDK"
FT   gene            307428..307793
FT                   /locus_tag="Nmul_A0286"
FT   CDS_pept        307428..307793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73594"
FT                   /db_xref="GOA:Q2YCC7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC7"
FT                   /protein_id="ABB73594.1"
FT                   /translation="MISYFYIFLTIVFTVYGQIVLKWQVIGAGEFPASASDKILFLARL
FT                   VLNPWVISGFLAAFLASLTWMAAMTKLELSHGYPFMSLNFVFVIVLSNLLFHEAITMPK
FT                   MLGLGLIILGIAVGSRG"
FT   gene            307790..308668
FT                   /locus_tag="Nmul_A0287"
FT   CDS_pept        307790..308668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0287"
FT                   /product="generic methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73595"
FT                   /db_xref="GOA:Q2YCC6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC6"
FT                   /protein_id="ABB73595.1"
FT                   /translation="MKICLSCSARFTDSGWRCPVCFSTPEQVDGFLSFAPAQAKSDEGF
FT                   QPHHFNELAQAEAEHFWFRSRNRLIIWALHRFFPDARKFLEIGCGTGFVLSGIAQDNPR
FT                   LEISGSEIHSAGLSHAADRARNATLFQMDARDIPFDSEFDVIGAFDVLEHIEEDSQVLL
FT                   QMFRAISPGGGMIVTVPQHRFLWSQQDEHACHVRRYEAQELQDKVEKAGFRVEKATSFV
FT                   SLLLPLMFISRLSKRKPVENYDPTQEFRIKKWVNTILEGILDLERLMIRGRVSFPMGGS
FT                   RLLIARKPAGA"
FT   gene            308676..309800
FT                   /locus_tag="Nmul_A0288"
FT   CDS_pept        308676..309800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0288"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73596"
FT                   /db_xref="GOA:Q2YCC5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC5"
FT                   /protein_id="ABB73596.1"
FT                   /translation="MQIPFNKPYMTGKELWYVSQAHANGHLAGDGVFTKKCNAWLERRI
FT                   GCKKALLTHSCTAALEMAAILAQIGPGDEVIMPSYTFVSTANAFALRGGVPVFVDIRPD
FT                   TFNIDETLIEAAITPKTKAIVAVHYAGVGCEMDAIMSIAERYGLFVIEDAAQGLMSTYK
FT                   GRPLGSIGHLAALSFHETKNIISGEGGALLVNDARFAEQAEIIREKGTNRSQFFRGQVD
FT                   KYTWVDFGSSYLPSELIAAFLWAQIEEADAITQRRLDIWDVYHANFELLEKQGKIHRPT
FT                   IPSDCMHNAHMYYLLLPDLDRRTAFINALRQKGIGTVFHYVPLDSSPMGEKWGRKSGAL
FT                   TRTRELSDRLVRLPLWLGLEEYQNEVIQHVAAEL"
FT   gene            309931..311148
FT                   /locus_tag="Nmul_A0289"
FT   CDS_pept        309931..311148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0289"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73597"
FT                   /db_xref="GOA:Q2YCC4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR024004"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC4"
FT                   /protein_id="ABB73597.1"
FT                   /translation="MRILHILDHSIPLHSGYTFRTLSILNEQRNLGWETFHLTGSKQEN
FT                   CSVLEECVEGWHFYRTPAPSGLRARLPVLNQLAVMEALTHRLTEVVKIVEPDILHAHSP
FT                   VLNALPALRVGRRSGIPVVYEVRAFWEDAAVDHGTHREWGARYRLTRELESYALRHVDA
FT                   VTTICEGLRGDILKRGIPSEKVTVIPNAVNLETFRMSERGDLQLANALGMEGKVLLGFI
FT                   GSFYAYEGLTVLLNALPRMLAANPDIRILLVGGGPQEDELKSLTARRGLQGKVIFTGRV
FT                   PHDQVRRYYNLIDILVYPRLPMRLTDLVTPLKPLEAMAQGRLVAASDVGGHLELIQDGK
FT                   TGVLFKAGDSDALAARILNLISSTDTWDTLRAGARDFVETQRNWAGSVAGYKEIYRTLL
FT                   SRKASS"
FT   gene            311145..312257
FT                   /locus_tag="Nmul_A0290"
FT   CDS_pept        311145..312257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0290"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73598"
FT                   /db_xref="GOA:Q2YCC3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC3"
FT                   /protein_id="ABB73598.1"
FT                   /translation="MKAGLRIGLVGPLPPPSGGMANQTLQLAGLLREEHVEVELIQVNR
FT                   PYRPGWIGRFKGIRAGFRLLSYVSQLWLSAGRVQLFHVMANSGWSWHLFAAPAIWIARL
FT                   RGKPVIINYRGGEADSFFDKAFSWVKPSLSRANAIIVPSGFLEGVFGKRGFSASIVPNI
FT                   IDLSRFGAGMRSDTSTVEAGPDSPHIIVTRNLEPIYDNETALRAFHIVRRSFPAAKLTL
FT                   AGSGPERHTLEQLAFALGIGGAVTFTGRVDNEGMAAIYRSASVMLNPSLADNMPISILE
FT                   ALASGVPVVSTNVGGVPYLVEHEKNALLVPARDPQAMANAVLRLLNDAARTRRLIEAGM
FT                   ECVQRYTWPNVRVPLFRVYEQVLAAPDRSC"
FT   gene            312280..313641
FT                   /locus_tag="Nmul_A0291"
FT   CDS_pept        312280..313641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0291"
FT                   /product="possible CapK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73599"
FT                   /db_xref="GOA:Q2YCC2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC2"
FT                   /protein_id="ABB73599.1"
FT                   /translation="MKNRDWYTSLVSGLLFPLQERLKDHSTVSVRKALELSQWWNRERL
FT                   ENLQLLKLRHLLAEAEAHVPYYRRIFAEIGFKAAEVSSLADLARLPLLDKPAIRADTEA
FT                   LKSQKARSLRSFNTGGSSGEPLTFYIGRERVSHDVAAKWRATRWWDVDIGDPEMVVWGS
FT                   PIELGAQDRLRMLRDRLLRTRLFPAFEMSEQKLDRFLGELRAAPPRMFFGYPSALSHIA
FT                   RHAQARGQRMDDLGINVAFVTSERLYDEQRQQISKTFGCPVANGYGGRDAGFIAHECPE
FT                   GGMHITAEDIIVEIVDRQGVPLPCGEAGEIIVTHLSTAEFPFIRYRTGDIGILDDRICR
FT                   CGRGLPLLREIQGRSTDFVVAQDGTVMHGLALIYILRELPQISHFKIIQESLNLIHIWV
FT                   VSGAKLDREITAKIEEEFKARLGQSVEVLIEETTEIPAEKSGKFRYVISKIAGA"
FT   gene            313774..315273
FT                   /locus_tag="Nmul_A0292"
FT   CDS_pept        313774..315273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0292"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73600"
FT                   /db_xref="GOA:Q2YCC1"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC1"
FT                   /protein_id="ABB73600.1"
FT                   /translation="MDKQQHQSDITAKVLYGARWSAMLRVTGQMVSWLSTIIVVRFIRP
FT                   EDYGLNAMLEAPLELLMLLSTFGLDLALVRWKTIEQEELRSVFGSLLIINGLLFLVYFF
FT                   GGSLMAAYFDEPRLESLAQVLAFVFILAPFRVIPNALLDRNLKFKLRALAEFIANISAA
FT                   VATLVLAILGWGVWALVSGVLINRILLAIILMVLQPWFIMPSLNFPAVRAMMVFGGVLS
FT                   LGGAVVLVTDKLATLIAGPVLGAELLGIFAVTFQFALLPLAKIMPVINPIIFPAFSKFQ
FT                   DQPGVATYYLSKSLGIVSLALFPVMIGLACIAQEFVATVLGNKWAAVALPLALLSTVMP
FT                   FRMTTSFLRPVLASMGRADLSLKSAVFALIILLPLILVGAHYGVMGLVMAMVVTELIVV
FT                   FLTIGMSKAVLHTSFTGIALSLRPAIAASTVMAACLMGAKIALGDAFGSSANLITLLIE
FT                   ISFGALVYFLTLRIFYGKLLDDTIRLFLGRNGGLAHLPNES"
FT   gene            complement(315317..317155)
FT                   /locus_tag="Nmul_A0293"
FT   CDS_pept        complement(315317..317155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73601"
FT                   /db_xref="GOA:Q2YCC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCC0"
FT                   /protein_id="ABB73601.1"
FT                   /translation="MNFTKNNPESYLSFLVVKSVLFWLVAILASMTILTHIAQVSGITF
FT                   KIYARLGLFLTLGMSLLAWNFFRRQYGQRVLQDLGTLSFLILTGLGGAFISSFFHTGAG
FT                   KVSFDLFYYVPNAVYYLQNPDLPMGFAIHFMEAGSEPITSYFGATSLPYEYTLGVLAYF
FT                   LNIPYLSAFFLVSPALLGFLIPLTLFYLVAQFVDPKPAAVGALFAVAIILLLGETPRTP
FT                   GTWSFPNVFIGKVFFLSTGIPLFAAATINFFRTYSLSDWMLTFAVTTAMVGATSSSMAL
FT                   LPVLTIAVVIACAAANEGSYKQFLKNAITYAFSLSYLVLYTLLMFLNFHSDLSANSPVN
FT                   EDFPVTFLGHAGFFFEKSGPATPLALLGATVLGLLMTSGKTRRFLLAWIGAALVLFLNP
FT                   IVSPFIIKYLTTPNIYWRVFYVYPLPLLLGLTGAGLYEYVEKYSRTVRLAFISGTVFLL
FT                   FIAHFVPFTTSVLYLRTEFGWPRYKLPARFEKAASDVIAVVPPGPMLAPLPVNGIITML
FT                   SGNYPQMRVFTDAERVWFRERGLGTEIDQRICASEFVNGDEPDCLPAFQTLLEYENLRS
FT                   VVIAKNTAADPRVQNALTRNGFANSKEIGDLLVYWR"
FT   sig_peptide     complement(317033..317155)
FT                   /locus_tag="Nmul_A0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.700) with cleavage site probability 0.519 at
FT                   residue 41"
FT   gene            complement(317268..318161)
FT                   /locus_tag="Nmul_A0294"
FT   CDS_pept        complement(317268..318161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73602"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB9"
FT                   /protein_id="ABB73602.1"
FT                   /translation="MTEKKTMLEKLKKLMHHFTLSLDDISVETSRARQLSIRTEIDRLR
FT                   SNERYKEPKSLIPFGGKIYSQNDEDGIIREIFNRIGTTNKVFVEFGIGNGLENNTLALL
FT                   FEDWQGLWIDASSDSITSIRNHFSEIIGSGKLAVVESFITKANIDNLIATNVKHREIDL
FT                   LSVDIDGNDYHVLQAISCITPRVIVIEYNAKFAPPVLFCMDYTETHMWTGDDCFGASLK
FT                   FLETNLNKMGYCLVGCNLTGANAFFIRRELVTNKFLEPFTAENHFEPARYYLSGYASGH
FT                   TPTYETLARSLTMRVS"
FT   gene            complement(318201..319094)
FT                   /locus_tag="Nmul_A0295"
FT   CDS_pept        complement(318201..319094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0295"
FT                   /product="Methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73603"
FT                   /db_xref="GOA:Q2YCB8"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB8"
FT                   /protein_id="ABB73603.1"
FT                   /translation="MRMSRIQARLLQAIVRPALKTNLLKHAAWRVVLKLRNEFAHAVPP
FT                   VELETTFDENIRILTSLSDHIESQVFWQGFQEADEGVILLLKRFLPSDGSFIDVGANIG
FT                   TFTLVAAHRAVRGQVHAFEPSAHHFARLAHNVELNDFKNVALNRKGLYDQPGEAVLFLP
FT                   SQTGEMNNSGAASLYTSALEETRQVSEAVSLIRLDDYVREKSIGRVDIIKIDIEGAELK
FT                   ALEGARETIARFRPLVFMELDLDNLERAERSPEEVLQYWKSLNYEVSIILLTGETVPVT
FT                   SPKEFGLHQNLQCRPF"
FT   gene            complement(319145..320185)
FT                   /locus_tag="Nmul_A0296"
FT   CDS_pept        complement(319145..320185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0296"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73604"
FT                   /db_xref="GOA:Q2YCB7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB7"
FT                   /protein_id="ABB73604.1"
FT                   /translation="MKDSALRVGIYQGPEIPQSFKVYAENVWRHLPKQDIATIPFKDRK
FT                   DLPKSADVLWDIRSGGGNPPPDFLLEHPLPPLVVTVHGFAPLSLNGWEYFRTLKGLIMS
FT                   GQYAKHKRERWREVRTAVGSIIAVSAFVKDEAIRFTGVPADRIHVCHHGVDGNAFTPGP
FT                   DTESEPYFFHVSNDEPRKNVGAIVRAFRQLRRHCRVQLVLKLPEESARNYEKIEGIRVL
FT                   SGFLTTEELVHLYRHALAFIFPSLYEGFGLPILEAMACGCPVITSNVSACREIAGEAAR
FT                   TINPRNESELLEAMEILYRNPEERRARTAMGLRRALGFSWEESAKCHARVLYMTADRNA
FT                   PVASPD"
FT   gene            320636..321577
FT                   /locus_tag="Nmul_A0297"
FT   CDS_pept        320636..321577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0297"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73605"
FT                   /db_xref="GOA:Q2YCB6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB6"
FT                   /protein_id="ABB73605.1"
FT                   /translation="MAASKPTVSIIIPTYNCEAYIAETLDSVLSQTFTDLELIVVDDGS
FT                   TDRTREIVTSYGTPVRLLSQSNSGVCAARNYGIREAAGSYVCLMDHDDYWFPEKLALQL
FT                   EQMFSHPEVGLVYSTFVWWHPDGEGVFPKPESFNIEKMPGGIDEEFSGWIYHLLLLDCW
FT                   ILTSAALIRAEVFDKCGAYDESLPYSEDWDLWLRISREYPVIKLNKGLTLYRQHPKQGN
FT                   RLTREIDYRTVLLRDAAEKWGLCSRDGRCISRQQFMQNIARYQMEFGLKHLASNNLKPA
FT                   MHALWKAWLSHPANLKTLAYVPAGLLGWRPKW"
FT   gene            complement(321581..322600)
FT                   /locus_tag="Nmul_A0298"
FT   CDS_pept        complement(321581..322600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73606"
FT                   /db_xref="GOA:Q2YCB5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB5"
FT                   /protein_id="ABB73606.1"
FT                   /translation="MKTRGDRVKDNTALIILGMHRSGTSLLTGLLGQVGVRMGRSLYAP
FT                   QKGVNEKGFWEHEDIVDTHDELLLHLRSQWDDLLPLKDKWWEDEAVQPYVARLQSLVKR
FT                   DFSEAPVWALKDPRMCRLLPLWMPIFKARGIRPVFISMNRNPFEVIASLQKRDRFSREK
FT                   ALVLWLNHTLSAESHSRGQSRIFIDFDQVVTDPVRVLQTIERETGIVFPVSVNQANEKI
FT                   GRFVSPDLRHHKADKTDAGATRYQGLEGMAHELYSALSEKAAESGGSHNGNLDERIDSV
FT                   AADFASYQKKWNPELIEQIRYLNQEHADYRIKFFRIYRSLSWLLARPFWLIEKILRKY"
FT   gene            323093..323770
FT                   /locus_tag="Nmul_A0299"
FT   CDS_pept        323093..323770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0299"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73607"
FT                   /db_xref="GOA:Q2YCB4"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB4"
FT                   /protein_id="ABB73607.1"
FT                   /translation="MNTNTVWHNATITRAHRERLNVHRSAVLWFTGLSGSGKSTLAHAV
FT                   EEKLYQLGCRTFVLDGDNVRQGLCSDLGFSVEDRSENIRRISEAARLLVESGVIAMTAF
FT                   ISPFRADRQKARSIFPHGDFIEIFCEASLAVCEQRDVKGLYKRARTGEVKEFTGISSPY
FT                   EAPATPELIVRTGELELEDCVAQVIEFMERRDIFKRKPQLRGSASHHNAKDLSHLSIDV
FT                   VKE"
FT   gene            323864..325204
FT                   /locus_tag="Nmul_A0300"
FT   CDS_pept        323864..325204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0300"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73608"
FT                   /db_xref="GOA:Q2YCB3"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR017528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB3"
FT                   /protein_id="ABB73608.1"
FT                   /translation="MRDILVTLIVFGWLPFVFKKPYMGALMWVWISVMNPHTQGWGFAT
FT                   TFPFAAIIAGVTITSLLITKEPKNLPLTPVTWTFIIFVLWMNLSTVFAIYPDETYIQWN
FT                   KVMKIMLMSFVVIMLIRTQKQIQLLIWTIVISLGYYGIKGGVFTLLGGGVDLVMGPEST
FT                   FIEGNNEIALALIMTIPLMHYVQMISRKTWVKHAMTAAMLLSAFAALGSYSRGALLAIA
FT                   AMGGFLWLKSQHKGRIALLVILAILPAIAYMPEQWMQRMDSINTYEEDASVQGRFNAWW
FT                   MAYNLAKDRPLTGGGFDIISPELFFAYAPNPEDIHAAHSIYFQALGEHGFVGLGLYLLL
FT                   GWLTWRTGSWIIRNTSKLDEYRWAFNLATMIQVSFIGFATGGAFLSLLYFDVPYYLMGA
FT                   MVATRVLVEKELKQKTMSAIAAKTSGSSRQLGQLSPSQSQPIAGDSS"
FT   gene            325227..326288
FT                   /locus_tag="Nmul_A0301"
FT   CDS_pept        325227..326288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0301"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73609"
FT                   /db_xref="GOA:Q2YCB2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB2"
FT                   /protein_id="ABB73609.1"
FT                   /translation="MPCLLAARVRFSSMRTSEYDHVDNLVNQVPLWPLLTSRAMLHLLS
FT                   PGGRRARLSILIYHRVLPCQDPLFPEESHARSFDQQMEQLAACFRVISLGEAIRGLRNG
FT                   TLPPRAACVTFDDGYADNAEIALPILKKRGIPATFFVATGFLDGGRMFNDTVIELIRGA
FT                   PGSTVDLDSLGLGRFPIGTVSERRQTIHQLLGKLKYLPSALRQSTVEAMSASIPVMLPD
FT                   NLMMTSEQVRMMHNAGMEIGGHTASHPILAKMESRAACADIATGKEMLEAIIRAPVRFF
FT                   AYPNGKPGRDYLPDHVRMVKKLGFDAAVSTAHGAARKGSDLHQLPRFTPWDRRPLRFAL
FT                   LMARNMLKTGETV"
FT   gene            326391..326909
FT                   /locus_tag="Nmul_A0302"
FT   CDS_pept        326391..326909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0302"
FT                   /product="unknown protein"
FT                   /note="possibly involved in tellurite resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73610"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="InterPro:IPR021948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB1"
FT                   /protein_id="ABB73610.1"
FT                   /translation="MRSSYKSSFLRPFAQSMERPITGFDTDSEGDPIAILTCGHAQHVR
FT                   HDPPFINRPWVTSKQGREGMIGKALNCVRCDQFELPDYFVPYKRTAVFTEETVPAGLRK
FT                   DHSTKTGVWGKIIVEAGKLRYRVDTLNVDTELSAETVGVVVPEVLHNVEPQGPVRFFVE
FT                   FYRAPDKEA"
FT   gene            327488..327880
FT                   /locus_tag="Nmul_A0303"
FT   CDS_pept        327488..327880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0303"
FT                   /product="ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73611"
FT                   /db_xref="GOA:Q2YCB0"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCB0"
FT                   /protein_id="ABB73611.1"
FT                   /translation="MPWIRNKPVRVVMRWQLIVTLAMVLTLGLLWGFHGAASAFLGGVV
FT                   SIVSAAAFSAIVSRYRGSTAGGILITALKAEAVKIVLTVALLWLVMTFYKDVVAIGFIG
FT                   TFILTVLIFGLALFVTDDAKVAQIKQ"
FT   sig_peptide     327488..327607
FT                   /locus_tag="Nmul_A0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.491 at
FT                   residue 40"
FT   gene            327902..328708
FT                   /locus_tag="Nmul_A0304"
FT   CDS_pept        327902..328708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0304"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73612"
FT                   /db_xref="GOA:Q2YCA9"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCA9"
FT                   /protein_id="ABB73612.1"
FT                   /translation="MASGTELTPTSYMSHHLTNLTSSIGEGEFWTLHVDTLVMAVLTGI
FT                   ISLGFLWWVVRGATSGVPSKRQAFVELAIEFIDNQVKSTFHGDRHAFVAPAALTVFVWV
FT                   LMMNAMDFLPIDIMAKVYELVGLHNWRSVPTADVNTTFALALSVWLLMIFFNMKVKGVG
FT                   GWIHELVCSPFGKNPLLWPVNILFNLVEYVSKPLSHSLRLYGNIYAGEIIFLLLGMWAA
FT                   TGLAGTFFGTLLNAGWAIFHILIVTLQAFIFMMLTVVYLSMAHESH"
FT   gene            328762..329034
FT                   /locus_tag="Nmul_A0305"
FT   CDS_pept        328762..329034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0305"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73613"
FT                   /db_xref="GOA:Q2YCA8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCA8"
FT                   /protein_id="ABB73613.1"
FT                   /translation="MENLQFLAMIQAYTGIGIGLMIGLGAAGACIGIGIMCSSFLEGAA
FT                   RQPEMIPTLQGKVFLLLGLIDASFIIGVGLAMLFAFGNPLLAVIK"
FT   gene            329072..329542
FT                   /locus_tag="Nmul_A0306"
FT   CDS_pept        329072..329542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0306"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73614"
FT                   /db_xref="GOA:Q2YCA7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA7"
FT                   /protein_id="ABB73614.1"
FT                   /translation="MNINFTLISQAMAFAIFIWFTVRFVWPPLMRAIENRQKTIAEGLA
FT                   AGERGKRELELASQRSGDVVREAKQRASDIIAQAEKRAAEIVDEAKVAAREEGDRILVG
FT                   AKAEVEQEVFRAKEVLRQQVAGLALAGAAKILRREVDEKAHAELLASLKAEL"
FT   gene            329546..330082
FT                   /locus_tag="Nmul_A0307"
FT   CDS_pept        329546..330082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0307"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73615"
FT                   /db_xref="GOA:Q2YCA6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA6"
FT                   /protein_id="ABB73615.1"
FT                   /translation="MAETRTIARPYAEAVFKLAKNQNDLARWADTLQLAAAVAADENVR
FT                   SLIGNPKISSRKLGELFLSVCGNRLNEEGRNFILLLAENGRLEILPEVNELYEQLKTRH
FT                   EGVLDAKVISAFAMSDAQLKDLVTDLEAKFKRKIEAKVSVDADLIGGVIVEIGDEVLDA
FT                   SVRGKLEAMAVALKS"
FT   gene            330098..331639
FT                   /locus_tag="Nmul_A0308"
FT   CDS_pept        330098..331639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0308"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73616"
FT                   /db_xref="GOA:Q2YCA5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA5"
FT                   /protein_id="ABB73616.1"
FT                   /translation="MHLNPSEISELIKSRIEGLEATAEVRTQGTVVSVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVVLGEYEHITEGDTVKCTGRILEVPVGEELI
FT                   GRVVNALGQPIDGKGPITTKHSEPIEKIAPGVVWRQSVNQPVQTGLKAIDAMVPIGRGQ
FT                   RELIIGDRQTGKTAVAVDAIINQKGENMICIYVAIGQKASSISNVVRKLEEHGAMEYTI
FT                   VVAATASESAAMQFIAPYSGCTMGEYFRDTGRDALIVYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSAAYVEKETNGAVKGKTGSLTALPVIETQAGDVTAF
FT                   VPTNVISITDGQIFLESDLFNAGIRPAINAGISVSRVGGAAQTKVIKKLGGGVRLALAQ
FT                   YRELAAFAQFASDLDEATRKQLERGKMVTELMKQPQYSTLSVSEMALTLFAVNKGYLDD
FT                   VEVSRALAFESALRGFIRSKYGAILDKIETTKDLDAETEKELDAAIQDFKKNGTY"
FT   gene            331643..332524
FT                   /locus_tag="Nmul_A0309"
FT   CDS_pept        331643..332524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0309"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73617"
FT                   /db_xref="GOA:Q2YCA4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA4"
FT                   /protein_id="ABB73617.1"
FT                   /translation="MAGSREIRNKIKSVKNTQKITRAMEMVAASKMRRAQERMKKARPY
FT                   GEKIRNVAAHMSRAYTEYRHPFLIERDTVKRIGIIVVTSDKGLCGGLNTNVLRMAVSKM
FT                   KAWEAEGEQIEVCCIGNKGLGFMNRMGANVISHAVSLGDAPDLERLIGAIKILLDGYNQ
FT                   DRFDRVYLFYTRFINTMKQEPVMEQLLPLSDERLRASDRPTGQRGVWDYIYEPEAKPVI
FT                   DDIMVRYVEALIYQALTENIASEQSARMVAMKAASDNAGNVINELTLIYNKSRQAAITK
FT                   ELSEIVGGAAAV"
FT   gene            332555..333934
FT                   /locus_tag="Nmul_A0310"
FT   CDS_pept        332555..333934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0310"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73618"
FT                   /db_xref="GOA:Q2YCA3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA3"
FT                   /protein_id="ABB73618.1"
FT                   /translation="MNQGKIVQCIGAVVDVEFAREEMPKVYDALVLEGSELTLEVQQQL
FT                   GDGVVRTIALGSSEGLRRGMMVTNTGDQIRVPVGTKTLGRIMDVLGTPIDEMGPIGAEQ
FT                   NRSIHQKAPAFDELSASTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIR
FT                   NIAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTG
FT                   LTMAEHFRDEGRDVLLFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGRLQERI
FT                   TSTKSGSITSIQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDPLDSTS
FT                   RQLDPLVVGEEHYSTARAVQQTLQRYKELRDIIAILGMDELSPEDKLAVARARKIQRFL
FT                   SQPFNVAEVFTGAPGKYVPLKETIKGFKGIVSGEYDHLPEQAFYMVGGIDEAVEKAKTL
FT                   Q"
FT   gene            334001..334420
FT                   /locus_tag="Nmul_A0311"
FT   CDS_pept        334001..334420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0311"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73619"
FT                   /db_xref="GOA:Q2YCA2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA2"
FT                   /protein_id="ABB73619.1"
FT                   /translation="MGVFHVDIVSAEESIYSGPAEFLVAPAEGGEVGIYPQHTPMLTRI
FT                   KPGSVRIKAPLKEEELVYVSGGMLEIQPDIVTILADTAVRGADLDEAKAIEAKKHAEEA
FT                   VRDRASTLDYARAQAELSEAIAQLAAIQKLRKRGH"
FT   gene            334820..336208
FT                   /locus_tag="Nmul_A0312"
FT   CDS_pept        334820..336208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0312"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73620"
FT                   /db_xref="GOA:Q2YCA1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YCA1"
FT                   /protein_id="ABB73620.1"
FT                   /translation="MNVSKLNIVVLAAGLGKRMYSALPKVLHPLAGKPLLVHVLDTARA
FT                   LAPHTTCVIYGHGGETVPQTIADESLIWVPQIPQLGTGHAVMQALPHIEKEGITLILYG
FT                   DVPLTSVETLKKLIAMAGKQTLGLLTVELPDPAGYGRIVRHSETGEVAAIVEEKDASES
FT                   QRSIGEINTGIMAVPNRYLHGWLCKLENNNAQGEYYLTDIVAMAVKDGVKVATANPAYV
FT                   WETTGVNSKVQLAGLERIYQTAQANKLLEQGVALADPARIDIRGKLSCGRDVMIDINCI
FT                   FEGDVQLDDGVKVGAHTILKDVRVAADSVIAPFSLIEAAEIGRNCRIGPYARIRPGTRL
FT                   EDEVHIGNFVEVKNSALAAGSKANHLSYIGDAVVGRSVNIGAGTITCNYDGANKYQTII
FT                   EDDVFVGSDTQLIAPVRVARGSTIGAGSTITRDTPPDMLTLSRAKQLSIDGWKRPVKKP
FT                   KPKN"
FT   gene            336279..338126
FT                   /locus_tag="Nmul_A0313"
FT   CDS_pept        336279..338126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0313"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73621"
FT                   /db_xref="GOA:Q2YCA0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YCA0"
FT                   /protein_id="ABB73621.1"
FT                   /translation="MCGIVGAVAKTNIVPTLIEGLRRLEYRGYDSAGIALNNGRLHRLR
FT                   TTGRVAELSKLADEQHFTGDVGIAHTRWATHGAPSERNAHPHFSGETPKVAVVHNGIIE
FT                   NHEVLRQRLQKTGFEFSSETDTEVIAHLISSHLRENPDLFEAVCRSVGELRGAYAIAVM
FT                   EEARPERLIVCRNGAPLLLGLGENGIYAASDASALLQVTRRMIYLEEGDVAELRQDGYR
FT                   IVNCRYDGARAEVARAVQESELTNEAVEMGPYAHFMQKEIFEQPGVVANTLEMVLNAQS
FT                   ISPRLFGTEAENIFKNTRSILILACGTSYHAGVVARYWLETVAGIPCNVEIASEYRYRN
FT                   PAVGADTLIVGISQSGETADTLAALSYAKSLGHRYSLGICNVAESALVRQTDLRFLTRA
FT                   GPEIGVASTKAFTTQLAALMLLTMTLAKLNGKLSGESERQMIAALRHLPVALQHSLQVE
FT                   PQVKAWAERFAEKRHALFLGRGMHYPIALEGALKLKEISYIHAEAYAAGELKHGPLALV
FT                   DKDMPVVAIAPNDALLEKLKSNLQEVRARGGELYVFADADSHIQESEGVHIIRLAEHAG
FT                   MLSPILHTIPLQLLAYHVALQKGTDVDKPRNLAKSVTVE"
FT   gene            complement(338215..339156)
FT                   /locus_tag="Nmul_A0314"
FT   CDS_pept        complement(338215..339156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73622"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC99"
FT                   /protein_id="ABB73622.1"
FT                   /translation="MQIRDQVTPATILAELVSHARAQPADTQGFCHVNCQDLYGRFHAK
FT                   AERIFASFDKYIPLTWYLWRAGESATDIAMRYSSEFLSGGTDRFIGMRLISSDELAAGD
FT                   NQATKIGAQIRELQKDYDALLERYFLLLCTDDEKQQEKIESIIEALKADTTIVTVVPRY
FT                   AWSFFAMEDAVIDAVVDRLIYPDDYVRRQAREQVSGLDRRRLVLLLSCLIHGIEENGCF
FT                   TVSDDFVMHNELVQEFEKDNPEERGSVAEDVIAMDGRFFFREADVNGFEIYQDSVSAVI
FT                   ALYYDAKVRYSHTGDEAVHYLYTLLEQTGETT"
FT   gene            complement(339350..340534)
FT                   /locus_tag="Nmul_A0315"
FT   CDS_pept        complement(339350..340534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0315"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73623"
FT                   /db_xref="GOA:Q2YC98"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC98"
FT                   /protein_id="ABB73623.1"
FT                   /translation="MDKLPACLSLIPSTAQSRGQPVARRCAAWMAALTIPVFLTGCGTF
FT                   FKLEKSEEKSVKPSPVSTLFGGKKKGGGYYLDDGPGDNPPADLHLIPDAVPREEPLRAS
FT                   TMRPYSALGKRYKPMTRHERYKTRGMASWYGRRYHGQKTASGEVYDMYAMTAAHPTLPI
FT                   PSYARVTSVTSGKSVVVRVNDRGPFLSNRLIDLSYTAAYKLDVLGGGSGLVEVESIVPG
FT                   TGSFTQLAAAASAERPGSTSSPSRFLPGSPTNLNGQGIIADQSVTVTPPTDPDSNEAQP
FT                   GLFQASFAPAVADTPPGPSLAGEGAPVSSPETPAAVPAGIYLQLGAFNAYDNADNFVVR
FT                   MRNELPSLMTSLDIVAKDGLFKVHAGPYPDRALARKAADKIAEALSIKPVLLMR"
FT   sig_peptide     complement(340481..340534)
FT                   /locus_tag="Nmul_A0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.459 at
FT                   residue 18"
FT   gene            complement(340540..341640)
FT                   /locus_tag="Nmul_A0316"
FT   CDS_pept        complement(340540..341640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0316"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73624"
FT                   /db_xref="GOA:Q2YC97"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC97"
FT                   /protein_id="ABB73624.1"
FT                   /translation="MARLPHAGHYFTRYIDGLLLCGILLLMATGLITLFSATDANSARV
FT                   TSQAINMLVALSVMWLVANIPLEHIMRIALPLYVAGLFLLLCVALFGEVNNGARRWLNL
FT                   GVTRIQPSELMKIAVPLMMAWYFDKHETTLRLRDYGVATLLLLAPVLLILRQPDLGTAL
FT                   LIASSGFYVLFFSGLSWRIMAAVAIAGGASLPLLWSMMHDYQRKRVMTLLDPTQDALGA
FT                   GYHTIQSTIAIGSGGVLGKGWQQGTQTHLAFLPERSTDFIFAVFSEEFGLLGNLLLLLL
FT                   YLALIARGMVIAANASTQFTRLIAASITLTFFTYIFVNIGMVIGILPVVGVPLPLISYG
FT                   GTSMVTMLLGFGILMSIQTHPKLVKT"
FT   gene            complement(341633..343573)
FT                   /locus_tag="Nmul_A0317"
FT   CDS_pept        complement(341633..343573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0317"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73625"
FT                   /db_xref="GOA:Q2YC96"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC96"
FT                   /protein_id="ABB73625.1"
FT                   /translation="MNHRIELRSYSRELHNFRLRLAISAGFMLLLFLLLFARFFYLQVS
FT                   QREHYHTLAEANRISIAPIVPNRGLIFDRNGVVLAHNYSAYTLEIVPSRIGNLERLINE
FT                   LTTVVEISARDRKRFKKLMEENRRFESLPIRTRLSDVEVARFAANRYRFPGVEIKARPF
FT                   RQYPKGEFASHVVGYIGRINDKDLERLEADSELANYRGSQHMGKIGIEQSYERELHGIT
FT                   GIEEMETDAGGRAIRVISRTPPIAGRNLKLSLDFKLQEVAEKAFGNRRGALVAIEPATG
FT                   DVLAFVSRPGFDPNLFVDGIDTENWELLNNSIDRPLNNRALRGVYPPGSTFKPFMALAG
FT                   LELKKRWPGSAISDPGYFSLPGSTHRFRDWKAGGHGLVDLHKSLVISCDTYYYSLAHDL
FT                   GIDNIYNFTSQFGLGKKTGIDIEGEAAGLLPSQEWKMQRHKQNWFAGDTISVGIGQGYN
FT                   LTTPLQLAFATAVLAGNGAAFRPHLVKQVLDSNNRIVREFGTSPLYRLKLDPANLKAVH
FT                   NALVDVTRPGGTAAVAGAGAAYTFAGKTGTAQVVGVKQGEKYEESKLDERHRDHALFIS
FT                   YAPAENPKIALSVLVENGGHGGSAAAPIARVVMDYYLLGKLPKEAAAQPVDQVDEEEDE
FT                   EHQQNREDGHG"
FT   sig_peptide     complement(343460..343573)
FT                   /locus_tag="Nmul_A0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.492 at
FT                   residue 38"
FT   gene            complement(343570..344091)
FT                   /locus_tag="Nmul_A0318"
FT   CDS_pept        complement(343570..344091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0318"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73626"
FT                   /db_xref="GOA:Q2YC95"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC95"
FT                   /protein_id="ABB73626.1"
FT                   /translation="MTLANSSRHEILMPAKSWFIMLSLIVALLLNLIPVTGTARTLQPD
FT                   FVALVMLYWYLNEPQRVGIGMAFWMGLLMDLSNASTFGQHALGYSVMAFMALVFNRRMG
FT                   IFEGYKQAPQIGLVLLSGQIVTLLAGLFAGSPFPGWNFFLGSIVGMLLWPLLSAILRVP
FT                   QKPWSASDAR"
FT   sig_peptide     complement(343972..344091)
FT                   /locus_tag="Nmul_A0318"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.487 at
FT                   residue 40"
FT   gene            complement(344088..344984)
FT                   /locus_tag="Nmul_A0319"
FT   CDS_pept        complement(344088..344984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0319"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73627"
FT                   /db_xref="GOA:Q2YC94"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC94"
FT                   /protein_id="ABB73627.1"
FT                   /translation="MIEISPRFFRHSPSLLARTAFFVMLSLLLMALDSRSKYLGGVREI
FT                   FSVIVYPLQKLAHMPMAMYDATSELFQHGEIAEENARLKQQHLVDKGQLLRLRALEAEN
FT                   TQLRKLLNTTQRIENKATVAEILRVPHDPFNRKVLLDKGSMAGIESGQVVVDDMGVVGQ
FT                   VTRNYPLASEVTLLTDRDHSVPVQVVRNGLRSIISGTGREGVLELRYMAINTDIQEGDV
FT                   LVTSGIDGIYPAGLPVAAVSQIERNPNYIFARIICTPASGVNQNRQLLILSTRAPRTGT
FT                   PAEATKTKPRPQEARRQ"
FT   sig_peptide     complement(344889..344984)
FT                   /locus_tag="Nmul_A0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.846 at
FT                   residue 32"
FT   gene            complement(345081..346139)
FT                   /locus_tag="Nmul_A0320"
FT   CDS_pept        complement(345081..346139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0320"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73628"
FT                   /db_xref="GOA:Q2YC93"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC93"
FT                   /protein_id="ABB73628.1"
FT                   /translation="MLNFLNNSVLKGYFSTDMAIDLGTANTLIYVRGQGIVLNEPSVVA
FT                   IRQDGGPNGKKIIQQVGLAAKQMLGRTPGNITAIRPMKDGVIADFTVTEQMLKHFIRKV
FT                   NPPRLFSANPRIVICVPCGSTQVERRAIREAAYGAGARKVELIEEPVAAAIGANLPVDE
FT                   ATGSMVVDIGGGTTEVGVISLGGVVYSSSVRVGGDKFDEAIINYIRRNYGMLIGEVTAE
FT                   LIKKEIGSAFPGSEVRELEVKGRNLAEGIPRSFTISSNEVLEALTEPLNNIVSAVKSAL
FT                   EHTAPELGADIAEKGLVLTGGGALLRDIDRLLMEETGLSVIIAEDPLTAVVRGSGIALE
FT                   NMDHLVGIFASD"
FT   gene            346251..346538
FT                   /locus_tag="Nmul_A0321"
FT   CDS_pept        346251..346538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0321"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73629"
FT                   /db_xref="GOA:Q2YC92"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC92"
FT                   /protein_id="ABB73629.1"
FT                   /translation="MSLSLDDVKRVANLARIEISEDEARKALIQLSGIFGLIEQMQAVD
FT                   VSAITPMSHAQDVMQRLRADGATEIDQRELFQSVAPQVEAGLYLVPKVIE"
FT   gene            346621..348114
FT                   /locus_tag="Nmul_A0322"
FT   CDS_pept        346621..348114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0322"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73630"
FT                   /db_xref="GOA:Q2YC91"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC91"
FT                   /protein_id="ABB73630.1"
FT                   /translation="MLHFASSSENQPSAMLNASLKQLSAMLAARKISSVELTSEFLKRS
FT                   RALNPEYNAFITLDERTSLAQAQAADILIGSGRGQPLTGVPIAQKDIFCTKGWLTTCGS
FT                   KMLSNFISPYDAHVIGRFNAVGAVNIGKTNMDEFAMGSSNETSFYGPVKNPWDTAAVPG
FT                   GSSGGSACAVAARMAPAATGTDTGGSIRQPAALCGISGLKPTYGLVSRYGMIAFASSLD
FT                   QGGPMAKSAEDLGLMLNVMAGFDARDSTSLEREPEDYTRDLEKPLDGLRIGLPKEYFVK
FT                   EIAEDVARAVEAAIGQYRKLGAETVEVSLPNTKLSVPVYYVLAPAEASSNLSRFDGVRY
FT                   GYRAPDYLDLNDMYRKTRAQGFGSEVKRRILIGTYVLSHGYYDAYYIQAQKLRRLMAQD
FT                   FAEAFKECDIIMGPTSPTVAFDLGERSSDPVQMYLSDAYTIAVNLAGLPAMSIPVGFGH
FT                   KNRPVGLHIIGNYFAEAQMLNVAHQYQLESDWHTRMPKE"
FT   gene            348204..349694
FT                   /locus_tag="Nmul_A0323"
FT   CDS_pept        348204..349694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0323"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73631"
FT                   /db_xref="GOA:Q2YC90"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC90"
FT                   /protein_id="ABB73631.1"
FT                   /translation="MQWETVIGLEVHAQLSTESKIFSGASTAFGAAPNAEACAVDLALP
FT                   GVLPVLNRGAVERAIRFGLAVGAKINSPSIFARKNYFYPDLPKGYQISQYELPVVEGGH
FT                   IQLQVVQDGKEQEKTVRLVRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDM
FT                   RSSAEAVAYAKTLHTLVRWIGICDGNMQEGSFRCDANVSVRPRGSDKLGTRCEIKNLNS
FT                   FRFLEKAIDYEVRRQVEILEDGGSIQQQTRLFDPEKGETRAMRSKEDAQDYRYFPDPDL
FT                   LPLEISGNWIEEVKKGLPELPQQIRTRFEHDYGLSMYDALLLTGDRDISEYYEAVVGKL
FT                   PSDPKLCANWVMGEVSAYLNNEGKSFDVCPLSPAQLAQLLLRIKDGTISGKIAKDVFRQ
FT                   MWAQAGTESISWRNSEGVDEGLADRIIDSQGLRQISDSSALENLVHEVLAANPKSVEEF
FT                   KAGKEKAFNALMGQVMKAARGKANPAQVNEILRKKLTE"
FT   gene            350540..350860
FT                   /locus_tag="Nmul_A0324"
FT   CDS_pept        350540..350860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73632"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC89"
FT                   /protein_id="ABB73632.1"
FT                   /translation="MKLAAITTAVAISSTVIVAWVLAAALRHSVFFYTADGYMSPRTAV
FT                   RVGLMKDEEASFSGGLAFRKTGGGGYDYREEMAIAFIDQTGHTDIDLLAVCERLGDCEL
FT                   RK"
FT   sig_peptide     350540..350599
FT                   /locus_tag="Nmul_A0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.430 at
FT                   residue 20"
FT   gene            351382..351768
FT                   /locus_tag="Nmul_A0325"
FT   CDS_pept        351382..351768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0325"
FT                   /product="Helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC88"
FT                   /protein_id="ABB73633.1"
FT                   /translation="MTAQYKRVDKMKEELDALRKYRDTLPAVFKFNRQDPARNEEDRMS
FT                   IRTEPEAINEITVRLGPDIDERLTRLVEEYGHNKQYYLIELARNGIEALEDALEADRVV
FT                   MLSRLKGEKMIPLEDIMRKYDIQD"
FT   gene            351752..352024
FT                   /locus_tag="Nmul_A0326"
FT   CDS_pept        351752..352024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0326"
FT                   /product="Plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73634"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC87"
FT                   /protein_id="ABB73634.1"
FT                   /translation="MTYRISFNPAAQRDLDKMDPQARQRLLKYLNGRIVLLEDARCLGE
FT                   PLLASQFFGYWRYRAGDYRITCDIQDEELHVLIVKGGNRRVCGVG"
FT   gene            complement(352039..353379)
FT                   /locus_tag="Nmul_A0327"
FT   CDS_pept        complement(352039..353379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0327"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73635"
FT                   /db_xref="GOA:Q2YC86"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC86"
FT                   /protein_id="ABB73635.1"
FT                   /translation="MKRVVAMAAALGIIMGAYAVEKITIPAQATDYVVLGMGCFWGAEK
FT                   RMGEIPGVVDVESGYAGGDLPGAGYQDILNHERALRTGKTTGRNHAEVVKVVFDPNKVT
FT                   LETVLAKFWESHDPTQGNRQGNDIGSNYRSAIYYHDANQKAMGLATRTAYQKALDAAGY
FT                   DRITTEILPLKNYITAEEYHQNYLKKNPDGYCGLGGTGVKYPRAVGKVAPMQVPPISSG
FT                   TSSASTSPKMGIEPLKSDDLNPVRQLVAFEAEHCEFCERFEKDIMSHWQAEVPIARTLN
FT                   SNPPSGWALEKPLFAAPTIVLFKNGREVARYTGYNGEKSNFWKWLGFQLLSPEQQKIAF
FT                   KRGTEPPFTASNLDEKRPGRFVDPVTGATLFYSNSKFESGTGWPSFFEPVEGAVTLHED
FT                   NSHGMKRIEVRSASSGIHLGHLFHDGPPPSHKRYCINGNVLKFVADR"
FT   sig_peptide     complement(353320..353379)
FT                   /locus_tag="Nmul_A0327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(353681..356536)
FT                   /locus_tag="Nmul_A0328"
FT   CDS_pept        complement(353681..356536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0328"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73636"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC85"
FT                   /protein_id="ABB73636.1"
FT                   /translation="MESTVIPTDFGKLVLDEMPGGAIVTTGDGVVVYWNKGAQSIFGYT
FT                   VAEALQRRLTELVGAPDHRPKINQSLRNTHETRASVDEILCRKKDGSLLYVSMSCKVLS
FT                   QDQRQDGYVLITSTNITHIKALRDAKLINTKFGNLLDSIPDGIVIVNSTGRIVLVNTQT
FT                   EKLFGYSAHELCGQPVEMLLPPRKRGLHSGERAAYFTHPHSRTLVADWELYGFRKDGTE
FT                   FPVEISLSPIETDEGRFSISAIRDISDRKKAEQKFRGLLEAAPDAIVIVNRNGEIVLVN
FT                   SQTEKLFDYQREQLLGKKMEMLIPPRYRSKHPGFREDFFRAPRTRPMGIGLELYGLRRD
FT                   GTEFPVEISLSPLETEEGILVSSAIRDITERKRTKEIQTQLRRDLTEREIAEKALFEEK
FT                   ELLRVTLSCIGDAVITTDTEGSVTYLNPVAEAMAGCSSDDAKGLPLQDVFQIIHAETNE
FT                   LASSPAERVLRNKETVSLNSHALLIRRDGQTFPIEDSAAPIRDQNGSIIGVVLVFRDVS
FT                   HAQKMAMEMRYQATHDALTGLINRHEFERRLKQVLERDKGADEHTLLYLDLDQFKIVND
FT                   TCGHLAGDELLKQLTSLLQAKLRKDDTLARLGGDEFGLLLERCPRGSAFRVAEVLRQTV
FT                   QEFRFVWEERIFSLGISIGLATFSGGEQTFSDVLRMADTACFLAKDKGRNRVQLYASDD
FT                   KNLEKRRGEMGWVERLHKALDKQRFVLYSQKILPLSAPSSTSHYEILLRMKGENGELVP
FT                   PMAFIPAAERYGLMPQLDRWVITNAFAQYASHPSRGIKDTCTINLSGASICDEHLYDFV
FT                   VDQFKQSQIDPAGICFEITETVAIANLTQAATLIRKLKELGCRFSLDDFGSGMSSFTYL
FT                   KHLLVDYLKIDGAFIKGMLSDPIDHAMVEAINHIGHVMKIQTIAEWVEEESFLEALRKI
FT                   GVDYAQGYAIEEPRPAITLCH"
FT   gene            357089..357565
FT                   /locus_tag="Nmul_A0329"
FT   CDS_pept        357089..357565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0329"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73637"
FT                   /db_xref="GOA:Q2YC84"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC84"
FT                   /protein_id="ABB73637.1"
FT                   /translation="MKFDTPVRAGNHYLIFLLDEQRYSLHLHVVESVARMVYITPLPGA
FT                   PEIVLGIVNLRGKVVPIVDIRQRFELPKREILLTDWLIFAHTTTRLVGLAVNSVMGVAE
FT                   CLEQCVVPTDEFFPPLKYLKGVIKFQDGLVLIQNLGDLLSLEEEKSLDLALSTS"
FT   gene            357569..359053
FT                   /locus_tag="Nmul_A0330"
FT   CDS_pept        357569..359053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0330"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73638"
FT                   /db_xref="GOA:Q2YC83"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC83"
FT                   /protein_id="ABB73638.1"
FT                   /translation="MQITLPHVLVSQLSDLIAMKMGLYYPQKRWGDLERAIAAAAPELD
FT                   MPDTETAARHLLSTSLTRRQIEILACRLTVGETYFFREQKCLNVLEQSILPELIRKCKE
FT                   SNRQLRIWSAGCCTGEEPYSIAILLDRLFEKHGEEWNAAILATDINPVFLDRAAEGLYR
FT                   EWAFRGTPGWIKERYFKRKKNGLFEIVPHIRKRVTFSRLNLVEDVYASQTNGTRAVDVI
FT                   FCRNVLMYFSSPAVKRIGQGFYRSLVDYGWLIVSPVEMSRASFPQFRLHTVSGTGLYQK
FT                   IDSHDVHGNGDYFSVGPPSDASYKITSASAPSPRLQGWETPLSLESMEPQILPVASSSF
FT                   TQLTSVQEVAGQSANQERSNTLYREARRHADGGDLPRAVKQCEEAIAANKLNPAAYYLL
FT                   ATIHQELGQAKEAMRCLMNTLYLDPDLVLAHFALGSLCLTQGKSREAKRHFDNALSLLN
FT                   GYSSNDILPDSGGLTAGDLAHFITSIRICDSIGNKE"
FT   gene            359098..359700
FT                   /locus_tag="Nmul_A0331"
FT   CDS_pept        359098..359700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0331"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73639"
FT                   /db_xref="GOA:Q2YC82"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC82"
FT                   /protein_id="ABB73639.1"
FT                   /translation="MASGNSPQLEQNPHSPRATVDSLEVSSKEKIQQILQARALALAQE
FT                   LSAQEVRNEDVEIVEFILGCERYALESCYVIQVAEVEDITPLPCTPGFIRGIVTLRGEI
FT                   LPVIDLKKFFEVPEKELGGRNKVIVLQSGKMTFSILVDEVLGARFILATDIQSSLPTLM
FT                   DIRKKYLKGITSERLVVLDAENLLMDESIVVDEQVVE"
FT   gene            359760..361253
FT                   /locus_tag="Nmul_A0332"
FT   CDS_pept        359760..361253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0332"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73640"
FT                   /db_xref="GOA:Q2YC81"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC81"
FT                   /protein_id="ABB73640.1"
FT                   /translation="MTISEKIIGGYAIILALLALSTAVAFYALGQTQATYDHFLRVDER
FT                   LMESANELRIAGFAQQTYVRGILLYPDLLKTNHALLQDNDRRFKQILEKIRQLRSGNKG
FT                   DSLLDELQSLHQQLEEAQQQAVRLSFEQKREEALAFVTNTFRPLSLVFIDKAKHFYEQQ
FT                   SAILESRKIEASDKVSSYTAVLVAVSLFTVLVGLTIGIRLSRMITGRLRESIAQLASSS
FT                   AEILSTTSQVAAGAAETAAAVSETTATVEEVKQTALTTSQKAKYVSDSAQKASNISEAG
FT                   RKSVGEAISGMNRIQEQMESIAESIMQLSKQGHAIGEIIATVNDLAEQSNLLAVNAAIE
FT                   ATRAGEQGKSFGVVAREIRSLADQSKQATAQVRTILGDIQKATNAAVLATEQGNKAVEA
FT                   GVRQSTETDEAIRLLSTSISEAAQAATQIAASSKQQMVGMDQVVMAMTNIQQASEQNVA
FT                   GTKQAESAAQGLYEMGNKLSVLVGSKKDRFVEEAGKVHA"
FT   sig_peptide     359760..359852
FT                   /locus_tag="Nmul_A0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            361246..363600
FT                   /locus_tag="Nmul_A0333"
FT   CDS_pept        361246..363600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0333"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73641"
FT                   /db_xref="GOA:Q2YC80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC80"
FT                   /protein_id="ABB73641.1"
FT                   /translation="MPDKRDVLLERLLAMFRIEAEAHLKDISSGLLALEGKPVDTPAFD
FT                   IIENMLRCAHSLKGAARAVNFAQVEETCRSLENVFSALKDKSLAVSSSLIDQLLKAVDA
FT                   LGTLVSGEGSMAERQKLLSATVTRQLNEMLKSPTKEGRTGSSLSQAASPLSLLPPDESS
FT                   ATRADVGAYLRTSIPSHASATIRVPTVKLEKVLRQVEEFLLPCLTARQRAKELGEITTT
FT                   LAVWKKQRLQIQSVVRIIDREMTSSLKDRSFREQHGLPKLLKYLDGEPLQMKALEERLV
FT                   RLQRTIEQDQRVLAGMTDCLIQDVKEMQLLPFSTLLDILPRFSRELAREQGKSLELVVS
FT                   GGEVEIDRHILEEMKDPLIHLVRNCIDHGIEQPAARLAKGKPSSGRITFACSQSDSGKA
FT                   EIRVADDGGGINVGKLKAAAHKLGVMSEEEMERLGESELLALIFRSGVTTSPLITDISG
FT                   RGLGLAIVREKVEALGGSIKVKSSTDTGTAFHILLPLTLTNTRGVLVHAAGQLFVIPSS
FT                   SVERVVRIAKNEIETVKNRETILVDEQPVSLVKLGDILELAGNSAEMEPAHYLRGIVLS
FT                   SGLGRVAFLVEEVLGEQEVVIKALLPPLKRVRNVAGVCMLGTGRVVPVLNVPDLLKSAV
FT                   KASSAPCIPTQDSSAEKQGTSSKHSILVVDDSITARTLLKHILESAGYRVTTAVDGVEG
FT                   YTALKTGTHSLVVSDVEMPRMDGFALTAKIRADKQLATLPVVLVTALDSRDHRERGIDV
FT                   GANAYIVKSRFDQGNLLEAIRRLISISSINP"
FT   gene            363611..364678
FT                   /locus_tag="Nmul_A0334"
FT   CDS_pept        363611..364678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0334"
FT                   /product="response regulator receiver (CheY-like) modulated
FT                   CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73642"
FT                   /db_xref="GOA:Q2YC79"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC79"
FT                   /protein_id="ABB73642.1"
FT                   /translation="MINVLVVEDSPVVREFLIYILNSDPDITVIATAGDGEEAIDALRN
FT                   HRPDVITMDIHMPKLNGVEATQLIMETQPTPIVIVSGSTDPAEVGTTFDAIDAGALAVL
FT                   PRPAGIGHPDHEATARKMIEVVKLMSEVKVVRRWARMRGASPASHSVRAPLLNRVAPAR
FT                   IVVVGASTGGPPALEAILSSLPKHFPVPILIVQHMTTGFMEGFVQWLKNSSNLPVHIAR
FT                   QGELPLPGHVYMAPDEYQMKVENRGEIVLTKDEPEHGSRPSISYLFRAVARVYGHDAVA
FT                   GLLTGMGRDGADELRLLKEKGAITFAQDKESSVVHGMAGEAIRLGAATMVLPLEKIAAA
FT                   LTNLVAERGETKLGA"
FT   gene            364668..367610
FT                   /locus_tag="Nmul_A0335"
FT   CDS_pept        364668..367610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0335"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73643"
FT                   /db_xref="GOA:Q2YC78"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC78"
FT                   /protein_id="ABB73643.1"
FT                   /translation="MAHDISIHDARKVEILIAEDSPTQAEKLKYLLEENGYQVTTAGDG
FT                   KQALSRARQRNPTLIISDVMMPEMNGFALCSEIKRDAQLKKIPVILLTSLADVKDIIQG
FT                   LESGADNFIRKPYDDKYLLDRIEYLLMSHELRKSQKMQMGMQIYLGGQKHFITSERQQI
FT                   VDLLISVYEDAVHLNAELNRRQRELTHSNRLLNGLYRMAEGLNQAATEREVSEKALEYA
FT                   MMFPGVQAGWLYLWNTDGLSLAGSRNVPASVSADGWDTSCNCLRLLLAGELGNTPKILN
FT                   CERLFSSGGNGSCHHVTIPMWSGSKNQGVMNLLGLEQDQFRENELDTFYGIGQQVSVAL
FT                   ERARLHEHMEKLVGERTAALTAEIAQRKEYEARVVRLNRLYSVLSGINTAIVRVREIQE
FT                   LFNEACRIAVVHGGFAFAWIGMLRGSTRVTTPVAKMGQGNDELLQLNLSLMSAPKGAPL
FT                   IEDLITHLKPFICNDLVADKRMEGLHDAPLAHDYLSMAILPLVLDGQLVGTLTLYTPET
FT                   GFFDEEEIALLVEMAGDISFAMDHLKKEERINYLAFFDAVTELPNRALFLDRVNQRIKM
FT                   VSSGHEMLSVIVLDIERFSSINESFGHGAGDSLLRQLAKRLKQLLSEADILAHLSADYF
FT                   AIARKHEEESIDIVHMLEKLLFEVQNEPFLINGQELWVSARAGASFFPSDGLDTDTLLR
FT                   NAGTALKKAKHSSDKHLFYAPEFHARVKEKLRLEIKLRQALEQEQLMLYYQPKVDLKSG
FT                   QISGLEALMRWHDPESATVLSPLHFIPLLEETGMILDAGRWALSKAISDANKWKAMSLN
FT                   PPRIAINVSPVQLRQKDFVDMVANVVSDAGDLAAFQFEITESVIMHDIKANIEKLNLIQ
FT                   EMGIELAIDDFGTGYSSLSYIAKLPVNVLKIDRAFISDMNINPDNLSIVSGIISLAHSL
FT                   HLRVVAEGVETAEQAELLRSLECEEMQGYLFSPAVTATKIIEFLHQKKSL"
FT   gene            complement(367955..368695)
FT                   /locus_tag="Nmul_A0336"
FT   CDS_pept        complement(367955..368695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0336"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73644"
FT                   /db_xref="GOA:Q2YC77"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC77"
FT                   /protein_id="ABB73644.1"
FT                   /translation="MQGKVILVTGGARRVGAATCRRLHSQGANLAVHYRSSIEEAQTLQ
FT                   AELNRTRSGSVALVQADLLDIARLPQLVAETVERFGKLDALVNNASSFFPTPFGEITAD
FT                   MWDDLMGSNLKAPLFLSQAAASQLRKQHGCIVNIVDIHSEWPLKNYVVYNAAKGGLASL
FT                   TRSLAQELAPEVRVNGISPGPILWPEAGEWADEASRQHIIDRTLLKRTGEPDDIARTVA
FT                   FLIADAPYITGQIIAVDGGRSVNL"
FT   gene            368771..370045
FT                   /locus_tag="Nmul_A0337"
FT   CDS_pept        368771..370045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0337"
FT                   /product="Protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73645"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC76"
FT                   /protein_id="ABB73645.1"
FT                   /translation="MSASKEGLRYRCYLLAESTVKRSIAPMQPQPPFPLPGEAALEHSR
FT                   VLTKLIHEKISAAGGWISFEHYMRLALYAPGMGYYSGGPAKFGQEGDFVTAPEISPLFG
FT                   RTVARQARQILELADEGSCILEFGAGTGKLALDLLVELEKLDCLPQQYFILEVSAELRQ
FT                   RQRQLLEQFAPHLASRVFWLKHLPEQFNGLILANEVLDAMPVHLIAWRGTTVYERGVSS
FT                   AGHEFIWSERLLAEGVLFEAAQELADRIRLGRNEGEYVSEICLQARGFIASLGKMLQRG
FT                   AILLIDYGFGRDEYYHPQRRQGTLMCHYRHHTHDNPFYLPGLQDITSHVDFSSAASSGL
FT                   EAGLQLLGYTTQAHFLINCGITEILAETPAANAKDYLPLANQVQKLVSPAEMGELFKVM
FT                   ILGKGIGNNHPPPVGFTGGDKSRLL"
FT   gene            370170..370613
FT                   /locus_tag="Nmul_A0338"
FT   CDS_pept        370170..370613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0338"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73646"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC75"
FT                   /protein_id="ABB73646.1"
FT                   /translation="MTTVKELLEGKGYEVASIEPDKSVYEAMHLMAAKNIGALLVLHRG
FT                   KLVGIFTERDYSRKAYSLDRLAKDIQVKELMTAQVAYVSPDYSTEDCMALVTKTRARHL
FT                   PVLANGKVMGIISIGDLVKDAISGREFIIDQLERYIYGTRSPE"
FT   gene            370876..372258
FT                   /locus_tag="Nmul_A0339"
FT   CDS_pept        370876..372258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73647"
FT                   /db_xref="GOA:Q2YC74"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC74"
FT                   /protein_id="ABB73647.1"
FT                   /translation="MKPDDLPSDVSSDPLLRLRRQISDEASQCVACGLCVPHCPSYRVT
FT                   LSEADSPRGRIALMSGVAAGRIPMNARFALHMDRCLTCRACEAVCPNHVRFGELIDDAR
FT                   EMISSPPLEFGGNNPGARVSSFRKWVERELIARPSRIDALRPLLRFYQRSGLQKWVRKS
FT                   GLLGKTKLALLEAQIPFIDQPRSSSWSVVYPAVGKPRGEVGLFLGCVARVADATTLDAA
FT                   LFVLNQLGYVVHVPTGQTCCGALHQHRGDMDAAAQLERQNVEAFAGLDLGAIITTASGC
FT                   GAQLSEYSSFSGSQRTTRAPAVSSQAGGETTRRSPPKVLDISEFLAEAEGWEDARFQPL
FT                   PHKILVHEPCTLRNVLRASTYAYKLLERIPQAQVVPLAGNDQCCGAAGTYFLDQPEISA
FT                   ALLEDKVTALKAGQACYLATSNVGCALHIAAGLRRPGLGIEVIHPVTLIARQMGMQSQS
FT                   LK"
FT   gene            complement(372407..373327)
FT                   /locus_tag="Nmul_A0340"
FT   CDS_pept        complement(372407..373327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0340"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73648"
FT                   /db_xref="GOA:Q2YC73"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC73"
FT                   /protein_id="ABB73648.1"
FT                   /translation="MPLHIQTPLIESRPLSDRTGHSVWLKMEIAQPSGSFKARGIGYAC
FT                   EEYFRRGAKRFISSSGGNAGLAVAFAGRNLSVPVVIVVPETASKRARELMAREGAEVII
FT                   QGKSLSEANAFARSLVQPEDAFLHPFDDPLIWTGHASIIDEIVDTGPKPDVIVLSVGGG
FT                   GLLCGVIEGLNRNEWQDVPIIAVETQGADSFAQALNAGALVELPRISSIATTLGASAVC
FT                   RQALEYSRKHRIGSVVLPDKLAVSACMQFLRDHDAVVEPACGVALAAVYERVPALSGYK
FT                   KVLIIVCGGVSTTVDQLQEWSAVMQ"
FT   gene            373527..374207
FT                   /locus_tag="Nmul_A0341"
FT   CDS_pept        373527..374207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0341"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73649"
FT                   /db_xref="GOA:Q2YC72"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC72"
FT                   /protein_id="ABB73649.1"
FT                   /translation="MAGLSFLPFSLFSFSENPMPNLDKLIIGFDHALRTLLTPAQTLRP
FT                   VPGTQLPEAELNDLEKSESAALMRVNHVGEICAQALYQGQALTARNAEVQQTLAQAARE
FT                   ETEHLAWTERRINELSGRKSLLNPLWYGGSFAIGAFAGLLGDKWNLGFLAETERQVSAH
FT                   LGGHLSRLPHADEKSRAIVTQMQIDEAGHATTAVAYGGAELPMPVKLVMRMASSVMTRT
FT                   AYWV"
FT   gene            complement(374252..374668)
FT                   /locus_tag="Nmul_A0342"
FT   CDS_pept        complement(374252..374668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0342"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73650"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC71"
FT                   /protein_id="ABB73650.1"
FT                   /translation="MKASVKWQEEASFLGESGSGHTVLMDGPPESGGRNRGPRPMEMLL
FT                   MGTGGCAAFDVVLILKKGRQEICDCEVRIEAERAEREPKVFTRIHFHFILTGKKLNPHQ
FT                   VERAISLSAEKYCSASIMLAKTAELTHDFEIVEA"
FT   gene            complement(374738..375493)
FT                   /locus_tag="Nmul_A0343"
FT   CDS_pept        complement(374738..375493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0343"
FT                   /product="Protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73651"
FT                   /db_xref="GOA:Q2YC70"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC70"
FT                   /protein_id="ABB73651.1"
FT                   /translation="MSWFATNFASAFLLPPFNLILLGAAGILLLKRRQGTGMTLVAAAL
FT                   ALLYLLSTPIVADALLQVLETPSEKNPFDDTIQAIIVLGGGTYYYAPEYGDHTVGRYTL
FT                   ERVRYAAKIYRLTGKPILTAGGAPLGNHSSEAMQMKAVLEEEFLVPVEWVEETSSNTRE
FT                   NAYKSFAILQKQGIRQIALVTHAWHMPRAAREFEQAGFEVTPAATGYTRRYKTDLLTFI
FT                   PNAGALLKSSLFFHEVIGILWYRLMPEPD"
FT   sig_peptide     complement(375320..375493)
FT                   /locus_tag="Nmul_A0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.604) with cleavage site probability 0.347 at
FT                   residue 58"
FT   gene            complement(375569..375877)
FT                   /locus_tag="Nmul_A0344"
FT   CDS_pept        complement(375569..375877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0344"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73652"
FT                   /db_xref="GOA:Q2YC69"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC69"
FT                   /protein_id="ABB73652.1"
FT                   /translation="MKAVWMGMVAASALLVVGTAQASPELAKSSGCLNCHMVDKKLVGP
FT                   ALKDIAAKYKADPKAADYLAGKIQKGSQGVWGPVPMPPNAKVNEADAKTLAKWILTQ"
FT   sig_peptide     complement(375809..375877)
FT                   /locus_tag="Nmul_A0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(375899..378001)
FT                   /locus_tag="Nmul_A0345"
FT   CDS_pept        complement(375899..378001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0345"
FT                   /product="Protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73653"
FT                   /db_xref="GOA:Q2YC68"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC68"
FT                   /protein_id="ABB73653.1"
FT                   /translation="MPNHLAGETSPYLLQHADNPVDWYPWGEEALTLARAQDRPILLSV
FT                   GYSACHWCHVMAHECFEDAEVAEVMNRYFINIKVDREERPDIDQIYQTALYMLTQRSGG
FT                   WPLTLFLTPDQKPFFGGTYFPKTPRHSLPGFLDLLPRVAETYRVRRPEIERQSASLLKS
FT                   FANMLPSKAPEAPVFSERPLEQALAELKNRFDSENGGFGEPPKFLHLTELDFCLRRYFT
FT                   AGNSEALHMATLTLEKMAEGGIYDQVGGGFYRYSTDKQWQIPHFEKMLYDNGPLLHLYA
FT                   DAWIASGNPLFARIVEETATWVMREMQPEYEENEKRTGAGYWSTLDADSENVEGKFYVW
FT                   DRSEASHILSRREYVVAASHYGLSQPANFGNRYWHLAVAQSLPEIAENFGVTYAEARQW
FT                   LESGRKKLLAQRQCRVRPGRDEKILTSWNGLMIKGMARAGRVFGRDDWVRSAICAVDFI
FT                   RSTLWKNGRLLATWKDGNARLNAYLDDYAFLLDGLLELMQTTFRPVDLDFAIALAEVLL
FT                   DQFEDKEAGGFFFTSHDHENLIHRPKPGYDNATPSGNGVAAHTLQRMGYLLGEFRYLQA
FT                   AERALRLFYPALLRHPDSCCSLLLALEQWLTPPPVVILRGKAEPMAKWENALRQRVPIA
FT                   LVLALPVERVTPAALPPSLAKPVPSGMGVNAWVCHGVKCLPEVTDLQELLRISEIRGKI
FT                   RSLFYN"
FT   gene            complement(378025..379698)
FT                   /locus_tag="Nmul_A0346"
FT   CDS_pept        complement(378025..379698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0346"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73654"
FT                   /db_xref="GOA:Q2YC67"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC67"
FT                   /protein_id="ABB73654.1"
FT                   /translation="MSDNQRSRAITQGAERTPNRAMLRAVGFSDNDFDKPIVGVANGFS
FT                   TITPCNKGLNELALAAEQALKQAAAMPQMFGTITVSDGISMGTEGMKYSLVSREVIADS
FT                   IETAVQAESMDGVIAIGGCDKNMPGAMIAIARMNVPAIFVYGGTIKPGHYKGKDLTIVS
FT                   AFEAVGQYTSHKIDAKELLEVERHACPGAGSCGGMFTANTMSSAFEAMGMSLPYSSTMA
FT                   AEDGEKLTSAARSAEVLVDAIRKQIRPRDIITRKSIENAIAVIMAVGGSTNAVLHFLAI
FT                   AHAAEVTLTIDDFERMRGKVPVLCDLKPSGRYVATDLHKAGGIPQVMKMLLDHGLLHGD
FT                   CITISGQTIAEILKDVPSEPREDQDVIRQWDNPLYVQGHLAILKGNLAPEGCVAKITGV
FT                   KSPKITGPARVFDSEEACMAAILAREIQPGDVVVIRYEGPKGGPGMREMLSPTSALIGE
FT                   GLGDSVGLITDGRFSGGTYGMVVGHVAPEAFVGGTIALVREGDSITIDAEQRLLQLNIP
FT                   GDELARRRAEWQPPHPRYTRGVLAKYSKLVSSASRGAITD"
FT   gene            379714..379965
FT                   /locus_tag="Nmul_A0347"
FT   CDS_pept        379714..379965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73655"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC66"
FT                   /protein_id="ABB73655.1"
FT                   /translation="MKKRECRQILANSGQGKKRPWRLRSGEERKGSSRSLFSVFSAVDN
FT                   RRRMYNEGENGIPYFHSCPTFRQEGLSLFLPVFAGMMF"
FT   gene            380014..380883
FT                   /locus_tag="Nmul_A0348"
FT   CDS_pept        380014..380883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0348"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73656"
FT                   /db_xref="GOA:Q2YC65"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC65"
FT                   /protein_id="ABB73656.1"
FT                   /translation="MLVHPQIDPIAIQLGPLAVRWYGLMYLLGFACFILLGRYRIKRNP
FT                   EGAFTISMLDDMLFYGVLGVIVGGRLGHIFFYQFGYYLEHPLEIFAVWQGGMSFHGGFL
FT                   GVIAAMALLARKYHLRWLVVTDFIAPLVPLGLGAGRIGNFINAELWGRPTDVPWGMIFP
FT                   YVDNIPRHPSQLYEFALEGLAFFTLMWIYSARPRPVGAVSGMFLIGYGVFRSFAEFFRE
FT                   PDEGFMGMMTLGISMGQWLSLPMILAGVIMLVWAYRTQAPVSARGKAGKAGKAANAVVA
FT                   GKRGSKER"
FT   gene            380894..381493
FT                   /locus_tag="Nmul_A0349"
FT   CDS_pept        380894..381493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0349"
FT                   /product="phosphatidylethanolamine N-methyltransferase"
FT                   /EC_number="2.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73657"
FT                   /db_xref="GOA:Q2YC64"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC64"
FT                   /protein_id="ABB73657.1"
FT                   /translation="MSLRRSYSLIAPLYDALLAGAGTGLRAASLEQLPRQENLDILISG
FT                   IGTGLDLPHVPACHHYVGLDLTAAMLKRARPRIGNLHVDLVQGDSMSLPFVDTCFDHVV
FT                   LHLILAIVPDARACLKETARVLKPGGSVLILDKFLKPGENAVLRRMVNLLSQHIVTRLD
FT                   VVFEEVLASVPQLKVESDQPLLAGGWFRSIRLVKAG"
FT   gene            381569..382261
FT                   /locus_tag="Nmul_A0350"
FT   CDS_pept        381569..382261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0350"
FT                   /product="cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73658"
FT                   /db_xref="GOA:Q2YC63"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR028347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC63"
FT                   /protein_id="ABB73658.1"
FT                   /translation="MSSSAAFIAILTIIAVAASGAAGLVSADPVEGTGSVNSPGPDWTE
FT                   AYHKNGLVIFTKDIAEGRRVIAVSEVEVPPEAVFNVLVDFEHYREFMPYVKESEVLSRT
FT                   GDNEVVTYARIAPPFISERDYPLKVRLTRKAAAGDTRKDGTFKVEWTALSEAKPEVEGV
FT                   VRIKLNEGSWVGEPLDDGRHTRLTYTLLTDPGGLIPDFVFNLSNTVAIPELFDAVRKRS
FT                   TEAVSGRK"
FT   sig_peptide     381569..381652
FT                   /locus_tag="Nmul_A0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.772 at
FT                   residue 28"
FT   gene            382325..382657
FT                   /locus_tag="Nmul_A0351"
FT   CDS_pept        382325..382657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0351"
FT                   /product="Protein of unknown function UPF0060"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73659"
FT                   /db_xref="GOA:Q2YC62"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC62"
FT                   /protein_id="ABB73659.1"
FT                   /translation="MFELKTLFLFLATALAEIVGCYLPYLWLKRDGSAWLLVPAAASLA
FT                   LFAWLLTLHPTDAGRTYAAYGGVYVSVAVLWLWAVDGVRPTAWDMAGSLLALTGMAIIM
FT                   FGPRHA"
FT   gene            382889..383242
FT                   /locus_tag="Nmul_A0352"
FT   CDS_pept        382889..383242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0352"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73660"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC61"
FT                   /protein_id="ABB73660.1"
FT                   /translation="MITRRMIALPGLLSVVLFAGCSAISTTPEGKSVELGTEKPGGNCK
FT                   PLGDAVGSQGNWITGDYTSNENLLIGARNDLRNRAAKMGGNYVWVQNSANTNAWGSKGT
FT                   TNTTVLGVVYRCE"
FT   sig_peptide     382889..382960
FT                   /locus_tag="Nmul_A0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.485 at
FT                   residue 24"
FT   gene            383307..383675
FT                   /locus_tag="Nmul_A0353"
FT   CDS_pept        383307..383675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0353"
FT                   /product="Putative thiol-disulfide oxidoreductase DCC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73661"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC60"
FT                   /protein_id="ABB73661.1"
FT                   /translation="MSSKVYYNSACPVCNAGIKEQRRRMEAGGIKDIQWIDVHAQPEAV
FT                   AEVNASLEEVRERLHVKRQDGRIDVGVDAFTQLWSQTPGQHWLARLFRLPPLKQLSRLA
FT                   YNAFAGGLYRWNRAKKHW"
FT   gene            complement(383760..384803)
FT                   /locus_tag="Nmul_A0354"
FT   CDS_pept        complement(383760..384803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0354"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73662"
FT                   /db_xref="GOA:Q2YC59"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC59"
FT                   /protein_id="ABB73662.1"
FT                   /translation="MNTFTLTRPDDFHLHLRDGEHMRAVLADTARRFARAIVMPNLKPP
FT                   VITTEMAVAYRGRLLAALPQGVRFEPLMTLYLTDNTSPSEIIEAKRSGVIYGIKYYPAG
FT                   ATTNSAAGVTDIARCHETLEAMEQAEMPMLVHGEVTDPEVDVFDREKVFLERMLIPLTQ
FT                   RFPRLRVVFEHITTREAVEFVINAPKTVAATITAHHLLISRNALFQGGIRPHHYCLPIL
FT                   KRETHRQKLIEAATSGNPKFFLGTDSAPHAQFAKENACGCAGIYTAHAAIELYAEAFEQ
FT                   AGALEKLEAFASFHGADFYQLPRNQDKITLKKENWRVPAQLEFGGESLIPFRAGENVTW
FT                   ALDKTGN"
FT   gene            complement(384991..386169)
FT                   /locus_tag="Nmul_A0355"
FT   CDS_pept        complement(384991..386169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0355"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73663"
FT                   /db_xref="GOA:Q2YC58"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR029324"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC58"
FT                   /protein_id="ABB73663.1"
FT                   /translation="MKHHKYLIVGGGMTADSAVHGIRKIDPDGAIAVIGEELHRPYNRP
FT                   PLSKALWKDSPYDSIWRSEHGLNVAMHLGKKIVALDPANKTATDNAGNIYTYEKLLLAT
FT                   GGEVRRFPHFDSGIIYYRTADDYLKLRELSSQGSDFVVIGGGFIGSEIAAALAMNDKRV
FT                   TMIFPENGISSRIYPRPLVEFLNSYYREKGVIVLAPETVTSIRTDGTKKIVTTGSGTEI
FT                   SADGVVAGLGILPNTELAVQAGLAIDNGIVVDEFLRTSNPDIYAAGDVANFYSPLLDKR
FT                   MRVEHEDNANMMGEAAGRNMAGSLEPYHHQPFFYSDLFDLGYEAVGELDSSLDIVEDWV
FT                   EPFRKGVIYYLRDELVRGVLLWNTWGQVDAATALIAEKKPCTNETLLGRIKD"
FT   gene            386511..387167
FT                   /locus_tag="Nmul_A0356"
FT   CDS_pept        386511..387167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73664"
FT                   /db_xref="GOA:Q2YC57"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC57"
FT                   /protein_id="ABB73664.1"
FT                   /translation="MTEVKTDSEANTIDICVHHAREILASQLPQVKAQGYDFAPLFRQM
FT                   TIQLYLVGVMWRCSERLGVAGDTRDHAFEAMESMLIADGMKKKEAQQRILFLRNMSRVE
FT                   DGTDTLAVSTGYEAVPNDESMTRLFDEYRNEARVSGSLWRLFERGKKIMFIGGAVAAFV
FT                   TIWAVTIFLPKTEGIDILAAGLLAAALVVVPTFLIGLLIYRTKMKKSAPPPSSQS"
FT   gene            387357..388223
FT                   /locus_tag="Nmul_A0357"
FT   CDS_pept        387357..388223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0357"
FT                   /product="methenyltetrahydrofolate cyclohydrolase /
FT                   5,10-methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73665"
FT                   /db_xref="GOA:Q2YC56"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC56"
FT                   /protein_id="ABB73665.1"
FT                   /translation="MSAKIIDGKRLSQEVRAECRARAARLAEKGTQPGLAVVIVGDNPA
FT                   SRVYVRNKAKACGETGIYSEVHEFPENANQDEVIGRIQELNGNPGIHGILVQLPLPRHF
FT                   DSSRVTESVAVEKDVDGFHLYNVGALVTGSSIFPPCTPNGVMKMLEKYDIPIEGQHAVI
FT                   VGRSNIVGKPMALMLLQKGATVTICTSRTRNLAEHTSRADILIVAAGKPRLITAMMVKP
FT                   GATVIDVGINRLSDGKLAGDVDFESVKEKAGYITPVPGGVGPMTIAMLLCNTVVAAEQA
FT                   HARLQGN"
FT   gene            388273..390942
FT                   /locus_tag="Nmul_A0358"
FT   CDS_pept        388273..390942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0358"
FT                   /product="2-oxo-acid dehydrogenase E1 component,
FT                   homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73666"
FT                   /db_xref="GOA:Q2YC55"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC55"
FT                   /protein_id="ABB73666.1"
FT                   /translation="MEPIPDIDPTETQEWLEALESVLTHEGTERAHYLLERLVEKARRS
FT                   GAYLPYSATTAYINTIPPGKEEWSPGNHALEHRIRSYVRWNSMAMVLRANRNSNVGGHI
FT                   ASFASAATLYDVGYNHFWHARSENHGGDLIFAQGHSSPGLYAYAFLLGELTEEQLNNFR
FT                   REVGGKGLSSYPHPWLMPDFWQFPTVSMGLGPLMAIYHARFMKYLDSRGLVKTEGRKVW
FT                   AFMGDGEMDEPESLGSISLASRENLDNLIFVINCNLQRLDGPVRGNGKIIQELEAAFRG
FT                   SGWNVIKVIWGSYWDPLLAKDTKGLLQQRMMECVDGEYQTFKSRDGAYVREHFFGKYPE
FT                   LLEMVANMSDDDIWRLNRGGHDPHKVYAAYSAAVKHKGQPTVILAKTIKGYGMGEAGEA
FT                   QNITHQQKKMGTTSLKAFRDRFGLPISDDDIESVPYLKFDKDSPESIYMHQRREALGGF
FT                   IHRRQRKAEPLQIPPLSAFDTLLKASGEGRESSTTMAFVRILNILIKDKNIGKRVVPIV
FT                   ADESRTFGMEGMFRQLGIWSSTGQLYTPEDAEQLMYYKEDKNGQILQEGINEAGAMSSW
FT                   MAAATAYSSHGVQMIPFYIYYSMFGFQRVGDLCWAAGDMRCRGFLLGGTAGRTTLNGEG
FT                   LQHEDGHSHLAASTVPNCISYDPTFAYELTVIIRDGLRRMCEMQEDVYYYITVMNENYS
FT                   HPEMPAGAEEGILKGMYLFREGKPAGEKDSGLRVQLLGSGAILREVIAAAEILEEEFGV
FT                   TGDIWSVTSFTQLRREALATTRWNMLHPTEPARLSHVGTCLKDREGPVVAATDYMKIFA
FT                   DQIREFIPGRYKVLGTDGFGRSDTREQLRRFFEVDRHYITIAALKALAEDGRIEAERVA
FT                   QAMGKFGLDPDKPNPMTI"
FT   gene            391164..392516
FT                   /locus_tag="Nmul_A0359"
FT   CDS_pept        391164..392516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0359"
FT                   /product="Catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73667"
FT                   /db_xref="GOA:Q2YC54"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC54"
FT                   /protein_id="ABB73667.1"
FT                   /translation="MAETKQVLIPDIGDFKDVPIIEVLVKAGDSIKAEDSLIVLESDKA
FT                   TIEVPSPFAGIIRELSVKVGDKVSEGSPILTLEASEAEQAPPAEPREAAPASTPAPAPT
FT                   TASPEQAPRPATQPRAQSQSSAQPQSSGSSPRSAFVPSPIDEATFAKAHASPSVRRFAR
FT                   ELGVNLGLVKGSGAKQRILKEDVQSFVKTELSKPRGSGTELNLLPWPQPDFAKFGPVEF
FT                   KPLSRIKKISGANLHRNWVMIPHVTQFDEADITELETLRKETNESSKEEGVKVTLLAFL
FT                   LRASIAALKKFPEFNASLTSEGDEMNLVVKNYYHLGFAADTPHGLVVPVIRDVEKKGVI
FT                   AIAKEMSDLAASARAGKLKPTDMQGASFTISSLGGIGGTAFTPIINAPEVAILGVSRAV
FT                   MKPVYRDGEFVPRLMLPLSLSYDHRVIDGATAARFTTHLVEVLADLRRVLL"
FT   gene            392621..393301
FT                   /locus_tag="Nmul_A0360"
FT   CDS_pept        392621..393301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0360"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73668"
FT                   /db_xref="GOA:Q2YC53"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC53"
FT                   /protein_id="ABB73668.1"
FT                   /translation="MNDFPVSPVGVFGGTFDPVHYGHLRIAEEIAELVGLREMRFVPAG
FT                   IPRLRRGPEASLEHRVEMVRRAIDGNSRFILDEREVVRGGVSYSVDTLRELRQELGKDI
FT                   VLCFVTGADAFIRLAEWHRWRELFGLCHFIIAARPGHLLSAENRPSPAALPQELEEECR
FT                   ERWTSSAEILKYAPGGLIFTAQTTLLDISATAIRKRVASGKSIRYLVPESTRDYIAAND
FT                   LYRE"
FT   gene            393304..393780
FT                   /locus_tag="Nmul_A0361"
FT   CDS_pept        393304..393780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0361"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73669"
FT                   /db_xref="GOA:Q2YC52"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC52"
FT                   /protein_id="ABB73669.1"
FT                   /translation="MTPAKLIKTVVAALDEIKARDVEVLDVKKLTALFDRMIIASGDST
FT                   RQTRAIANNVVEKVKAAGGMVYGVEGENNGEWILVDLGDVLVHVMQTAVRAHYNLEELW
FT                   AHAARINKISENTSRKKPVARPPVAEEGETGPVTPAKTRKARVSRAKTNPDDER"
FT   gene            393886..394356
FT                   /locus_tag="Nmul_A0362"
FT   CDS_pept        393886..394356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0362"
FT                   /product="Protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73670"
FT                   /db_xref="GOA:Q2YC51"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC51"
FT                   /protein_id="ABB73670.1"
FT                   /translation="MKFLVYAVGHKMPEWIAAGFQEYAKRMPREANIELLEIKPERRDS
FT                   GKKVEQLLAAEGARIRALLPSNCRLVVMDERGSQWTTAGLAHAIGSWMKDGGDTAFLIG
FT                   GADGLDPALRNAADEVLALSALTLPHGLVRILLAEQLYRAISLIKGHPYHRA"
FT   gene            394408..395031
FT                   /locus_tag="Nmul_A0363"
FT   CDS_pept        394408..395031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0363"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73671"
FT                   /db_xref="GOA:Q2YC50"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC50"
FT                   /protein_id="ABB73671.1"
FT                   /translation="MTFVENRIYLASRSPRRQELLKQIGVDFMVLPLREALPRIPDVDE
FT                   TPLPQESPPEYVERIARVKAETGRKRMSERGWADFPVLGADTAVVLNGRIFGKPENPLH
FT                   AKQMLRALSGQIHEVLTAAAVAAGNGTRVCLSRSSVRFRNLGEQEIDHYLACDEAYDKA
FT                   GAYAIQGRAAVFISGISGSYSGVVGLPLFETAQLLEESAIRIFQ"
FT   gene            395056..396507
FT                   /locus_tag="Nmul_A0364"
FT   CDS_pept        395056..396507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0364"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73672"
FT                   /db_xref="GOA:Q2YC49"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC49"
FT                   /protein_id="ABB73672.1"
FT                   /translation="MSCEILINVTPQETRVAVVEHGAVQELHIERTSNCGIVGNIYNGR
FT                   VIRVLPGMQSAFVDIGLERAAFLHLADIWRLRQSEDADKPIEQLLYEGKNILVQVIKDS
FT                   IGAKGARLSTQVSIAGRLLVYLPQVSHIGISQRIEDETERKSLREKLKHLLPAAEEGGF
FT                   IIRTVAEAASEQDLQTDIEYLHKLWRDIKEKSLISQPALLYQDLNLSFRVLRDFISDDT
FT                   TRILVDSRETFQKMATFARVYMANVVERLDHYAGERPLFELYGVEDEIEKALARRVDLK
FT                   SGGYLIIDQTEALTTIDVNTGGFIGVRSFDDTIFKTNLEAAQVIARQLRLRNLGGIIII
FT                   DFIDMESAEHQNAVLSEFKKSLMKDRTHMTVNGFTALGLVEMTRKRTRESLAHILCETC
FT                   PTCQGRSKVRTAQTMCYEILRELLRESRQFDAREFRIVASQQVIDLFLDEESQSLAQLA
FT                   DFIAKPISLQVEGTYTQEQYDLILM"
FT   gene            complement(396500..397321)
FT                   /locus_tag="Nmul_A0365"
FT   CDS_pept        complement(396500..397321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73673"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022484"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC48"
FT                   /protein_id="ABB73673.1"
FT                   /translation="MSLTEILDLGHAFKRYFEIVPAFSDELKDEVHRIRHEVYCEDLKF
FT                   EPLQRDRRESDEYDIDSLHFLLRNVQTQEFIGCARIISPRPKDPDYPLPFEITCADTLD
FT                   RSIIDPALLPRHHIAEVSRLAVVASYRRRKGEASKAIDIADEDFGVAQSRRFPYIPISL
FT                   YLGTFELARLHKIETLFILTEERLALHFAKLGFDLKFIGPPVEHHGIRVPSMMSVSGTI
FT                   KGMRPNLRPLYDVITEDIKRNLPETGNGLPGIENEYSGSGPQGIIAVKPAT"
FT   gene            complement(397502..398263)
FT                   /locus_tag="Nmul_A0366"
FT   CDS_pept        complement(397502..398263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73674"
FT                   /db_xref="InterPro:IPR011220"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC47"
FT                   /protein_id="ABB73674.1"
FT                   /translation="MQKNSEQYLLTVILLFAIAVPTAIADTNDTELAQTILEKADQIRF
FT                   PRESFQVDVTINTTAPGQPEDWRKYRVLSKGNENSVVMTTEPASERGQILLLKGRDLWI
FT                   FMPEVSQPVRLSLSQRLTGQVANGDLARANFAGDYNAKILRTDVIEGEKYYVLELTGVD
FT                   RGVTYHKVLYWVGQSNFWPYRAEFYSLSDRLLKTARYEKFQMLHGALRPTRLVMEDALR
FT                   TGEQSVLEYSGMKQRDLPDKVFTKDYLKKLD"
FT   sig_peptide     complement(398186..398263)
FT                   /locus_tag="Nmul_A0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            398321..399055
FT                   /locus_tag="Nmul_A0367"
FT   CDS_pept        398321..399055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0367"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73675"
FT                   /db_xref="GOA:Q2YC46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC46"
FT                   /protein_id="ABB73675.1"
FT                   /translation="MSDTGIVHLENVSKDYILGEQKVQALKDITLDIASGAFLAIAGPS
FT                   GSGKSTLLNLIGCIDTPTAGKVLINGQDISGRTPDDLSGLRARTIGFVFQTFNLFPVLS
FT                   AEENVEYPLLQFRELKTAERRIRVAEYLDIVGLSRFARHRPNQLSGGQRQRVAIARALA
FT                   THPKIVLADEPTANLDHATGEGILELMKNINDKFETTFIFSTHDSRVMAIADNVIHIQD
FT                   GQIVQREIRKEKSMHVIEHRDR"
FT   gene            399083..400795
FT                   /locus_tag="Nmul_A0368"
FT   CDS_pept        399083..400795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73676"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC45"
FT                   /protein_id="ABB73676.1"
FT                   /translation="MTKVAPMSYGIRGVYLISLKALLVVRSISFAGEAQVQLPDAAKPV
FT                   PVIYDANEDRTTPAEPLMLTLSLAMGTSPARPVREPDDRAGAVVSQGENVERRLGEEKP
FT                   LLLSVSPSLSFISAPAAKDHEINLSREPAPVIAAGNDAESEFTSREALFGDDLGQEQKP
FT                   SKPMPAWKRLVTGWRGFSQLEIADTYTDPEHLSKAKLRTELSRTGQFNENIKWKISGRF
FT                   DYDAAYDLSSFYPHAVRQDQRYQFFVRENYLDVSAGDFDFRLGRQHVIWGEMVGLFFAD
FT                   VVSAKDLREFVLPAFDILRIPQWAARAEYSKGDSHAEVVWIPVPTLDEIGKPGADFYPG
FT                   PLRGVATYLPEDRSGRNIANSNYGVRLSHLVNGWDISGFYYHSLDSSPTFYRIGGPLDP
FT                   PVFQPRHDEIDQVGGTLSKDFGSIVLKGELIYTDGRKFNVTRPTAMNGLVRQNTLDYVI
FT                   GLDFSLPAETRLNLQFFQRVFFTHDPDLPLDRLENGASILLNGKLSPKIEAQALLIHSL
FT                   NRSDWMFRPRLSWNFQPNWRWAVGADVFGGPPIGLFGRFDHADRVYTELRYSF"
FT   gene            complement(400827..402038)
FT                   /locus_tag="Nmul_A0369"
FT   CDS_pept        complement(400827..402038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0369"
FT                   /product="Protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73677"
FT                   /db_xref="GOA:Q2YC44"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC44"
FT                   /protein_id="ABB73677.1"
FT                   /translation="MLRLAFRNIFRQKSHTAMTLAAIVSGVVALVLAGGWVNDIFVTLS
FT                   EALIHSRSGHLQVYKEGFFAAGAHAPERYLITDDEAIKRRIMNNEGIDSVMARLNFSAL
FT                   LNNGRADLPIIGEGVEPAKEAALGSSVSIISGRQLQNTDKFGIAIGVGVAQELKLKPGD
FT                   HVTLLANTLEGALNTIDLEVVGVFKSFSSDYDARAIRIPLAASQELLGTQGVNALVISL
FT                   KKTDDTFRIAGLLKEQLETLGLEIKTWIELNDFYEKTVELYGRQLGFLQLIILIMVLLG
FT                   VLNSVNMSAFERTGEFGTMMALGNRRNEVFQLIITENFLLGVIGSGLGLGLGIGLALII
FT                   SAIGISMPPPPNSNLGYTAHIQIVPGVLLASFAIGIAATVSAAIVPGRHISRTPVVDAL
FT                   RQNI"
FT   sig_peptide     complement(401937..402038)
FT                   /locus_tag="Nmul_A0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.876 at
FT                   residue 34"
FT   gene            complement(402055..403284)
FT                   /locus_tag="Nmul_A0370"
FT   CDS_pept        complement(402055..403284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0370"
FT                   /product="Protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73678"
FT                   /db_xref="GOA:Q2YC43"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC43"
FT                   /protein_id="ABB73678.1"
FT                   /translation="MDRIRLDFLLAFRNMVRHKRRSAIAVGAVTFGIIALILAAGFIEW
FT                   IFWGMQEATIQSQLGHIQISRPGYQEAGKADPYAYLLPDAIPELEPANGPAQIKTIIPR
FT                   LSFGGLISHGDATLSFVGEGVIPEEKAILSGSVEISAGENLSVDAPKGIILGVGLGRNL
FT                   NVNIGDKVVLLASTASRGVNAVEVTVRGLFSTVNKSYDDIALRMPIETARQLLRVKGSH
FT                   VWVVLLNDTAKTDTVLQRLRDSLQKSDFEVVPWYVLADFYNKTVALFTKQIHGLKLIIA
FT                   FIILLAILNAMTMSVMERIGEIGTDMALGARRIDVLRRFLSEGILLGGFGGLLGVTIGV
FT                   ALAAMISSIGIPMPPPPGTTRGYTGEILVTWNIAFESLLLAIGATLTASIYPAWKASRM
FT                   QIVDALRHNR"
FT   sig_peptide     complement(403165..403284)
FT                   /locus_tag="Nmul_A0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.770 at
FT                   residue 40"
FT   gene            403646..404857
FT                   /locus_tag="Nmul_A0371"
FT   CDS_pept        403646..404857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0371"
FT                   /product="UDP-glucoronosyl and UDP-glucosyltransferases
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73679"
FT                   /db_xref="GOA:Q2YC42"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC42"
FT                   /protein_id="ABB73679.1"
FT                   /translation="METGNKPIILLVAEAVTLAHFGRIVTLARALDSNKYEVVVASDPR
FT                   YLDLDAPLNCTFHPIRSIPSAEFALALARGKPVYSLETLSRYIEDDLALLDLVRPALVV
FT                   GDFRLSLAVSAPLRKIPFATVVNAYWSPYAVTRYPVPDLPVTRILGITLAQKLFDIIRP
FT                   VAFALHARPLNRLRRRFGLTPLKQDIRNTYTWADYTLYADIPEVVPALNLPPHHRYLGP
FT                   ILWSAAISLPAWWDCLPEDKPVVFLSLGSSGMAALLPMALAALSQLAITVVVATARKIT
FT                   IDEVPANAYVTDYLPLDRVASRLKIVISNGGSLTTYQALSSGVPVIGLCSNLDQLLNMN
FT                   AVQQLGAAITLHCARISVTDLVMAVTAMLDNPSYGRAAIKISQILAESDAKQRFREFVV
FT                   QVLH"
FT   gene            404913..405725
FT                   /locus_tag="Nmul_A0372"
FT   CDS_pept        404913..405725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0372"
FT                   /product="Catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73680"
FT                   /db_xref="GOA:Q2YC41"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC41"
FT                   /protein_id="ABB73680.1"
FT                   /translation="MDHQYTTLERNRYFEVLGGLNVENRGDNKVAMLSELDMTSAQALR
FT                   TSVDRQTGIKPSYTAIVAKAVSIALREHPYANRMAVERLFWKRILQLHDVHMTIAVERD
FT                   RPGIEQAVFAGTIRDTDKLDVAAITKELQSLAQSTEETNERWRLLKRMVETLPPALARR
FT                   LISIPRWLPDQWIKHRGGSVMISSPAKYGVDMMVANWPWPIGYSFGLVKDRVIAVEGAA
FT                   QVRPTMVLTMSFDRRLMGGAPAARFFRTVCEHIEHAERDMALPVNIPS"
FT   gene            complement(405870..406709)
FT                   /locus_tag="Nmul_A0373"
FT   CDS_pept        complement(405870..406709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73681"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC40"
FT                   /protein_id="ABB73681.1"
FT                   /translation="MNKKLINLSMAAVLLGGPAIGYSATLDTFSADGVLQNFTGFDWHS
FT                   NGGGWVQGFDLTGANMQGDSDTFTLTYQAFAGVINTTSPTNNLFVAAPGSQNGTYEVTT
FT                   FQTLTQTATCANDGCSSIDITTNSGSWRIFLDSSPDANQSTGTGFLDGVNILSGTWDSG
FT                   FSTFSATGAIPGPAVLGTGGGFLFGTVTFTNNTYVNPALAGTQFQASLQFPGQSAPSYT
FT                   RPAAFDGVATGADTASSFVIQTDGSQGFTHGEVPEPGILALMGIGLLGFAFTGRRRT"
FT   sig_peptide     complement(406638..406709)
FT                   /locus_tag="Nmul_A0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.617 at
FT                   residue 24"
FT   gene            complement(407378..409432)
FT                   /locus_tag="Nmul_A0374"
FT   CDS_pept        complement(407378..409432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0374"
FT                   /product="UBA/THIF-type NAD/FAD binding fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73682"
FT                   /db_xref="GOA:Q2YC39"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC39"
FT                   /protein_id="ABB73682.1"
FT                   /translation="MVQDFSYREATSRNIGWVTPVEQEILRYKRIAIAGLGGVGGIHLL
FT                   TLARLGIGAFHIADFDVFDLVNFNRQVGATVSSLNRPKSEVLAAMARDINPELNIKIFP
FT                   RGVNPDNLPEFFEDVDLYIDGLDFFAFSARAVTFSACEERGIPAITAAPLGMGSALLNF
FT                   LPGKMTFEEYFQWGDLPEVEKALRFLIGLAPTGLHARYLLDPSSINLKERRGPSTIMGC
FT                   QLCAGIAATEALKILLNRGTVLAAPHGVHFDAYRNKLIRTWRPGGNSNPLQQFSLAIAR
FT                   RRLSKKNTNKLFGDPEPYSSTGTIIPSESTGCEDESKRPPELKSYTLIEQILDLARWAP
FT                   SGDNTQPWRFQIVGDNSLTIHGFDTRDHCVYDLDGRPSQISIGALLETISIAATGHGLK
FT                   TSIQRRPDCSDTKPTFDIHFGSDPHLKPDPLIPYIRYRSVQRRPMSTRPLTGREKSALE
FT                   AAVKPQYDILWLEGFSRRLEMARFLFDNAKLRLIMPEAYQVHRAIIQWNSRYSADKVPD
FT                   QALGVDPFTARLMHWIMGSWDRVEFFNTFLAGTWAPRLQMDLIPAMACGGHFVILAPHA
FT                   PRSIDDYVSAGRVMQRFWLTATKLGLQLQPEITPLVFARYSRESIPFSKTKQCITLATS
FT                   LTRRLGHILGEEVATRAVFMGRIGAGKRPASRSIRLELEQMLWRLRAGA"
FT   gene            complement(409595..410413)
FT                   /locus_tag="Nmul_A0375"
FT   CDS_pept        complement(409595..410413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0375"
FT                   /product="possible long-chain N-acyl amino acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73683"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC38"
FT                   /protein_id="ABB73683.1"
FT                   /translation="MHIFQPFYALITHRYNFLPHDSEDSEAIISFESPYRWQDICIGKH
FT                   DSKSVRTHSIDQQRFHIRMANSEDQREAASLLIKKRYSWRGYSVDMPVINEPNRITLIA
FT                   ETANQTVGTMTLCVDGNSSLPADENFGDELNELRAQGRRLCEPSRLAIDDNVPPRVFAS
FT                   LIHVCYIYAANIHGFTDWVVEVNPRHAGFYKRMLGCRQIAEERVCTRVDAPAVLLRVKL
FT                   EYMAEQIGKFGGLMEQHGNERSFYPYFFSAEDEGNITERLKTGGVWVPSA"
FT   gene            complement(410657..413446)
FT                   /locus_tag="Nmul_A0376"
FT   CDS_pept        complement(410657..413446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0376"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73684"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014266"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC37"
FT                   /protein_id="ABB73684.1"
FT                   /translation="MRAFRKTVLKKTGLTLAIAAALTVSSMQGCNKAVDPVKLMADAKR
FT                   YEESGDHKSAIIQLKNALQQNPDNSEARYLLGAIYNKTGDFQSAEKELRKALSLGMDAG
FT                   KVLPELGQALLRLGAYQQILDETKELADKTKSAQILTLRGNAQLGLGKTAEAKALFEQA
FT                   LGHNPDSADALIGLAKYSLVQRDVEGATHFSEQAVSRSPQNVEAWLFRGDLLRMQGKSG
FT                   EALAAYDQVVKLKPNAAIAYINKAFIEIGTGKFEAAKADIDAARKISPSLMVFYTQALL
FT                   DFSQQKPAAALESLQQVLSKSPDHMPSVLLAGAVQFALGSMPQAEQHLKHYLEKDPGNI
FT                   YARKLLASALLKNGETKRAIDILTPPLKNVKEDPQLFALAGEAYMQAKDFAKATEYFEM
FT                   ASDIAPRSAMLHTALSMSRLGQGENARAISELETATKLDPKSPRAGVLLVMTHLRLKEF
FT                   DKALAAVKALEKENPDNPLIQNLKGGVYLGKNDIANARASFEKALAIQPNYFPTIANLA
FT                   RLDIQDKKPDAARKRFEAILEKDKKNIQAMVALAGLAVNQGQNQKATEWLERAMQANPD
FT                   VLQPAILLGTHYLRLGEKQKALALAKKLEGTHSKDSAVLDLLAQAQLANNDKSSALESY
FT                   ARLAVVQPESPLVQFRIASIHMAMRNLSAASDALKKSLAIKPDYLAAQLAQIDIEAEQG
FT                   NYEKAIAMARQVQKQHKGSPAGYIAEGDLLLKQKKPALAASAYEQAFAVNKTSPLLIKL
FT                   HASLRQAGKDKEADLRLIEWLKKHPNDLSARMYLADTFLTEGKLAAAVEQYQTVLKEQP
FT                   KFAPALNNLATAYQRQKDPRALEYAEKAYQLATENPAVLDTLGWVLLEQENIARALPLL
FT                   QKAASLAPQAGEIRYHFASALVKSGNKSQARKELEQILATGKTFSGIDEARALLERIQ"
FT   sig_peptide     complement(413348..413446)
FT                   /locus_tag="Nmul_A0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.588 at
FT                   residue 33"
FT   gene            complement(413951..414733)
FT                   /locus_tag="Nmul_A0377"
FT   CDS_pept        complement(413951..414733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0377"
FT                   /product="Inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73685"
FT                   /db_xref="GOA:Q2YC36"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC36"
FT                   /protein_id="ABB73685.1"
FT                   /translation="MIDAVIAAVKAVAQQEILPRYMKVARQRKVDGSLFTEADLATQEA
FT                   LARELRKIYPGPVVGEEMTENEQVAHWREGEAGLWCMDPIDGTSNFVNGLSYFAVSVAL
FT                   MRQGRSVLGVVYNPVADEMFYAEKGRGAFLNGEKLPIKEDVPPLCAAIASVDLKRLGRR
FT                   LAQEVSTAKPFSSQRNFGSCALEWCYTAAGRFDLYLHGGQKLWDYAAGSLILEEAGGHM
FT                   CGLNEDDFWTEPLWQRSAIAALDLNLFMQWRDWVRAHR"
FT   gene            complement(414737..415294)
FT                   /locus_tag="Nmul_A0378"
FT   CDS_pept        complement(414737..415294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73686"
FT                   /db_xref="GOA:Q2YC35"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC35"
FT                   /protein_id="ABB73686.1"
FT                   /translation="MASLETPVCDFGWKAIDFNLPGVDGKHYNLASVKGEKGLLVMFIC
FT                   NHCPYVKAVRERIIRDVKELREQGIGAIAIMSNDPSDYPEDSFENMGRVAREYAYPFPY
FT                   VWDETQEVAKAYGAVCTPDFFGFNHKLELQYRGRLDASRKEAAPVDARRDLFEGMLQVA
FT                   RTGGGPKDQIPSIGCSIKWRAD"
FT   gene            415519..416286
FT                   /locus_tag="Nmul_A0379"
FT   CDS_pept        415519..416286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73687"
FT                   /db_xref="GOA:Q2YC34"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC34"
FT                   /protein_id="ABB73687.1"
FT                   /translation="MTLPRFYCPIEILAGQTLELPSAVAHHAARVLRLEAGDEVVLFNG
FT                   DGGEFTCVILRASKQGVDVVVERHVQVERESPLTILLAQAVCMGEKMDWIVQKAVELGV
FT                   TRIQPLITKQSVVRLGGERGEKRVSHLQKVVISACEQCGRNHVPEVLPLATLRNWLGRQ
FT                   TEARRMSSDSLSPDACFMLSPFATKGLRDFKHSSNIGSIILLVGPEGGFTQDEEAAAMV
FT                   AGFIPLRLGHRILRTESAALAAVGAMQALWGDY"
FT   gene            416289..417617
FT                   /locus_tag="Nmul_A0380"
FT   CDS_pept        416289..417617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0380"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73688"
FT                   /db_xref="GOA:Q2YC33"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC33"
FT                   /protein_id="ABB73688.1"
FT                   /translation="MDFVTWFRSVAPYINSFRHKVFVVAFGGEVVADGKFIELVHDLNL
FT                   LASLGVRLVLVHGARPQIESRLNEHDLQTTYIRGMRVTDAAALQCVKESIGRVRVEIEA
FT                   LLSMGLPNSPMANAAIRVASGNFVTARPIGVIEGIDLMHTGEVRKVDISAIRSRLEQGE
FT                   LALLSPLGYSPTGEIFNLTLENVAAEAAIALKAEKLIFLMDTQGIEKSTADSEQALLLR
FT                   ELTVGEGRSLLKEFGRKMVQLAEDAQLYLPFALHACERGVSRVHLISRHVDGAILQELF
FT                   THSGIGTMISEGPLQNLRDARIEDVGAILQLIEPLEADGTLVRRSRELLEMEIDRFVVI
FT                   EHDRMIVGCAALYPFPDDMAGELACLTVHPDYRSAGCGDALLKAIEAKARSQGSKKLFV
FT                   LTTRTAHWFVERGFLSADVSQLPKVKQGLYNYQRRSKVFMKPL"
FT   gene            417725..417997
FT                   /locus_tag="Nmul_A0381"
FT   CDS_pept        417725..417997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0381"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73689"
FT                   /db_xref="GOA:Q2YC32"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC32"
FT                   /protein_id="ABB73689.1"
FT                   /translation="MGRTVNCIKLGRELEGLDFPPYPGELGKRIFENVSKEAWAGWIRH
FT                   QTMLVNEYHLNLSDIKARKYLAEQLDAYFFGSGAEQPRGYVPLAK"
FT   gene            418052..420127
FT                   /locus_tag="Nmul_A0382"
FT   CDS_pept        418052..420127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0382"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73690"
FT                   /db_xref="GOA:Q2YC31"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC31"
FT                   /protein_id="ABB73690.1"
FT                   /translation="MTDSRASGQFLNREVGQIEFNRRVLAQAENEETPLLERLKFLCIV
FT                   SSNLDEFFEVRVAGIKEQIKLDTRGFDPAGMLPHQIFKLVSEQAHALVARQYALLNQQI
FT                   LPGLANEGIHFLRRATWNDAQRTWIKSYFFREMMPVLTPIGLDISHPFPRVLNKSLNFA
FT                   VELEGKDAFGRNSGVAIVQAPRVLPRLIQLPPEISSSTYNFVFLSSILHAHVGELFAGM
FT                   NVLGCYQFRATRNSDLFVDEEEVKNLRIALQGELPQRHFGNAVRLEVADNCPPHMSAFL
FT                   LEQLGLAQEDFYQVEGPVNLARMMHVFERIDRPDLRYLSFIPGLPLTLQKKKASDIFQL
FT                   IRKNDILLHHPYQSFQPVIHFLQQAATDPDVVAIKQTVYRTGADSQVMTALIAAASSGK
FT                   EVTVVVELLARFDEEANINWASRLENVGAHVVYGVVGHKTHAKMAMIVRREEGSLRRYV
FT                   HVGTGNYHASTARLYTDFGLFSCQEDFCADVNEVFTQLTGLGKAGKLKYLWQSPFSFHS
FT                   QMIASIENEAQNAKAGKPARIIAKMNALLEPGVIKALYAASEAGVKIDLIVRGVCALRP
FT                   GIKGLSENIRVRSIIGRFLEHSRIFYFRNGGAYDIYLSSADWMDRNFFRRIEICFPVLE
FT                   PKLKKRVLEEGLYVFLKDNCQAWEMDSEGRYHLRQSGQRKKQSAQETLLMELAAAQ"
FT   gene            420199..421758
FT                   /locus_tag="Nmul_A0383"
FT   CDS_pept        420199..421758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0383"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73691"
FT                   /db_xref="GOA:Q2YC30"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC30"
FT                   /protein_id="ABB73691.1"
FT                   /translation="MPLEIELKLRLSPEDVGRLRGDPLLTSLTVSRPVSQKLFTAYYDT
FT                   PDLYLQRHQMALRLRHIGRKWIQSIKGGGEAALGLHQRHEWESMVPTGRPDFSQITDPS
FT                   LIRLFDGAESHGQLCVLFTTDFQRSKRVLRLVDGSEIEFSLDRGVIRTPADFTSEICEI
FT                   ELELKSGSAQSLYQFALDILHIVPFRLENTSKAERGYRLVTGFKPTPIRAAAVRLETEM
FT                   KLGEAIKVIAWNCLDHLHGNEAGMLQHQDPEYLHQMRVALRRIRTARRVFARAFAATGF
FT                   ASATSDLKWLSRSLGGARDWDVFVSETLSEVRNYFHERPGIFALWEECEQIRQNHNEAA
FT                   CEAVGSTRYTEAMLRLGAWLNAEIRLLAPDSQQSELRKTGLEWPVKKFADSALSHGHEK
FT                   LKKYYKRAEGQSSEAVHALRIAVKEQRYTAEFFSDLYRRKRVKRYIKSLTGLQETLGAV
FT                   IDTTVTERLLNEVGVAEGRDENDGMCEARGIVLGWTVQRGLMKRSELDEIWGDFAKKEV
FT                   FW"
FT   gene            complement(421965..423029)
FT                   /locus_tag="Nmul_A0384"
FT   CDS_pept        complement(421965..423029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0384"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73692"
FT                   /db_xref="GOA:Q2YC29"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC29"
FT                   /protein_id="ABB73692.1"
FT                   /translation="MALVSLRQLLDHAAENGYGLPAFNVNNLEQIHAIMQAADECDSPV
FT                   IMQGSAGARKYAGEPFLRHLIAAAVEAYPHIPIVMHQDHGASPAVCVNAIRSGFSSVMM
FT                   DGSLEADAKTPSSYEYNVEVTGKVVEMAHAVGVSVEGELGCLGSLESGMGEAEDGHGAE
FT                   GKLSHDQLLTDPEQAADFVKQTGVDALAIAIGTSHGAYKFTRKPTGDILAIERIKEIHA
FT                   RIPNTHLVMHGSSSVPQDWLDIIREYGGEMKETYGVPVEEIQEGIKYGVRKVNIDTDIR
FT                   LAMTGAIRRHLAKNKSEFDPRKYLKDATAAARDICKARFEAFGCAGQAAKIKPIALDNM
FT                   AGKYAKGELKAVIK"
FT   gene            complement(423112..424566)
FT                   /locus_tag="Nmul_A0385"
FT   CDS_pept        complement(423112..424566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0385"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73693"
FT                   /db_xref="GOA:Q2YC28"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC28"
FT                   /protein_id="ABB73693.1"
FT                   /translation="MIRRTKIVATLGPASRDAKVLERMINAGVDVVRINFSHGTREEHI
FT                   EGAELARSLARAAGHAVGVLADLQGPKIRIGKFENNKILLKTGDQFILDAECELGNQER
FT                   VGLDYKELPNDVETGATLILDDGRIVLGVSEVKGSQVYCVVEQGGILSNNKGINRKGGG
FT                   LSAPALTGKDVEDIRTAAALKADYLAVSFPRSGDDMRWARDVMREAGGKSLLMAKIERS
FT                   EAILALDDILEASDAIMVARGDLAVEVGDAAVPALQKRMIRTARTKNKLVVTATQMMES
FT                   MVSSPIPTRAEVSDVANAVLDGTDGVMLSAESATGQYPVEAVAAMARVCLEAEKEYLVS
FT                   SENRRLQGGLPDNIEEAIARATMFTAGGLKIRAIAALTQSGRTVLLMSRRSSTVPIFAL
FT                   SPQEDTRRKMTLFRGVYPVKFGGGSNDPEIILNHAENELLRRGAVRNGDLMIMTIGEPV
FT                   GKAGGTNTMKIVKVGEHRKQERKVES"
FT   gene            complement(424623..425810)
FT                   /locus_tag="Nmul_A0386"
FT   CDS_pept        complement(424623..425810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0386"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73694"
FT                   /db_xref="GOA:Q2YC27"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC27"
FT                   /protein_id="ABB73694.1"
FT                   /translation="MSVIRVTDLDLKGKRVFIRADLNVPVKDGKVTSDARISASMGTID
FT                   YCLKQGGKVMVTSHLGRPEEGVWSEENSLKPVADNISERLGKPARLIKDWVDGNFDVAE
FT                   GELVILENCRFNKGEKKNADETAQKYAKLCDVFVMDAFGTAHRAEASTYGIAKYAPVAC
FT                   AGILLTEELDALTKALLNPARPMVAIVGGSKVSTKLTVLESLSEKVDQLVVGGGIANTF
FT                   LKAAGQNVGKSLCEDDLVPIAKMLMEKMAKRNATIPIAVDVVVGKKFDASEPAVLKNAD
FT                   AVTDDDMIFDIGPKSARELSDIIMKAGTVVWNGPVGVFEFDQFGEGTKTIAMAIADTDA
FT                   FTLAGGGDTIAAIQKYDIYDRVSYISTAGGAFLEFLEGKKLPAVEILEQRAAGSR"
FT   gene            complement(425941..426942)
FT                   /locus_tag="Nmul_A0387"
FT   CDS_pept        complement(425941..426942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0387"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73695"
FT                   /db_xref="GOA:Q2YC26"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC26"
FT                   /protein_id="ABB73695.1"
FT                   /translation="MTIKVGINGFGRIGRMVFRAAVQNFPDIEVVAINDLLEPDYLAYM
FT                   LQHDSVHGRFKGDVSIEDSTLIVNGKRIRLTAIKDPAELKWGEVGAEVVVESTGLFLTK
FT                   ESCQKHIAAGAKKVIMSAPSKDDTPMFVYGVNNDSYDGQAIISNASCTTNCLAPVAKVL
FT                   NDTFGVKRGLMTTVHAATATQKTVDGPSNKDWRGGRGILENIIPSSTGAAKAVGKVIPE
FT                   LNTKLTGMAFRVPTSDVSVVDLTVELEKEASYEEICNAMKKASEGSMKGVLAYTDQKVV
FT                   STDFRGESATSIFDAEAGMALDGNFVKVVSWYDNEWGYSSKILEMVRVVAGK"
FT   gene            complement(427023..429038)
FT                   /locus_tag="Nmul_A0388"
FT   CDS_pept        complement(427023..429038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0388"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73696"
FT                   /db_xref="GOA:Q2YC25"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC25"
FT                   /protein_id="ABB73696.1"
FT                   /translation="MGTFRDFEAPVFKNLTSAIRALAMDAVQKANSGHPGMPMGMAEIA
FT                   EVLWIHHLRHNPANPKWADRDRFVLSNGHGSMLIYALLHLTGYDLPMEEIKRFRQLHSK
FT                   TPGHPEYGYTPGVETTTGPLGQGITNAVGMALAEKILASEFNRPGFDIVNHHTYVFLGD
FT                   GCLMEGISHEACSLAGTLGLGKLICFYDDNGISIDGHVEGWFTDDTPKRFEAYGWHVVP
FT                   NVNGHDPVAIEAAIEAAKQAVDKPSMICCKTVIGMGSPNKANTHEVHGAALGDLEIAAA
FT                   RPHIGWNHLPFEIPEDVYQNWDARAKGQKLEDGWNRKFAEYAAKYPTEAAEFSRRMAGE
FT                   LPEGWQEHVDGLVARVHAKEETIASRKASQNAIEGLAPKLPELVGGSADLAGSNLTLWS
FT                   GSKGIARQDGGNYVYYGVREFGMSAIMNGLALHGGIIPYGATFLMFSEYARNALRMAAL
FT                   MKIRCLFVFTHDSIGLGEDGPTHQPVEQTATLRYIPNMDVWRPCDTVESTVAWARAIER
FT                   KDGPSTLIFSRQNLPFQKREGNTIKLIDKGGYILSEASDNQPRAVIIATGSEVGLAMMA
FT                   QKALAETGIHVRVVSMPCTNVFDRQDVDYKSSVLPKGIGRVAVEAGVTDYWRKYVGLEG
FT                   AVVGIDTFGESAPAGELFKHFGITVENVIKAVNSVI"
FT   gene            complement(429178..430476)
FT                   /locus_tag="Nmul_A0389"
FT   CDS_pept        complement(429178..430476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0389"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73697"
FT                   /db_xref="GOA:Q2YC24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC24"
FT                   /protein_id="ABB73697.1"
FT                   /translation="MTFNFISVASKSIPGIMSNNTILIVDDEIGIRELLSEILRDEGYR
FT                   VALAENAAQARAWRKQARPDLVLLDIWMPDTDGITLLKEWVSSGLLTMPVVMMSGHGTI
FT                   DTAVEATRMGAAAYLEKPVPLQKLLSTVGRALRSGQAKPRMTLPLASLGRGALITDLKR
FT                   RLEQVASLTAPVLLISEPGTGVDLCARFLHEPNTPWVEPDTLATLSNAPFELLEQAKGG
FT                   LLFLKEIDELNKLAQKGLLLLLGKLERYSVRLVCVTSTPLASLAAQGVYDPKLYEMLSG
FT                   LCINVPALREHREDIPELATQILSRYIESGDVPLRQFSTAALNCLRNHDWPGNLAQLTG
FT                   AVHTLALSCTSDEISAEDVKQILVPSSPSQAVAGIPLDIPLREARDMFEKTYFEQLIEQ
FT                   ENGNMTRVAERAGLERTHLYRKLKLLGIRLRGN"
FT   gene            complement(430486..432720)
FT                   /locus_tag="Nmul_A0390"
FT   CDS_pept        complement(430486..432720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0390"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73698"
FT                   /db_xref="GOA:Q2YC23"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC23"
FT                   /protein_id="ABB73698.1"
FT                   /translation="MMKYLIIAGVALGAIMLLLLASAGADTGLFDRKYRLLIRLNAGLV
FT                   LFLMAIVGYLLWRLRRRLQAGVFGSRLALRLLLIFSLMAVLPGVLVYSISVQFLGKSIE
FT                   SWFDVKVDRALEGGLELGRTILDSRLEDLHREADLAALALSEQAGPLPPVLNQLVHQMQ
FT                   AQEAVLFDHEGNVVAFARADTSETVPDALSTTSLHQIRTENGYSTIESIAGEGLYLKVW
FT                   SPIDVPGVRNNTRILQLTQPVPTQLAEDAEIVQAAYRDYQELLLSREGLKHLYGVTLTL
FT                   ALLLALFSALAAAFLISERLSAPLGMLAEGTRAVAQGDFSRRHPVRSRDELGVLTESFN
FT                   LMTQQLEEARITAQHNQQEVESARAYLENILANLSSGVLVFDESLHLRTANLSAEQILN
FT                   VPLPGLEGLTIEECAMRESELHAFAYGILEGFHSETKGEWQRQVERTREGTRQVLLLRG
FT                   TWLAHVPGGGGVVVFDDITHLLETQRAAAWGEVARRLAHEIKNPLTPIQLSAERIQHKL
FT                   AAKLNDNDAQILHRSTETIVNQVEALKRMVNEFSEYARAPEPEFHLLDFNALVREVLAL
FT                   YESPATAAPDNRQPHIDLVLVPDLPMMKGDSARLRQVIHNLLQNAQDALAGLPQPAIMI
FT                   KTETLPSGIRFTVSDNGGGFPEQVRARVFEPYVTTKPKGTGLGLPIVKKIIEEHRGTIQ
FT                   IENRRPHGARISIVLPLSPDKLVVSLKDGWFRPIAGEPALSLSCELQSKE"
FT   sig_peptide     complement(432643..432720)
FT                   /locus_tag="Nmul_A0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 26"
FT   gene            complement(432717..433334)
FT                   /locus_tag="Nmul_A0391"
FT   CDS_pept        complement(432717..433334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0391"
FT                   /product="possible proline rich signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73699"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC22"
FT                   /protein_id="ABB73699.1"
FT                   /translation="MHCLKSSDFLPRLLRMTVAALLLALIGQASSAHGEASIEIKSVRI
FT                   KPVEGAYEFDADFQITLNHKLEHALEKGIVLYFVTELSLVNSRWYWFDERVGYSRVREG
FT                   LSYYALTRQYRLTRGALSQNFGSLSDALQALSRVRDRPINASEELIPNAEYTVELRTRL
FT                   DIAALPKPFQVETLGSREWDLGSGTLRWNTRLPSQKLQDNSK"
FT   sig_peptide     complement(433230..433334)
FT                   /locus_tag="Nmul_A0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 35"
FT   gene            complement(433312..434640)
FT                   /locus_tag="Nmul_A0392"
FT   CDS_pept        complement(433312..434640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0392"
FT                   /product="sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73700"
FT                   /db_xref="GOA:Q2YC21"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC21"
FT                   /protein_id="ABB73700.1"
FT                   /translation="MIRTQRLAATTVERVVSGASLTTVLQETWRSHSGLSDQQRGAIQD
FT                   LSYGVLRFYGQLDILLGLLLNKPLKDQSLRYLLLVGLYQLQYSKTAPHVVVDSAVSASC
FT                   SPSIDGRNSRNMLDPRHAKSIGGLVNAILRNFLRKRPALLEKTAATEVGRYSHPQWWID
FT                   KLRAQYPSRYQAVLETANIRPPMALRVNQRRTNVEAYQKLLHNAGLNARRPENEWTEEA
FT                   LELFHPVPVEKLPGFGQGLVSVQDVAAQMAAPLLCPQSGMRVLDACAAPGGKSAHLLEL
FT                   TDLELTAVDNDGERLERLKQNFTRLGLKPYRIIHGDATHPGEWWDGRPFDRILADAPCS
FT                   ASGVVRRHPDIKWLRRESDLAQFAEIQRKTLDALWQTLVKGGKLLYVTCSIFAEENGLQ
FT                   VESFLNHHPDARLLPFSVPEIVEGQLLPDLHHDGFFYALLEKL"
FT   gene            complement(434637..435575)
FT                   /locus_tag="Nmul_A0393"
FT   CDS_pept        complement(434637..435575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0393"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73701"
FT                   /db_xref="GOA:Q2YC20"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YC20"
FT                   /protein_id="ABB73701.1"
FT                   /translation="MRIIFAGTPPFAAAALEALADAGHEIALVLTQPDRPAGRGMKNAS
FT                   SAVKLLAQKRGFGLLQPPSLRQPELHMQLEAVRADIMVVAAYGLILPFSVLNIPKLGCV
FT                   NIHASLLPRWRGAAPIERAILAGDRETGITIMQMDRGLDTGPILLVRSITIAKDDTAGT
FT                   LHEKLGQLGAACIVEALALLQQGKIIATPQNDLAATYASKLEKTEAEIDWRMDAENIDR
FT                   AVRAFNPRPGMHSTVNGISMKVWQTSVDIAETDEKPGEIVAIRPDGIVVACGKHALILK
FT                   IVQKSGGKKLRSAEFLLGHSLHPHDRFESGE"
FT   sig_peptide     complement(435513..435575)
FT                   /locus_tag="Nmul_A0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.873 at
FT                   residue 21"
FT   gene            complement(435780..436355)
FT                   /locus_tag="Nmul_A0394"
FT   CDS_pept        complement(435780..436355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0394"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73702"
FT                   /db_xref="GOA:Q2YC19"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC19"
FT                   /protein_id="ABB73702.1"
FT                   /translation="MRRTIAIRRRLEFCIQFLLCSSLFMALLKILQYPDERLHTIAAPV
FT                   PEVTDEIRVLVQDMAETMYAAPGVGLAATQVDVHKRVIVIDVSNTHDQLLVLINPEITT
FT                   HEGESDYEEGCLSVPGIFGKVPRAAQITVEALNKDGERFTLDADGLLAVCIQHEMDHLL
FT                   GRVFVEYWSRMKQSRIQAKFRKQRRKVM"
FT   gene            436563..437681
FT                   /locus_tag="Nmul_A0395"
FT   CDS_pept        436563..437681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0395"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73703"
FT                   /db_xref="GOA:Q2YC18"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC18"
FT                   /protein_id="ABB73703.1"
FT                   /translation="MSSIPVQVISQRNIEPDIASWLALDLIDGLGDESMRCLLATFGSP
FT                   AAILSASMTSLERVVKRKVADNIIGGADPQKLNASLKWLEDPQNSVITLADPDYPALLL
FT                   HIPDPPPLLYVKGKRALLNAPMLAIVGSRNATPQGLSNAEAFAEAASNAGFSIASGMAL
FT                   GIDAAAHRGGLRGRASSIAVVGTGLDLVYPASHRKLAHELAERGALVSEFPLGTPPIGS
FT                   NFPRRNRIISGLSRGCLVVEAALQSGSLITARQALEQGREVFAIPGSIHSPLSRGCHAL
FT                   IKQGAKLVESAGDILEEFGCPSGIPILVPEGGEAAREEFLLLKHLSHDIIDVDTLCLRS
FT                   GLTVETVSAMLLTLELDGIIASLPGGRYQRLR"
FT   gene            437968..440508
FT                   /locus_tag="Nmul_A0396"
FT   CDS_pept        437968..440508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0396"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73704"
FT                   /db_xref="GOA:Q2YC17"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC17"
FT                   /protein_id="ABB73704.1"
FT                   /translation="MGKTLIIAEKPSVAADIARALGGFTKHTDYFENDEYVVSSAVGHL
FT                   LELAVPPEHEVKRGKWSFTNLPVIPPHFDLNPIEKTESRLKLLTRLIKRKDVDALINAC
FT                   DAGREGELIFRYITRHVGTKKPVKRLWLQSMTPASIREGFNKLLDDEDVWPLAEAAVSR
FT                   SEADWLVGINGTRAMTAFNSQEGGFHKTTVGRVQTPTLAILIEREDIIKKFVPRSYWEV
FT                   HATFSAREGSYKGRWFDESFTKARKDNEQKAERLWDHATAEAIRVKCLGKSGVVTEESK
FT                   PATETCPLLYDLTSLQRDANGRFGFSAKTTLSLAQALYEKHKVLTYPRTDSRALPEDYI
FT                   ATVKETLGSLQNSGYGAFAAQILGAGWVKPNKRIFNNAKISDHFAIIPTTIEARGLNEV
FT                   ESKLYDLVVKRFLAIFYPAAEFLVTTRITRVENEPFKTEGKVLINPGWQAVYGKEAQPS
FT                   GTEDNSTLVKLEPDEPVTAEEIEVASHQTRPPPRFNEATLLSAMEGAGKWVEDEELREA
FT                   MSAKGLGTPATRAAIIEGLVSENYIQRVGRELHPTAKAFSLITLLRGLKVPELTSPELT
FT                   GDWEYKLRQIEQGKLERNKFMAEIAEMTSHIVQQAKSHRGETISGDFSTLKSPCPKCGG
FT                   VIQETYKKFQCQKCDFALWKILAGRQFETAEMEQLITRREVGPLQGFRSKMGRLFNANI
FT                   KLTDELEMKFDFGADGEQDTEEVDFSGQEPLGKCPRCSGRVFDHGMSYLCEKSLGSAHT
FT                   CSFKIGKIILSRPLEREQVMKLLQTGKTDLLTKFISKKGRPFSAYLVAGKDGKIGFEFE
FT                   VKEAKVKTPAETEETKVAKPRAAPMKKTLSAKTR"
FT   gene            complement(440619..440894)
FT                   /locus_tag="Nmul_A0397"
FT   CDS_pept        complement(440619..440894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0397"
FT                   /product="Phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73705"
FT                   /db_xref="GOA:Q2YC16"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC16"
FT                   /protein_id="ABB73705.1"
FT                   /translation="MKEELDMDTAEIEAKVIQFIATKVENLDASTINRSSKFEELGLDS
FT                   MDTIQLLFDAEDAFGINFDSEEAKGFTTVGDIVSYIETHQPSAPPQ"
FT   gene            complement(440891..442111)
FT                   /locus_tag="Nmul_A0398"
FT   CDS_pept        complement(440891..442111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0398"
FT                   /product="Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73706"
FT                   /db_xref="GOA:Q2YC15"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC15"
FT                   /protein_id="ABB73706.1"
FT                   /translation="MRVVVTGMGVVSPIGIGVDQFWSAAVKGVSGIKRITSFDASSRRS
FT                   QIAGEVTDFDPSTFLSQKYIEQTDRFTQLALLAARLALEDAGGLEAYESRRIGVSIGSG
FT                   MGGFSTFESSALRKFRSQPVPPFTVPRTMANSAAAWIAIRHGFKGMNLTSSTACSSGAN
FT                   AIGAALDLLRAGRADVVVAGGAEACVLPLTINGFEILHALTTTSNDNPARASRPFAKGR
FT                   DGFVMGEGAGILILEKEEQARQRGAKIYAELAGYGQACDATHIVMPDMEGQIAAMQEAI
FT                   RDAGMELDSIEHINAHATSTPLGDTVETRAIKNLFGARAADIAISATKSMVGHSIGASA
FT                   AIGSIATIMALHTGTIHPTINLDEADPECDLDYTPNVAQKRSVRTGLCNAFGFGGNNAS
FT                   ILFTTLA"
FT   gene            complement(442298..442552)
FT                   /locus_tag="Nmul_A0399"
FT   CDS_pept        complement(442298..442552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73707"
FT                   /db_xref="GOA:Q2YC14"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC14"
FT                   /protein_id="ABB73707.1"
FT                   /translation="MESSEYNLLVSLALIPVVIGLQVWVRNRRKRRRNEAGQQEFDSLA
FT                   ATLVSALIEGAAVISSLLLVIWIMGGILRYLFPMIFNAK"
FT   gene            442879..444081
FT                   /locus_tag="Nmul_A0400"
FT   CDS_pept        442879..444081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73708"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC13"
FT                   /protein_id="ABB73708.1"
FT                   /translation="MRPWNIHVRSSLGQFYMKKKISGPHFPEVIVRPVRSYREMGIFID
FT                   IPWSIYADDPMWVPPLRLERRLHFSRFNPFFKHGKWQAWIAYRDDQPVGRISAQIDQLH
FT                   RERYGGHTGHFGLFECIDDKEVSAALFQMAEAWLGAEQTRHVTGPFNLSINQECGILVD
FT                   GFDKPPVVMMPHSRRWYGRLLEEQGYQQAKDLLAYWIELDFKVPRLMDALIGKFADQVH
FT                   LRTLRRDKFNEELEVLRDIFNDAWSENWGFVPFTQAEFAELGASLRLLVPDDCIQIAEV
FT                   DGVPAAFMVALPNLNEIFAELNGHLFPFGWTRLVRIRSRGGVRTGRIPLMGVRRRFHNT
FT                   PLGMALAFMVIDAPRELGRVMGVKAMELSWILEDNKPMRAILDSLGCREYKRYRIYQKM
FT                   L"
FT   gene            444128..444976
FT                   /locus_tag="Nmul_A0401"
FT   CDS_pept        444128..444976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73709"
FT                   /db_xref="GOA:Q2YC12"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC12"
FT                   /protein_id="ABB73709.1"
FT                   /translation="MKKNDLFTAVVLAADRTARDPISLETGAPCKAFARVGGIPMIIRV
FT                   LDALEASGMVKSIILCGPPKSLLPACPELQERIRNGRVVWLPNLDSPSRSARSGLSHVN
FT                   QEAPVLLTTADHALLTPAIVQYFLRNSQASDCDAAVGVVKYEDVAAAFPGAKRTVIRLK
FT                   DANICGCNLYAFLNDRGRGLVSFWQRAEDLRKRPVRLIMETFGFATVFYYLLGLLTIER
FT                   GLRAVRRKTGIRAHPVFLPYPQAGVDVDKVADLVLAESVLARKAPAAGGGSDLHGPTPE
FT                   M"
FT   gene            445010..446086
FT                   /locus_tag="Nmul_A0402"
FT   CDS_pept        445010..446086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0402"
FT                   /product="permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73710"
FT                   /db_xref="GOA:Q2YC11"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC11"
FT                   /protein_id="ABB73710.1"
FT                   /translation="MKIIERYITRELLIPFMVVTVILATLFASFSMARFLAGAVTDSLG
FT                   LIPVLRLVFLKTLIALEVLMPIALYVAVIMGLGRLHRDQEIVVLRSAGVSEHRIIYAVL
FT                   IVAIPMGLISGLFSIFARPWAYEESYLLNAQAEAELNTDRFRAGRFYGSEKKGRVIYVQ
FT                   AKDSSGKQMGEVFHYLNKHDSSEIILAKKAHQPELVFGQRPQIHLLDGSIYRLSHTGKG
FT                   DTVVQFEKLVYFTDSGNVTDYRRKAASTAALMQSDQPRDTAELQWRLSRPLATILLALI
FT                   AVPFSRASPRQTKGDKTYYLAALVFAIYYILSGLAQTWVEQGTIGRVPGVWWLYAVMLL
FT                   FAISLLSPGFWRKLPLRR"
FT   sig_peptide     445010..445111
FT                   /locus_tag="Nmul_A0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.363 at
FT                   residue 34"
FT   gene            446083..447147
FT                   /locus_tag="Nmul_A0403"
FT   CDS_pept        446083..447147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0403"
FT                   /product="permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73711"
FT                   /db_xref="GOA:Q2YC10"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC10"
FT                   /protein_id="ABB73711.1"
FT                   /translation="MTIIYRYLGLQVLMGLGIATAVLLPLFGFLDLLDQLDDVGKGTYS
FT                   VKDAFLYTALLLPRRFIQLAPFIALMGNVTALGRLAVGSELTALRGAGVSPLGISLAPV
FT                   VVGIILLLFITVLDQFVAPQFQQKAISSRAAALEKSAALGQQLGIWTRDERNILRIGEM
FT                   LHARRAANIEIMHFDDNGFLLRYTYAKYADIINEGLWELRDVVIKTFNGNAMEIVSRES
FT                   VPWEPFLKEEDISTLTKSPESLSPAELFLHVHFLRATGQESGAYELALWRKAGGALTTI
FT                   AMLLLSIPFVFGSVRAGLGNRLVVASMLGISVYLFDQITANAGLLLHLNPALSALLPGG
FT                   VLIAVAYFWLRRIF"
FT   gene            447274..448467
FT                   /locus_tag="Nmul_A0404"
FT   CDS_pept        447274..448467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0404"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73712"
FT                   /db_xref="GOA:Q2YC09"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC09"
FT                   /protein_id="ABB73712.1"
FT                   /translation="MPVYIHIIGDSETDIWGLSGRERLQRMLKAFAGTRLVDNPARIPA
FT                   PASALLLRGDYLFDAIVLDALLKAKTDLMLVSDEDKPVAVRISGENVHQVLAEFAGEGQ
FT                   NLSSLRRYELGELGLPNLRQNLKKRDAPYVLPISRNSRCNLESELFKRSYKGVTDFVTK
FT                   WLWPAPAFHAVHFCIRMGLRPNHITLLSLLFAVLAGVAFWYGFYGSGLVMGWFMTFLDT
FT                   VDGKLARVTVTSSRFGDVLDHGLDIIHPPLWYIAWGVGLSADYSLSSHLPLLFALILIG
FT                   YIGGRLCEGAFQFWVASFDIFIWRPLDSFNRLITARRNPNLVLLTFGWLAGRPDIGLLS
FT                   VVIWHLLSTGFLLVRVAMGWVSRRSCGPLHSWFEEIVGGQDEGKLAVRIFAPLKSRK"
FT   gene            448491..449480
FT                   /locus_tag="Nmul_A0405"
FT   CDS_pept        448491..449480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0405"
FT                   /product="Diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73713"
FT                   /db_xref="GOA:Q2YC08"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC08"
FT                   /protein_id="ABB73713.1"
FT                   /translation="MKSGTGSVGLLFNPLSGRIRKRKEAIRRAAEEIPGACREVTNARE
FT                   ISASVDTFVNDGTDLLIIIGGDGTVQGVLSHLFATQPLAKWPVLTIVPGGTTNMTALDL
FT                   GIRGSPESVLRQLSASFQKDFPSALVERHVLCIEQAGAEKVYGMFFGVGLIARAVIFSQ
FT                   SRIKRLGITGEIYSALITFGYVAGFLLGRRQGAWAPVRMTITEKTLSRPHGTYAFLFAS
FT                   TLDRLLFGMRPYWGGQPEPLHVTFVRQQRQLPLRSVLRLLIGRGNDLKDKDGYHSCNTD
FT                   ELELLIDDDYIVDGESYRATSQGGPLRITPAGPIIFLAAERAAANAKS"
FT   gene            449477..450463
FT                   /locus_tag="Nmul_A0406"
FT   CDS_pept        449477..450463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73714"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC07"
FT                   /protein_id="ABB73714.1"
FT                   /translation="MSILQGAATADPPLPEGLISEMATLSSNTVSADFLVLLEALKLRF
FT                   GSALDAVLLYGSCLRAREIGDGVVDFYAVVSSYSSAYPERYLRYFNTLLPPNVFYLEVS
FT                   QEEKTFRAKYAVVSMADFEQGTRRWFHPYLWARFAQPSRLLFFRDEAARKRISESLAHA
FT                   VVTFLGSTLPTLDCSGTGATTTEMIWTNGLTQTYAAELRPERAGRARQLAQMNLEVYSR
FT                   LTTLAVPALAGKLMPLPDGSYESLIDDAGRRKSLWHWQLRRWQGKVLSVLRLSKAAFTF
FT                   HDSISYAAWKIERHTGIRVEVTPMLRRHPLLWGFKVSWRLLRRGVLR"
FT   gene            complement(450563..451768)
FT                   /locus_tag="Nmul_A0407"
FT   CDS_pept        complement(450563..451768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0407"
FT                   /product="phosphatase kdsC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73715"
FT                   /db_xref="GOA:Q2YC06"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC06"
FT                   /protein_id="ABB73715.1"
FT                   /translation="MRWVAFAPLHGNFGPVSRSSARSMAGRPLFSWSLEQAVISGCFDT
FT                   IYVTADPPVIRKRIVEEFSRADTIIEILDCSGATRTGVENWTSLLHTFQQKIPFDVVCS
FT                   IQAASPLTRAEDFRAAKRKFLSENLDSLLTAAPSRRFLWTRMGEPVGHDPLKSRASCDA
FT                   SNPEGYLLENGAFYLTHEKLLRDNDHYLGGRMGIHEMAPETAIEITGEAGWNIVERLLR
FT                   EQERGSVQARASRIKFLVLDVDGTLTDAGMYYGPAGEALKKFNTRDAHGLQRLREHGLG
FT                   VCVITTETSPSVEARMRKLRIDEYYPGISDKFPLLLKLSKRWGVPLENIGYVGDDLSDL
FT                   ECLSRVGVAFCPADAVPLVVRQAHYMCEYSGGHGAVREVCDLILRSRETIRHDSAEAEA
FT                   YS"
FT   gene            complement(451768..452646)
FT                   /locus_tag="Nmul_A0408"
FT   CDS_pept        complement(451768..452646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0408"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73716"
FT                   /db_xref="GOA:Q2YC05"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC05"
FT                   /protein_id="ABB73716.1"
FT                   /translation="MKTPRVIAEIGCNHKGDIEIAREMIGIAATFAKCDFVKFQKRSNR
FT                   ELLTPEEYNAHHPNPQNSYGDSYGAHREFLEFDVDQHRQLQQWCQEFGIGYSTSVWDLT
FT                   SAKEIARLNPEFIKIPSACNLNFPMLAYLATDYAGDIHISVGMTTPAEQEQVVQWMERH
FT                   GAAGRVVLYACTSGYPVPFDQVCLLEIQSLRDRFGSRVKEVGFSGHHLGIAIDIATVVL
FT                   GASWIERHFTLDRTWKGTDHAASLEPDGLRRLVRDVRNVCKTLKFKEGDMTEIELAQRD
FT                   KLKRVQGVHFN"
FT   gene            complement(452773..454173)
FT                   /locus_tag="Nmul_A0409"
FT   CDS_pept        complement(452773..454173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73717"
FT                   /db_xref="InterPro:IPR030906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC04"
FT                   /protein_id="ABB73717.1"
FT                   /translation="MATSASTLIIPVENQVRELDAKLLLSCVAAERGFPVVIGSRAFIH
FT                   FEVASLPRGVYLAKSMRSLSNSMFRILRMLGHEIVAWEEEALVHPPADTYFTLRLSPIT
FT                   IRKVSHIFAWGQENVDLLQQYPQLPAGMPIHVTGNPRGDILRPEMRAYFAAEVERLRGL
FT                   YGDFILVNTNFTDVNPFIPSIGLFIPPKDGGKKSRRGQAGIGMSNEFAEGLWHHKQAIL
FT                   EDFKQLIPALERAFPDVTIVVRPHPSENFQVYDDIAAQCRRVKVTNEGNVIPWLLASKT
FT                   MVHNGCTTGLEAYALGVPAISYLATFNEYYDYDFQGLPTKLSYQSFNFDELEDTLSRIL
FT                   HGELGVAGGEERRTLIDYYLAAQNGRLACERIVDVLEDSGYGRTQPPASPAGTYIGGWA
FT                   LTNLKTALTSLNMRRPGPNRLSYHDHRFPEISVAQIEQKIARFGRLLNRFGAIRVKQHS
FT                   KHLFRING"
FT   gene            454822..455538
FT                   /locus_tag="Nmul_A0410"
FT   CDS_pept        454822..455538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0410"
FT                   /product="Acylneuraminate cytidylyltransferase"
FT                   /EC_number="2.7.7.43"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73718"
FT                   /db_xref="GOA:Q2YC03"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC03"
FT                   /protein_id="ABB73718.1"
FT                   /translation="MLIYSLIPARGGSKAVPHKNIRPLRGKPLIAHSIEVSLKCPSIRR
FT                   TFVSTDSEAIAGLARNAGAEVPFLRPAEFAQDDTRDLPVFRHFLEWLEQNRVPLPDAIF
FT                   QFRPTSPLRSVSKIEEAVELLEKNPEADSVRGVTEPGQNPYKMWTIGADGFMRALLNVP
FT                   GIPEPFNEPRQSLPKVYWQIGYLDLIRTRTILEKNSLTGTHILPLKIDSRDSIDIDDEF
FT                   SFQLAEFLMERQGSVI"
FT   gene            455535..456521
FT                   /locus_tag="Nmul_A0411"
FT   CDS_pept        455535..456521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0411"
FT                   /product="Oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73719"
FT                   /db_xref="GOA:Q2YC02"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC02"
FT                   /protein_id="ABB73719.1"
FT                   /translation="MKALVVGLGSIGVRHLNNLHALEVRELGVVRSRNFPPPTEIVPKD
FT                   IAVFQDIDLALSRKFDLVVVANPTSLHLETLIKALRAGSHVYVEKPVAHEKRRLSELTR
FT                   YVSLDGPRVLVGCQFRMHPGLRKIEGWIRQGKLGKIHSVQVDLGEYLPGWHPWEDYRQS
FT                   YAARADQGGGVVLTLIHELDYLHWLFGKPKSVFAIGGHRTSLDITAEDTALITFETEQD
FT                   ICVQLRMDYWRKPPVRHMNIVAENAIVDWDYPTRLTTLRQNGQVLDEMVLVPSWDRNEL
FT                   FLSMMKEFIEGIPRGSIPRVTLRDGIEVLKTALAVKKSLQTHRKVAL"
FT   gene            456518..457354
FT                   /locus_tag="Nmul_A0412"
FT   CDS_pept        456518..457354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0412"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73720"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC01"
FT                   /protein_id="ABB73720.1"
FT                   /translation="MNQAYKGTPFDLSGRVVLISGATGLLGTEFALAAASAGANLVLGD
FT                   LDGGRLELLKSEIASAYPDTQSWAQVLDVTRADSCRSIAQSCETRFGRINAVVHSAAID
FT                   PKFEQGSDTSHFSKFTEFPGELWQSSLDVNLTGAFHLAQATCRVMEKTGKGSIVFLGSN
FT                   YGLVGPDQRIYKKAGQEEQTYKPAVYSVCKAGLLGLTKFLAAYYMNTSIRVNMLTPSGV
FT                   WNQHGSEFVDNYSSRTILGRMSEKNEYRGAIIFLVSDASSYMTGANLVIDGGWTAL"
FT   sig_peptide     456518..456619
FT                   /locus_tag="Nmul_A0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.673 at
FT                   residue 34"
FT   gene            complement(457510..458619)
FT                   /locus_tag="Nmul_A0413"
FT   CDS_pept        complement(457510..458619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73721"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YC00"
FT                   /protein_id="ABB73721.1"
FT                   /translation="MSKSLAHSPRPPSSGLLSEMETVPVEIYFGGPHQAPGHLRDVLAA
FT                   HITAVPSGGSIDWVTYYFRDLRLAEALIQARKRGVQVTLSLEGRPRIPHANDAVIKMLS
FT                   GPGGLGDAFRIIAIPGVPSPATKSWKPQLHEKLYCFSHPEPVAFIGSFNPSGNMPEDDP
FT                   ELIREIGDQDRGYNALVGLNDPVLVEGLVNHARQIHRSPPGLFYRFSTHASRIIHGADT
FT                   TIHFWPRVSPHPVVQFLSRVNSGARIRVVASHIRTESAVDVMAGLARRGTTLEIFAEST
FT                   HRRVTPKVERRLASAGIRFRRIRNPERLPMHLKFVLVEDGDHAWSIFGSFNWTKPSFWL
FT                   NHEIAAISSNPLIFQVLAHCWEVLENEKC"
FT   gene            complement(458663..460564)
FT                   /locus_tag="Nmul_A0414"
FT   CDS_pept        complement(458663..460564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0414"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73722"
FT                   /db_xref="GOA:Q2YBZ9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ9"
FT                   /protein_id="ABB73722.1"
FT                   /translation="MPQTYSPSVSVVVPTYEQARFIGRALDSLQAQVLTDWEAVVIDDG
FT                   SRDATAEVVSAYLGDTRIHYYRFPENRGLGRTLNEGIAKAKAPLIAYLPTDDVYYRDHL
FT                   GSLKTCLETQKGAVLACSGVRHHYNREAIGQIPEFPLQLVQCMHRKMPVRWVERAELES
FT                   DDLERLYWSLLRPLGAFAESGTLTCEWVSHPMQRHKIMQEPEGGINTFRSHYRVKEPLR
FT                   FHTTVGHRIDEADHYRKMRERPDTPRADNGLKILLVGELAYNAERVLALEERGHKLYGL
FT                   WMQNPYWYNTVGPMPFGHVEDLPRDNWREAVKQVQPDVIYALLNWQAVPFAHEVLMATH
FT                   GIPFVWHFKEGPFICLEKGTWPQLIDLHRYSNGQIFSSPEMRDWFDTIIPGLSLDKPTH
FT                   VLDGDLPKRDWFDQPRAPLRSESEGDIHTVSPGRPIGLHPHHVAELAHHGIHLHFYGEI
FT                   THGQWLQWIEKTQAIAPDYLHLHPNVDQSHWTAEFSQYDAGWLHLFESSNRGEIRRANW
FT                   DDLNYPARLSTLAAAGLPMLQKANEDALVATRTLAKQLDIGIFFDTVDELAAQLRDCKQ
FT                   LRATRERVWQQRHLFTFDHHVPELVDFFRLVIASTSRKQTRTGTTVESAHPQSRRLA"
FT   gene            complement(460682..462001)
FT                   /locus_tag="Nmul_A0415"
FT   CDS_pept        complement(460682..462001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73723"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ8"
FT                   /protein_id="ABB73723.1"
FT                   /translation="MKALFFLRHYNDIDHITPVISKWLESGHRCDVVLIGNPKFRNDYR
FT                   VEFLGTLEGARVAHIRDLLPSWEFLGWRLQTLLLASRLRRSIMGPLVDALARAYRVDRR
FT                   QSIWRSTAGRLLERSFTAADRGVVVFDWITRDSPVSVEWVEVVVSLARSKGLGTVSLPH
FT                   GDSPHASQLIRHHERSLKPNSLYSAASIFDKLVVPNELCAERFRPFLDDQSIAVLGSPR
FT                   YCDEWLVKLAELSPAPPAIHPGKEPKRVKESTKTKGLKVLIFLRKSNFTTFWEEVEEIV
FT                   GMIAAFPNVELVIKPHTRGGWRQPLTRNTSLRDLPNVSVAPDQIHSVHLMNWAHVIIDL
FT                   ATSVVFEAVKGKKPVLAADYLHAGRSTLAHFMPETELKCRDDVYRKIDGFLSNGCDSFY
FT                   VEEHRQRFINEMLHVGGSDVLPRYVTLLETQAQASRIENR"
FT   gene            462317..463270
FT                   /locus_tag="Nmul_A0416"
FT   CDS_pept        462317..463270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73724"
FT                   /db_xref="InterPro:IPR021266"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ7"
FT                   /protein_id="ABB73724.1"
FT                   /translation="MINKELDAGYQEGNIVQMLTIEPGADLRAPELQRAAIDMLEGGGV
FT                   IYLPKSGFELSCHERELISDTANILSRTPDVEDGRPTIIFDPERGRIKKYHYAQVRGKM
FT                   MRAQVKNTARPQIEAMMSRYSKWTESVITQLFPSYQGALERKRVTYRPFPRNNIQSLHI
FT                   DSSYGYPTQGRGMLRVFSNINPTDRLRIWQLGEPFEPFVRRFLPAAHPSEPSWITSILG
FT                   RLGIIDGPKTRYDRYIATLRSLGMRDKEYQRTAPRKIMEFPAGASWIAITDLVLHGAIS
FT                   GQHSLDQTFYLPVEAMKDSSRSSLRILERLAGKALV"
FT   gene            463465..464769
FT                   /locus_tag="Nmul_A0417"
FT   CDS_pept        463465..464769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73725"
FT                   /db_xref="GOA:Q2YBZ6"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ6"
FT                   /protein_id="ABB73725.1"
FT                   /translation="MSAWSLDRITQALSGAMWTFSSLPEDNSAATFVHRCFRRESWRGA
FT                   GFRERTLMYAALPFAPFVTLVLAIAFTALNGQAIKKRTGKGIIRQIREQFEIALRYAIL
FT                   PPWYYIFELHDGDKRRRASEYINRFEVKTCLYRILRDYNGGLPIPAERSTFCIKDKLCF
FT                   LSRCRRFSIATAPVFLIVSKGEIKAIDWGGSLLPETDLFVKPLQGENGRNAVRWDYLGS
FT                   GQYRRNDGKHATAQEVLEGLCKASWRRSFLVQPRLINHREIADLANGTLATIRVMSCRN
FT                   ERGEFEATNAVFRMAQNETVVVDNFHRGGIAVNVDLHTGKLGRGACGAWGSTGGGWYER
FT                   HDKTGVQILHRELPCWPELLAMVRYAHGSAFSDQVVIGWDVALLDSGPCMVGINKAPDL
FT                   DMIQRISRRPLGNERFGKLLAFNLERTVEAVHQSS"
FT   gene            464976..466271
FT                   /locus_tag="Nmul_A0418"
FT   CDS_pept        464976..466271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0418"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73726"
FT                   /db_xref="GOA:Q2YBZ5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ5"
FT                   /protein_id="ABB73726.1"
FT                   /translation="MNEKVTVPCSPIYEARAWQEVAAKFVLLFFGIALWSKWLSLGTGI
FT                   LLTFIWILDSGPRRLGQIIREPLVLGILLLCAVVAVGLLWADYPEAGRMKWRRYFGFLV
FT                   FIPFLSLLNRHRLPWAIAGLLTGYIIVLLSGVYQWAVSGVQGIPPLNISYLVFSSLLGI
FT                   GVILLLYLATAIGEIKWKCVLGLGSLFLLLIQFGQYGRGPLLATLLAVFLMVFLTYKTE
FT                   RKALLGIIASLTIVVAVLVYGSNSFQARLEQVEVEAKLSQQGKYDTSLGYRLAMWDVGL
FT                   HGILEHPFFGHGTGMPESYFEKTVATYKGGIYRDLPQYVGASHYHNDWIEIGMHTGALG
FT                   ILAYGFFLWSWFQTLRAHRLPVLGAALVFFIFLSGLTDTFALYSKIPTFLVVITAIAIA
FT                   WQKEGNWRKNQEASFSNSLPARSPGPERLENI"
FT   gene            complement(466415..466762)
FT                   /locus_tag="Nmul_A0419"
FT   CDS_pept        complement(466415..466762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0419"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73727"
FT                   /db_xref="GOA:Q2YBG7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG7"
FT                   /protein_id="ABB73727.1"
FT                   /translation="MAMLLSEGQMSDYKGARVLLPSLPKAKTLIADRGYDAAWFRAALR
FT                   AKGMTPCIPTKRNRKIQIKYDKTLYRQRHRIENMFARLKDWRRIAMRYDRCAHTFFSAI
FT                   CIAATVIFYLN"
FT   gene            complement(466804..467172)
FT                   /locus_tag="Nmul_A0420"
FT   CDS_pept        complement(466804..467172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0420"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73728"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG6"
FT                   /protein_id="ABB73728.1"
FT                   /translation="MRDLFYLSETQFNRIKPYFPLSHGVPRVDDLRVISGIIYVIRNGL
FT                   QWKDAPREYGPHKTLYNRFVRWSRLGVFNRIFVELTGKEETPERLMIDATHLKAHRTAA
FT                   SLLKKGMFPAVSVAQRAA"
FT   gene            complement(467209..469119)
FT                   /locus_tag="Nmul_A0421"
FT   CDS_pept        complement(467209..469119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0421"
FT                   /product="Glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73729"
FT                   /db_xref="GOA:Q2YBZ2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ2"
FT                   /protein_id="ABB73729.1"
FT                   /translation="MLELAGVGRRPLFPDHSRFAVPGLLAAFLDGLLFESLMSYGANLA
FT                   LSHIVGFLAAATLHYWFISRPRLLYDLAGYSRWTELGRFLVICVLALSVRGGLLAVLIQ
FT                   AWDIPPAAAILPAIAATAVMLYLGSVFYVIPSGNALPSPEADWRIASFGIIAFVILLRL
FT                   IYIGVAQLIPDEAYYWNYAQHMDLSFYDHPPMVAWLIWLGTSIFGNSEFGVRVGAFLCG
FT                   LITMGYLFALTRNLYDSATGIRAVLLLAILPFFFATGALMTTDAPLVAAWAATLYYLEQ
FT                   ALIAQRERAWLGVGIAFGLGILSKYTLGLVGIAALVFVIIDPVARRWLRHPYPYLAVLL
FT                   ALLLFSPVIIWNMEHGWMSILFQSGRVRGVGDDEFGLFELILHFAVLLTPTGLLAAALV
FT                   LLPGTRQNNSVSICRRRLFIMVFTGVPLAIFLILSIFDTQRFHWTGPLWLMALPAMASM
FT                   MGKMRNFSGNPTIADRVMAAWRPTILACLVCYAIALHYLVLGFPGIPYQGIYKGFPEHY
FT                   FWRQATMGIEQIVEDTRRQTGQEPIVVGMSKWSVASIVTFYNRGKPMEIRSRNIFGDSG
FT                   AMYDLWYPSESPTTRPVILVGMWQDNLECVRDSIEIGKMLANPDPVRQLGSGPINFMIH
FT                   E"
FT   gene            complement(469345..470058)
FT                   /locus_tag="Nmul_A0422"
FT   CDS_pept        complement(469345..470058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0422"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73730"
FT                   /db_xref="GOA:Q2YBZ1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBZ1"
FT                   /protein_id="ABB73730.1"
FT                   /translation="MTQLVLLRHGESVSNRDGCFTGWGDAPLTPRGEREAEQAGNLLKK
FT                   AGHKFDICFTSELSRANDTLRIVLSVMGQDEPVVQRNWRLNERHYGALEGINRWKAIRK
FT                   YGFCPILSSQCRFDAPPPPLDPADIRFPGNQACYATIDPGELPLGESMRQAFARMLPYW
FT                   QQTITPEIQRGKRVLIVAHKHILRGLIMQLDGLSIIQLIKLSVATGRPLIYELDDNLHP
FT                   IRHYYADTGLTGHTG"
FT   gene            complement(470328..470786)
FT                   /locus_tag="Nmul_A0423"
FT   CDS_pept        complement(470328..470786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73731"
FT                   /db_xref="GOA:Q2YBZ0"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBZ0"
FT                   /protein_id="ABB73731.1"
FT                   /translation="MTPTPSGTAILNPTMRKFGAPGTIIHQFQHWIVMLRPIQVTLGSL
FT                   VLAAHEPARSFSQLGQESFTELHKITGQLESALAKAFNYDKLNYLMLMMVDPDVHFHVI
FT                   PRYGEGRYFNGVKFIDSGWPGPPDFNKATKTDADTNRLIKEQLISCWP"
FT   gene            471181..472503
FT                   /locus_tag="Nmul_A0424"
FT   CDS_pept        471181..472503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73732"
FT                   /db_xref="GOA:Q2YBY9"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY9"
FT                   /protein_id="ABB73732.1"
FT                   /translation="MKIVNDLGIDRITRDLSGAMWIFGRLREDDSSTATFIHRCFQREI
FT                   WREIRLRDRIAMCAVLPAVPLVIMGVTAVFTALNGSAIKRRTGKGIIRQIREQIELALH
FT                   CAILSPWYYIFELHDDDKKRHAGEYLNRLETKAGLYRFLRDYNGGLPVPAVRSTPCISD
FT                   KSCFMARCREHGIMTAPVFFKIMGEKVTAVDWNGTGLPETDLFVKPSHGRGGRNATRWI
FT                   YLGSGQYRRNDGEILTGTQLLERLRLESRQKAFLIQPRLLNHEDIADLANGTLATVQVM
FT                   SCRNERGEFEVINAVFRMARKKSVIVDNFHAGGIAANVDIRTGELGRGTGGAWGATADG
FT                   WYERHCETGVQILHRKLPCWPELVDLVQYAHASAFSDQVVIGWDVALLNSGPCIMEANK
FT                   APDLDIIQRVGGGPVGEQRLGKLLAFNLRRTVETKYNRPAP"
FT   gene            complement(472500..473285)
FT                   /locus_tag="Nmul_A0425"
FT   CDS_pept        complement(472500..473285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0425"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73733"
FT                   /db_xref="GOA:Q2YBY8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY8"
FT                   /protein_id="ABB73733.1"
FT                   /translation="MAGSEEKPPVKAIILSAGQGHRLGPLTTSIPKCLLPISGKPIIEW
FT                   QIDALLSTGINLVTVITGFQSCLIETLLQQRYGNDGRIETVFNPFFSITDNLVSCWIAR
FT                   SAMDRDFLLLNGDTLFEEVLLARVLNSDPAPVTLGVDQKPAYDADDMKVQLDENGWVRH
FT                   VSKTLPADRIDAESVGLVLFRERGPLLFRDTLEEALRHQSGLKAWYLSIIENLASRQLV
FT                   KACFVPESSWCEIDFPADLIKAEELFSEKKLSRSVTLQR"
FT   gene            complement(473408..474049)
FT                   /locus_tag="Nmul_A0426"
FT   CDS_pept        complement(473408..474049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0426"
FT                   /product="Haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73734"
FT                   /db_xref="GOA:Q2YBY7"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY7"
FT                   /protein_id="ABB73734.1"
FT                   /translation="MKTAAWQAIIFDFDGVVVESGEIKTQAFANLYQEYGEEVMVEVAK
FT                   YHVLNGGMSRYQKFRYFQEMLLEKPPLTAEEERQLDQRFSELVVEAVIASAPVPGAAEL
FT                   IQREAGRIPLFVASGTPETELNTIVVRRGLESYFTAVRGSPTPKQKLIADILTTHRLLP
FT                   ERVLMIGDALIDYQSAMVNNVAFIGRVRPGDQNPFPAHVDVLPDLSPLLL"
FT   gene            complement(474046..474975)
FT                   /locus_tag="Nmul_A0427"
FT   CDS_pept        complement(474046..474975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0427"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73735"
FT                   /db_xref="GOA:Q2YBY6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY6"
FT                   /protein_id="ABB73735.1"
FT                   /translation="MSSEIAIVYGASGFLGSHVADALSDSGYRVRLFDRSPSRYQRADQ
FT                   EMIIGDIMDLEQVKEAAHGADVVYNFAAIADIDEAQEKPIATATINVLGNMHTLEAARL
FT                   AGARRFVFASTIYVYSESGSFYRASKQAAERFIETYHERYGLEYSILRYGSLYGRRADA
FT                   RNGIYRMLYEALEQHSITYHGSGEAIREYIHVEDAARMSVQVLAPEFANRHLILTGQER
FT                   LHIKDVMTMISEIMPWKVDLRFDEARAGHHYEVTPYAYQPRIGRKLVLNEHVDLGQGLL
FT                   DCLQDIHQSMHHSGENEEIIPLASDNKA"
FT   gene            complement(474984..475931)
FT                   /locus_tag="Nmul_A0428"
FT   CDS_pept        complement(474984..475931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0428"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73736"
FT                   /db_xref="GOA:Q2YBY5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY5"
FT                   /protein_id="ABB73736.1"
FT                   /translation="MNKLAISTSSFDVSHNSALRPLQERGIPIAENSHKRKLTEDEVIA
FT                   LLGEDTVGMIAGVEPLTERVFSCARSLKVVSRCGSGLDSVDLGAAKRHGIKVLNTPEAP
FT                   AQAVAELSLALIMAALRKICQTDKQVRAGQWPRAQGGLLAAQKVGIVGLGRVGSRVARL
FT                   CRAFEAQVVAHDTYVKEMPPGMEGVKLVPFETLIAEADIISLHLTYDADTHHLLNEKTF
FT                   ARMKPGAIVINTARGGLIDEAALADALNSGQLGGAAMDVFEQEPYHGPLLQCDNAILTS
FT                   HIGSLAKESRQRMELEAAENLVRGLIEAGVMEKG"
FT   gene            complement(475928..476689)
FT                   /locus_tag="Nmul_A0429"
FT   CDS_pept        complement(475928..476689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0429"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73737"
FT                   /db_xref="GOA:Q2YBY4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY4"
FT                   /protein_id="ABB73737.1"
FT                   /translation="MQLKAKLARNALTIGSWITLGHPSIADIMGAAGFDWLVLDTEHSV
FT                   LELSEVQMLIQVLDSRACPAIVRLTSNHPDQIKRVMDAGATGVMVPMIKTAADAEAAVN
FT                   AVYYPPRGQRGVGLARAQGYGARFQQYRHWLEENAVIIAMIEHIDAVDAIDSILSVPGI
FT                   DAYIIGPYDLSGSLGRPGELADPEVQAAVERVKDAGRRAGKAGGIHVVEPNPEQLRRNI
FT                   EAGFSFLGYGLDIRILDTVCRSHLQNIREAL"
FT   sig_peptide     complement(476609..476689)
FT                   /locus_tag="Nmul_A0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.754 at
FT                   residue 27"
FT   gene            complement(476740..477507)
FT                   /locus_tag="Nmul_A0430"
FT   CDS_pept        complement(476740..477507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0430"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73738"
FT                   /db_xref="GOA:Q2YBY3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY3"
FT                   /protein_id="ABB73738.1"
FT                   /translation="MKTIAVIPARMGSSRFPGKPIANLLGRTMLEHVYKRVALSKALDA
FT                   TYIATCDDEIRRAAENFGAPVIMTADTHERASDRVAEAVAEMDAELIVMVQGDEPMTHP
FT                   EMIDAAVDPFRHDPDLGCVNLMRSIDNKGDFYDFNTIKVVTDRRGDALFMSRQPIPTVP
FT                   ASALSAGSDFPHTLAFKQVCIIPFRRKTLLEFSTLPSTPLEKLESVDMLRLLEHGYRVK
FT                   MVETRFNTQAVDTQADLERVARLMEKDPLLASY"
FT   gene            477865..479187
FT                   /locus_tag="Nmul_A0431"
FT   CDS_pept        477865..479187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73739"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY2"
FT                   /protein_id="ABB73739.1"
FT                   /translation="MKALFFLRHYNDIDHITPVIYKWTSKGHTCDIILIGNSRFRTDYR
FT                   IGFLKGLKGVRMAYIADVLPPLDFIRWFFQTLILIRSLRRPFLGPIMKKLEEVYDAKRR
FT                   EPVWQRTAECLLTRSFAANEEGVVVFDWIERNSSICVEWVKVVLSTARRMGLGTVSLPH
FT                   GDSPHASQLIRRRELRLEPDTTFANAGIFEKVVVPNELCSVRFRPFMDNQKLAILGSPR
FT                   YCDEWLAKLATLMPPSPLTRTGSNLKVAMFLRKSNFSTFWEEVGEVVRIVAGFPGVELI
FT                   IKPHTRGGWQQSLTKDISLRRLPNVRVAGGNLHSIHLMNWADVIIDLATSVVFEAVKVG
FT                   KPVLAADYLHAGRSALAEYLPEAELRCRDDVYKHMEKFLTQGCDSFYIEEHRQRFLKEM
FT                   IDVGDPDVLSRYVALLEEQVRSKADQSQPEPQGNTKDFAFA"
FT   gene            479234..480280
FT                   /locus_tag="Nmul_A0432"
FT   CDS_pept        479234..480280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0432"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73740"
FT                   /db_xref="GOA:Q2YBY1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY1"
FT                   /protein_id="ABB73740.1"
FT                   /translation="MPAMPPIDVVIPVYNAPALTRRCIDSVVACLSPSIRFIFIQDDAS
FT                   GMETHAMLDQLPRGRIRVHHARENQGFGASVNEAISRSDACYVLVLNSDTVVGEDFLPL
FT                   LYATLVADSRLAVIIPAGNDFAGYDLNRYVRQPGGYVQTHRLRGHAFLIRREVFRDANG
FT                   FDLAFGRGYYEDVDLGRRLNKRGWRVGVHPDAHIQHEGGGSFGRGRSFKKLVRRNRKLF
FT                   FSRHPSAKRNILLLSGDCPLAYFPSSLLEALDEVFCGGGYVYWLSPEAAGMLLCLQMRS
FT                   LLSGVDAAVRLFLCSWREDKRISEIWILPDVPRVRYEALTLWARICGLRILTWERVPTE
FT                   ENCTPRLL"
FT   gene            complement(480398..481468)
FT                   /locus_tag="Nmul_A0433"
FT   CDS_pept        complement(480398..481468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0433"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73741"
FT                   /db_xref="GOA:Q2YBY0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBY0"
FT                   /protein_id="ABB73741.1"
FT                   /translation="MISPSKKRSKKAGLPPGMPVHIGAKKNASPRITLLDYDPEGVREA
FT                   EVAPADLAEKIKHASGVKWVNLQGLGDIHMIEQFGACFNLHPLVLEDIFNTEQRSKVED
FT                   YGDYLYVVLKTFGYETRGKEERIYSEQISLVLGKDFVLSFLEANGVQFESVRDRLRAGK
FT                   GQSARLGADFLMYNLIDSVVDTYFSILERLDEKTEALETELVDRPQPSTLQSIQRLKRE
FT                   GVFLRRALWPLREVISSLQRGDSPLFSRNTLLYLRDVYDHTVHIIESIESLRDVTAGML
FT                   DIYLSSVSFRISTVMKVLTVITTIFMPLTLITGIYGMNFTYMPGLEWHMGFFIVLTAMA
FT                   VISIAMLLLFRWKKWL"
FT   gene            complement(481487..483010)
FT                   /locus_tag="Nmul_A0434"
FT   CDS_pept        complement(481487..483010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0434"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73742"
FT                   /db_xref="GOA:Q2YBX9"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX9"
FT                   /protein_id="ABB73742.1"
FT                   /translation="MPEYSTLAAVDLGSNSFRLQVARVEGRQLYPLDNLREMVRLAAGL
FT                   TRDKRLDEDSQARALACLTRFSERLRGFPPHAVRAVATNTLRVAKNAAVFLKKAEAAMG
FT                   FPIEVISGHEEARLIYLGVAHGLPASPDARLVMDIGGGSTEFIIGRRLKPVKLESLYMG
FT                   CVSYSLRFFPGGRISREAMNRAELSARSEIQAIAKEFSSEHWQLAYGSSGTARALGDII
FT                   QLNQLGSGSGNGEITREGLENFRNHLLKVDDIKKLDLAGIKTDRAPVIAGGFAIMSAAF
FT                   AELGISRMAQGMGALRQGVLYDLLGRFHKHDMREVTVRQFMRRYHVDGAQAGRVESTAL
FT                   LLGEQLLAAFPCEGEEHLQVLSWAARLHEVGISVAHSGYHKHSAYILGNADMPGFSQRE
FT                   QERLSMLVLAHRGDIGKARGNMIERADFALLFALRLAALFHRSRCETALPRLEVSLRGK
FT                   EFSLYLERKWLEGNPLTYNALLGEIEQWDALGFRFGMAGADGSKLSASV"
FT   gene            complement(483047..483754)
FT                   /locus_tag="Nmul_A0435"
FT   CDS_pept        complement(483047..483754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0435"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73743"
FT                   /db_xref="GOA:Q2YBX8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX8"
FT                   /protein_id="ABB73743.1"
FT                   /translation="MGSHEHISKQFDADLEAVRTRVLHMGGFVEEQIEKAIEALITGNE
FT                   SLIENIIADDHRVNAMEVSIDEICNQIIARRQPAAGDLRMIMTVIKTITDLERIGDEAE
FT                   KIARMAKLIYAADRMHMPRFVEIRHVANVALEMLRKSLDAFARLDLTAAAQVVRQDELV
FT                   DEEFRSIMRQLITFMMEDPRKISTALEILFIAKAIERIGDHAKNMSEYVVYMVKGRDVR
FT                   HVTVEEIEREIRE"
FT   gene            complement(483842..484501)
FT                   /locus_tag="Nmul_A0436"
FT   CDS_pept        complement(483842..484501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0436"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73744"
FT                   /db_xref="GOA:Q2YBX7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBX7"
FT                   /protein_id="ABB73744.1"
FT                   /translation="MNQDEQKRAAAHAAIQHIPAGCIVGVGTGSTANYFIDALAGIRSR
FT                   IDGAVASSEATARRLSAHGIEVMDLNNVDELPLYVDGADEITPHLHMIKGGGGALTREK
FT                   IVAAVAKKFICIADQSKLVDVLGKFPLPVEVIPMARGHVAREIVRLGGQPMLRQGFTTD
FT                   NGNVILDVHALQILNPIELETELNQITGIVTNGLFARRPADLLLLGDEGGIRTIAI"
FT   gene            484639..486150
FT                   /locus_tag="Nmul_A0437"
FT   CDS_pept        484639..486150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0437"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73745"
FT                   /db_xref="GOA:Q2YBX6"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX6"
FT                   /protein_id="ABB73745.1"
FT                   /translation="MKNSYLERILTARVYDVAIESPLELAPNLSTRINNQLFLKREDVQ
FT                   DVFSFKVRGAYNKMVKLSPAALERGVVTASAGNHAQGVALAAQRLGCRATIVMPVTTPQ
FT                   IKLQAVEARGATVVSYGDSYDEAYAHAHEFAEKNQVTFVHPYDDPDVIAGQGTIGMEIL
FT                   RQHPGEIHAIFAPIGGGGLISGVAAYVKRLYPEIRIIGVEPVDADSMYQSLKKNRRVRL
FT                   ARVGLFADGVAVKQVGVETFHLCRELVDEILLVDTDAICAAIKDVFEDTRAILEPSGAL
FT                   SIAGAKAYAKREGIRGKNLIAIASGANMNFDRLRHVSERAELGEQREAVMAVTIPEEPG
FT                   SFKKFCAMLGPRSITEFNYRFAGPKEAHVFVGVSVRNREEAAKLIKDLENNGLRTEDLS
FT                   DNEMAKLHIRHLVGGHARDVKNEIVYRFEFPDRPGALMQFLNSMSHHWNISLFHYRNHG
FT                   ADYGRVLVGMEVPPEEKADFKAFLAQLDNRYWDETHNPAYKLFLG"
FT   gene            486326..487654
FT                   /locus_tag="Nmul_A0438"
FT   CDS_pept        486326..487654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0438"
FT                   /product="Protein of unknown function DUF1597"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73746"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX5"
FT                   /protein_id="ABB73746.1"
FT                   /translation="MKCRRKRSSRIPYGVGCFLLIFMSNSIVQAVDIAGWLRENGVRAG
FT                   GWINAGATYNPGNPVNGYNGPVTFADRANRFQLNQFNLYLQRTVVTEGEAFDLGGRVDF
FT                   MFGTDAIYTQAFGVPPFDVNTGQVLNRGHWDLNICCSSTRTYGIALPQAYLEAYIPLGN
FT                   GLNIKAGHFYSPTGYETVPAPDNFFYTHAYTFNNGEPFTHTGAVGNYTVNGNWSVMGGL
FT                   ITGSATGDWDGGFDRELGNWGGLGGITWVSDDKRTSANITGSYSATSTRSNRPWGMYNI
FT                   VLQHRITPKTHLVLHHVHGYAGGVLLGGVPKNVEWYGINTHLYYDLLEDLSVGIRGEWF
FT                   RDRDGFRVSSPFRVVAALNHTGISFAGDSSTVRAAPADYYEITFGMNWKPAKRLRLDWK
FT                   PMQKLNVRPNIRYDRADGIDHSHRPFNNKKDQIIFSLDAMIPF"
FT   sig_peptide     486326..486418
FT                   /locus_tag="Nmul_A0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 31"
FT   gene            488291..489646
FT                   /locus_tag="Nmul_A0439"
FT   CDS_pept        488291..489646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73747"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX4"
FT                   /protein_id="ABB73747.1"
FT                   /translation="MKRLPKRRRGMIFASAVSLFTTLENPDSAYANTALEWFNDNGIRL
FT                   GGWINGGATFNPSQLTGFNGPVTFADRSNRFQLNQFNIYVQRPVVAEGSTWDFGGRIDF
FT                   MFGTDAIFTQAYGVPAFDVNTGQPLNRSNWDLDVCCASTRYYGIAFPQVFAEAYVPVGN
FT                   GLNVKVGHFYTPIGYESVPAPDNFFYTHAYTMQYGEPFTHTGVLGNYKITQNWTFMGGV
FT                   TTGSATGGWDGGFDKQLGNWGGIAGITWTSEDMGTSANISGTYSATSTRSDEPWMLYSI
FT                   VLKHKFTEKTHFVLQHDHGFAGNVLLNNVFYSNVIKDAEWYGINTHLYYDLMPELTIGV
FT                   RAEWFRDRDGFRVFSPGRVAAATDNRGFSYALGRNQLGNSTSSPADYYAVTVGMNWRAA
FT                   KRLKLDWKPLQQLNIRPNVRYDAADGLHGIDYRPFGGHKDQVVLSLDFMVPF"
FT   sig_peptide     488291..488365
FT                   /locus_tag="Nmul_A0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.333 at
FT                   residue 25"
FT   gene            complement(489729..490235)
FT                   /locus_tag="Nmul_A0440"
FT   CDS_pept        complement(489729..490235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0440"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73748"
FT                   /db_xref="GOA:Q2YBX3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX3"
FT                   /protein_id="ABB73748.1"
FT                   /translation="MQEQKPPSHGQITRTGRTSMSLYIVRAASWREDAVALRAVREAVF
FT                   IREQGVPAELEWDEFDDVCVHLLAMNPSGNPIGTARLLPDASIGRMAVLRNWRCKGVGS
FT                   ALLDRLLKEAENRQFPSVTLNAQTHATGFYRKFGFQQAGPEFLDAGIPHVKMMLQFRPL
FT                   TVDTP"
FT   gene            complement(490275..491582)
FT                   /locus_tag="Nmul_A0441"
FT   CDS_pept        complement(490275..491582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0441"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73749"
FT                   /db_xref="GOA:Q2YBX2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBX2"
FT                   /protein_id="ABB73749.1"
FT                   /translation="MSKNVVVIGTQWGDEGKGKIVDWLTDQAQGVVRFQGGHNAGHTLV
FT                   IGGKQTVLHLIPSGILRKDVACYIGNGVVVSPQALLDEVGMLERAGIDVLSRLRISEAC
FT                   PLILPCHVALDNAREIARGLGKIGTTGRGIGPAYEDKVARRAVRLQDLFHRDRFAAKLG
FT                   EILDYHNFVLKNYFQSPVVDFQQTMDETLSLVERIRPMVADVPRLLFEANRAGANLLFE
FT                   GAQGALLDIDHGTYPFVTSSNCIAGAATTGSGIGPQMLHYVLGITKAYTTRVGAGPFPT
FT                   ELDDDVGRHLAKRGNEFGATTGRPRRCGWFDAAALKRSIQINGVSGLCVTKLDVMDGVE
FT                   TLRLGVGYKMMGKGEEEKFSAIMPVGAEELASCEPVYEEMPGWSGSTVGIRNFEQLPMA
FT                   ARNYLKRMEEVCEVSIDMISTGPDREETIVLRHPFE"
FT   gene            complement(491672..492853)
FT                   /locus_tag="Nmul_A0442"
FT   CDS_pept        complement(491672..492853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0442"
FT                   /product="tRNA synthetase, class II (G, H, P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73750"
FT                   /db_xref="GOA:Q2YBX1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBX1"
FT                   /protein_id="ABB73750.1"
FT                   /translation="MNMSAWALPEYIEDILPAEALKIEMMRRRVLDWLFVNGYELVGPP
FT                   LLEYVESLLTGSGGQMNLRVLKVVDQLSGRMMGLRADMTPQVARIDAHLLNRKGITRLC
FT                   YAGSVLHARPSGLTRTREPLQIGAELYGHQGLESDLEIQRLMLQSLAIAGVGNIHLDLG
FT                   HVAVFRGLIRSTGISPDLEMELSGALQGKDKAALKELCAGLKKQVDASVREALQLLPEL
FT                   YGDENVLTLARSALPSYPGIMKALDELEMVASELSPLVDTLAFDLADLRGYHYHSGMVF
FT                   AAYTDNCPNAIAVGGRYDEVGKAFGRARPATGFSMDLRELSGLMSSDSHPRGILAPFIK
FT                   EDKALEKKIEQLRNEGQIVIVALPGHENDAGSFNCDKKLVSENGVWSIADALI"
FT   gene            complement(492908..493093)
FT                   /locus_tag="Nmul_A0443"
FT   CDS_pept        complement(492908..493093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73751"
FT                   /db_xref="GOA:Q2YBX0"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBX0"
FT                   /protein_id="ABB73751.1"
FT                   /translation="MWDTLLMAFALMLVLEGLLPFLMPGAWREAFRKLTEAGDNQIRFI
FT                   GLTSMLVGLLLLYLVK"
FT   gene            complement(493339..494217)
FT                   /locus_tag="Nmul_A0444"
FT   CDS_pept        complement(493339..494217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0444"
FT                   /product="protease FtsH subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73752"
FT                   /db_xref="GOA:Q2YBW9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBW9"
FT                   /protein_id="ABB73752.1"
FT                   /translation="MKNYTPMLLTVLIILFLVASSSLYIVDQRQQAILFQLGEVVDVKT
FT                   SPGLYFKIPLAQNVRYFDSRILTLDTAEPERFITSEKKNVLVDLFVKWRIVDVKQYYVS
FT                   VRGDEMLAQTRLSQTVNSSLRDEFGNRTVHDVVSGERDKIMEIMRQKADADARKIGVEV
FT                   VDVRLKRVDLPQEVSESVYRRMEAERKRVANELRSTGAAESEKIRADADRQREVVLAEA
FT                   YRKAQEIKGEGDAKAASIYASAYESNPEFYSFYRSLDAYTEIFKNKNDIMVLEPTSEFF
FT                   KYMRNSGRGGK"
FT   sig_peptide     complement(494152..494217)
FT                   /locus_tag="Nmul_A0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.433 at
FT                   residue 22"
FT   gene            complement(494218..495417)
FT                   /locus_tag="Nmul_A0445"
FT   CDS_pept        complement(494218..495417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0445"
FT                   /product="protease FtsH subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73753"
FT                   /db_xref="GOA:Q2YBW8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBW8"
FT                   /protein_id="ABB73753.1"
FT                   /translation="MGLNDPQWGRKKGNSGPPDLDQLWRNFNKKLNNLLKRKGGGRRDS
FT                   SGGGEGAPPAGPKKYSGGAGLLAGLLLLLWIGSGFYIVNEGQRGIVLRFGKYVESTQAG
FT                   LRWHLPYPIEVVEPVNVSQVRTVEIGYRNNVRSKVLKESLMLTDDENIIDIQFAVQYIL
FT                   KNPEDFLFTNRDPENAVLQAAETAIREIIGKSKMDFVLYEGREQVAAKATELMQDILDR
FT                   YKIGIAISKVTMQNAQPPEQVQAAFDDAVKAGQDRERQKNEGQAYANDVIPKAKGNAAR
FT                   LLEEAEGYKQRVIASSEGEASRFKQVLVEYSKAPGVTRDRLYLDMMEQVLSNTSKVIVD
FT                   QKNGNNLLYLPLDKLIQMSGPSSSSGTVPETQLASPPEPTADAATRTREAFRGRERETR
FT                   "
FT   gene            complement(495522..496706)
FT                   /locus_tag="Nmul_A0446"
FT   CDS_pept        complement(495522..496706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0446"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73754"
FT                   /db_xref="GOA:Q2YBW7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBW7"
FT                   /protein_id="ABB73754.1"
FT                   /translation="MLDSSSGNAPDTHAAVDSAVLVSLDLNDSDSAENLEELRQLAASD
FT                   RLAISAVVLGKRLRPDPATFAGSGKVDEIMGAVEQTGASLVIFNHDLSPAQQRNLEQRL
FT                   RRRVIDRTSLILDIFAQRAKSHEGKLQVELAQLEHLATRLVRGWTHLERQKGGIGLRGP
FT                   GETQLETDRRLLGKRVKVLKEKLAKFERQRALQRRARRRAQVMSVSLVGYTNAGKSTLF
FT                   NRLTRGHTYVADQLFATLDATTRKLFIADRGPLVLSDTVGFIRDLPHTLVAAFRATLEE
FT                   TVQADLLLHVVDTSSSNRSEQIDEVNKVLKEIGADRIPQILVLNKTDLVDLPASSPGYQ
FT                   RDEYGRIVQVRLSAKTGEGLEFINLALSEALGERAALREPDNQSEAQDITSGYH"
FT   gene            complement(496699..496944)
FT                   /locus_tag="Nmul_A0447"
FT   CDS_pept        complement(496699..496944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0447"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73755"
FT                   /db_xref="GOA:Q2YBW6"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBW6"
FT                   /protein_id="ABB73755.1"
FT                   /translation="MSAKGQLLQDPFLNTLRKEHIPVSIYLVNGIKLQGHIDSFDQYVV
FT                   LLKNTVTQMVYKHAISTVVPARAVNIPFEAPPISDA"
FT   gene            complement(497199..498200)
FT                   /locus_tag="Nmul_A0448"
FT   CDS_pept        complement(497199..498200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0448"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73756"
FT                   /db_xref="GOA:Q2YBW5"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBW5"
FT                   /protein_id="ABB73756.1"
FT                   /translation="MILRALITSLLAVGTIVAPPAQAAAADEPIKPIEAAKPKNENKVE
FT                   LGKMLFFDPRLSKSGFISCNSCHNLSMGGSDNLPSSIGHKWHQGPINSPTVLNSSLSLA
FT                   QFWDGRAKDLKDQAGGPIANPGEMAFSHELAVGVLQSIPQYRARFKQIYSSDKVDIGMA
FT                   TDAIAAFEETLVTPDSRFDKWLKGDKNAINKTELEGYKLFKDAGCTGCHNGPAVGGASF
FT                   QKMGVLEPYKTQSKAEGRFAVTGKEEDRLFFKVPTLRNVELTYPYFHDGAAATLEDAVN
FT                   TMGRIQLGRNFTKDENAKIVAFLKTLTGKQPHLTLPILPPSSKDTPKPHPFD"
FT   sig_peptide     complement(498129..498200)
FT                   /locus_tag="Nmul_A0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 24"
FT   gene            complement(498462..499025)
FT                   /locus_tag="Nmul_A0449"
FT   CDS_pept        complement(498462..499025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0449"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73757"
FT                   /db_xref="GOA:Q2YBW4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBW4"
FT                   /protein_id="ABB73757.1"
FT                   /translation="MIDRNGYRSNVGIILLNSKNEVFWGKRIRQDSWQFPQGGIKPGES
FT                   PEQAMYRELTEEVGLRPWHVQILGRTRDWLRYDVPAQWIKRDWRGNYRGQKQIWYLLRL
FT                   LGSDCDVSLHTSGRPEFDAWRWNQYWVELESVVEFKRQVYRQALTELARLLNRPPVPFG
FT                   YSGYEKYDYSASGPLTGSTAKQSE"
FT   gene            499228..500937
FT                   /locus_tag="Nmul_A0450"
FT   CDS_pept        499228..500937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0450"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73758"
FT                   /db_xref="GOA:Q2YBW3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBW3"
FT                   /protein_id="ABB73758.1"
FT                   /translation="MRASGFFISTLKEAPAEAELISHKLMLRAGIIRRLGSGLYTWMPL
FT                   GLKVLRKVENIVREEMDAAGALELLMPAVQPAELWRETGRWDVFGPQMLKIRDRHERDF
FT                   CFGPTHEEVITDIARREIKSYRQLPLNFYQIQTKFRDEVRPRFGVMRAREFVMKDAYSF
FT                   HTDIPSLEETYQAMHVAYCRIFDRLGLKFRPVKADTGAIGGSSSHEFHVLADSGEDAIA
FT                   FCSDSDYAANVEMAESLPPAGLREAAAGEMQKVRTIAQKTCEEVAAYLNVSIEQTVKTL
FT                   AVMANGGMHLLLLRGDHHLNETKVRKIPFLSDFRLASEEEIRTETGCLPGFIGPAGLSL
FT                   PVIADLTVATMSNFVCGANEEDYHLVNVNFGRDLKEPDHVFDIRNVVSGDLSPDGKGKL
FT                   EICRGIEVGHIFQLLTKYSEAMKANYLDESGQARPMEMGCYGIGVSRIVAAAIEQNHDE
FT                   RGIIFPAAMAPFQVVIIPIGLKKNAEVRAEAEKLYATLSSVGIEVLLDDRDDRPGVMFA
FT                   DMELIGIPHRVVVGERGLKEGNAEYRGRRDEKSEVVPLPEIADFIKSKLAGG"
FT   gene            complement(501061..501603)
FT                   /locus_tag="Nmul_A0451"
FT   CDS_pept        complement(501061..501603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0451"
FT                   /product="Thiol-disulfide isomerase and thioredoxins-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73759"
FT                   /db_xref="GOA:Q2YBW2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBW2"
FT                   /protein_id="ABB73759.1"
FT                   /translation="MKRRQMKRCHLSILLYRFCLWIMLSAVPVAQTYGFTFTDHTGKKL
FT                   SLSDFKGKWVLVNFWATWCPPCLKEIPDLVSLYESRKKDIMVIGVAMDYRNPDVVLKHA
FT                   KRLSVTYPIVLGDQELARQVGPVSMLPTTYVFDPEGKPAVYKIGIVSREALEEFMDENS
FT                   NKIPNSQPAGKAQQKGR"
FT   sig_peptide     complement(501511..501603)
FT                   /locus_tag="Nmul_A0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.439 at
FT                   residue 31"
FT   gene            complement(501630..502910)
FT                   /locus_tag="Nmul_A0452"
FT   CDS_pept        complement(501630..502910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0452"
FT                   /product="tRNA-processing RNAse BN"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73760"
FT                   /db_xref="GOA:Q2YBW1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBW1"
FT                   /protein_id="ABB73760.1"
FT                   /translation="MELFSQSSRPVAKVMKSIRPVDFMHYVLVRFFQHNCTQIAGSLTF
FT                   TTLLSLVPMLAIGLSVIAAFPAFAEFSDRIKEFILTTMVPEAANKVISVYMQQFADNAA
FT                   KLTAIGIAFLGVTALALMLTIDEALNSIWRVSRLRPLLHRLLIYWSVLTIGPLLIGASL
FT                   SLTSWLMTASRGFTRDIPGGDIMLLRLSPLVLTSIAFSASYLIVPNRQVAWRHAIAGGV
FT                   AAAIGFEIMKEGFAFYITRFPTYQAVYGTFATIPIFLLWLYLSWLMVLLGAVIAASLSS
FT                   WRFREWRDDPNARGKQFFDALRLLGILGEALKAGKVETALSLQQQLMLSPEEVERILEL
FT                   MVKANFVRQVQEGGWVQILDPAEIRIADVYRLFAFRPEALRGTAGGDTRLEQLLDDIAV
FT                   GIDEKMSLPLSQLFTSAEPEPPAEMSA"
FT   gene            complement(502976..504508)
FT                   /locus_tag="Nmul_A0453"
FT   CDS_pept        complement(502976..504508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0453"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73761"
FT                   /db_xref="GOA:Q2YBW0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBW0"
FT                   /protein_id="ABB73761.1"
FT                   /translation="MKDHLIIFDTTLRDGEQSPGASMTREEKVRIARQLERMRVDVIEA
FT                   GFPAASNGDFEAVKAVAAAIKGSTICGLARAIEGDIRRAGEALRGANSARIHTFIATSP
FT                   IHMEKKLRMSPDQVVEQAVKAVKFARQYTDDVEFSPEDAGRSDITFLCRVLEAVIDAGA
FT                   GTVNIPDTVGYTMPQQFGELIRTLRERIPNSDKVIFSVHCHNDLGLAVANSLSAVMNGA
FT                   RQVECTVNGLGERAGNASLEEVVMAVRTRQDFFPCDTRIDSVHIVPASKLVSGITGFPV
FT                   QPNKAIVGANAFAHESGIHQDGVLKHRETYEIMRAEDVGWGANKLLLGKHSGRNAFRSR
FT                   LAELGIELESEETLNATFMRFKELADKKHDIFDEDLHALVSDDAAALQEHYKLLSLTAH
FT                   SETGETPHASIVIGEEGRESRAESDGSGPVDATFRAIEKILNSGVELQLYSVNAITSGT
FT                   DSQGEVTVRLQKSGRIVNGNGADTDIVVASAKAYLSALNKLHSKLERAHPQV"
FT   gene            504833..505444
FT                   /locus_tag="Nmul_A0454"
FT   CDS_pept        504833..505444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0454"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73762"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV9"
FT                   /protein_id="ABB73762.1"
FT                   /translation="MGKNFAGSGNFGYDRLAAGLVIALAMGACNPTEQGHIKEVTGHLP
FT                   DLSFSLSSDEGQPVTAKTYEGKVLLMYFGFTHCREECPISMARLTRVMHLLGEDAKRTH
FT                   ILFVTVDPTRDGPRELRRYLAQFNLAQATGLTGTADEIGELAKRCRNAFRPHFPPGGDG
FT                   GLMHGDAVYIFDAQGHARLLATSADPEETLAEDLRDLLPS"
FT   gene            505479..506303
FT                   /locus_tag="Nmul_A0455"
FT   CDS_pept        505479..506303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0455"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73763"
FT                   /db_xref="GOA:Q2YBV8"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV8"
FT                   /protein_id="ABB73763.1"
FT                   /translation="MEWFYWLVPWEESILVVAAAGSAALFFPRGCASVRPSLHRKLCFW
FT                   GGLSLAYLVSHTQLDYYSEHQFFIHRLQHLALHHLGPFLIVLSRPCPVLLAGMPSRMRR
FT                   AFRLMAGWNSIRYPAQALCNPVVAVVLFSMLIGFWLLPSIHFMAMIDWRLYRLMNWSVF
FT                   LSGLVFWGLVLTPGPVFAVKLSPGSRIGMMLAIIPPQIVIGAIIFFTAHELYPIYTICG
FT                   RAIGGINALADQQIGGIILWIHGAMMSAVGILVVILRELMLAEYPEAGQKVA"
FT   gene            complement(506361..507752)
FT                   /locus_tag="Nmul_A0456"
FT   CDS_pept        complement(506361..507752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0456"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73764"
FT                   /db_xref="GOA:Q2YBV7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV7"
FT                   /protein_id="ABB73764.1"
FT                   /translation="MQRLDLKHMKSRRTVSDWIIRMGKETRILLSAVLLAMGAIVTDTQ
FT                   VSIATAAAGHAAEAAGKDESAFDALVTRGAYLATIADCTGCHTAGAAHPAFGGGLAINS
FT                   PFGTIYSTNITPDPETGIGRYSYEDFSRAVRGGIRKDGKWLYPAMPYPSFTAMSDEDAR
FT                   ALYAYFMHGVKPVRHTPSQTRLPFPFNQRWTLKFWDLAFVEHKRFEPRADRGEKWNRGA
FT                   YLVQALGHCGACHTPRGLAYQEKAYSETSSDYLTGALIDNWFAPELTGNTAAGLGRWTE
FT                   EEIAAFLKTGHSGHTAAFGSMVAVIENSTQYLRQEDLDAVAHYLKSLPATGEKSSYNPR
FT                   RTPAVIPAGMSRSEKPGAGIYSGFCAKCHRNEGSGKPPKFPPLSGSSIVLSENASSLIR
FT                   LMLEGGKGPRTKTGPKPEKMPGYAERFTDREIAEVLTFIRNSWGNKAPPVTTRDVYLMR
FT                   EALNE"
FT   sig_peptide     complement(507582..507752)
FT                   /locus_tag="Nmul_A0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.313 at
FT                   residue 57"
FT   gene            complement(507734..508180)
FT                   /locus_tag="Nmul_A0457"
FT   CDS_pept        complement(507734..508180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73765"
FT                   /db_xref="GOA:Q2YBV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV6"
FT                   /protein_id="ABB73765.1"
FT                   /translation="MDARQTVSTEHHFLHSPPRVRTLLALFGAPGAWVTQMALTPPIAA
FT                   YACYPHQFPLPAPLWPGLTAILATIGFACLAAALISGYIALASWRSLARYSEDASNKQL
FT                   PIQKDEGQARFLAMLGMMSSFVFIVAILFNTFAVLSIRSCSAWI"
FT   gene            complement(508188..508793)
FT                   /locus_tag="Nmul_A0458"
FT   CDS_pept        complement(508188..508793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0458"
FT                   /product="putative cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73766"
FT                   /db_xref="GOA:Q2YBV5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV5"
FT                   /protein_id="ABB73766.1"
FT                   /translation="MSGTAPVVTPLPVGSAGKLSGGWWGVIALIVTEASLFGYLLFTYF
FT                   YLAAQTGQDWPPTGLPGLLIPGINTIILLASSAAFWAGERRIRQGGVRSSIFGFIAAIA
FT                   LGSAFVAIQLLEWKNKTFSINSDLYGSLYFTITGFHLCHVIIGLGVLLLLLAWTMMGYF
FT                   DHKRHVAITIGGVYWHFVDVVWLFVFSALYLSPYLQRG"
FT   gene            complement(508790..510805)
FT                   /locus_tag="Nmul_A0459"
FT   CDS_pept        complement(508790..510805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0459"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73767"
FT                   /db_xref="GOA:Q2YBV4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV4"
FT                   /protein_id="ABB73767.1"
FT                   /translation="MAAIDATRHRIDPPLERIPEVGRIPAGSPIEARLEKIWETAPGWR
FT                   GWLSTVDHKTIGVRYLVTAFLFLVIGGIEALFLRIQLAGPDMAFLTPEQYNQLFTMHGV
FT                   TMIFLYALPVLSGFSNYLWPLLLGSRDMAFPRLNALSYWIFLFAGLFMYISFPLGQAPN
FT                   AGWFNYVPFSGPVYNTGPNIDVFALGMVLLGISTTVGSVNFVVTLFRMRAPGMTINRVP
FT                   ILVWGTLTASVANLFAIPAVSLAFFLLWLDRQIGAHFFDVANNGQPLLWQHLFWIFGHP
FT                   WVYVVVLPAMGIVSDALPTFCRRPLVGYTAVALATMATMLLGFGVWVHHMFATGLPTVA
FT                   LSIFGAASMVISIPSAVAVFAWIATIWLGKPVFKTPFLFFAGFVALFIIGGMSGVMTAA
FT                   VPLDWQLNETYFIVAHLHYVLLGINVFPVVGAIYYWFPKFTGRMMSEKLGKWSFWTMFI
FT                   GFNAGFFPMHIAGLLGMPRRIYTYPSRMGWDEVNLITTVGSFIFAVGVLIFLVNVVLSL
FT                   KRGTRAGANPWDAPTLEWAVSSPPPAYNFATIPTIASRHPLWEGRIEGEKEHTRTRLEE
FT                   GYLLMRGRETLGTSPIDAKPVVILKMPEDSYTPFLVGLFVSLLFVGLLLHSWTFTALMA
FT                   ALSCAALSVWMWPRRNLGQRTARHDPASARRGGKGP"
FT   gene            complement(510815..511876)
FT                   /locus_tag="Nmul_A0460"
FT   CDS_pept        complement(510815..511876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0460"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73768"
FT                   /db_xref="GOA:Q2YBV3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV3"
FT                   /protein_id="ABB73768.1"
FT                   /translation="MKASKSGFDSRPAIKNLRFRITLLAPSMVAARPSEAADTLSTPLN
FT                   YFLHSYGPAATPVMHLGWLMTALLSAITLIVILLLVIAIVRKRSSADSGMIGAESGGLK
FT                   WVYIGTGISTFILAGLTVHFLTVLNAVAKPTETPVLTLTVTGYDWWWNIEYEHGDPAKR
FT                   FVTANEIHIPVGRPVLLKLKSADVIHAFWVPVLAGKTQMIPGLVNQKWIQADVPGIYAG
FT                   QCAQFCGAAHAHMNLEVIAESDRDFEKWQEAQRRTAFPVSEHNEHGYKLFMDRCGGCHA
FT                   VRGTEAEGLHGPDLTHLNSRGRIAAGLLTNTPDHLMEWITRAQYFKPGARMPSIALSDS
FT                   EASALASYLSTLD"
FT   sig_peptide     complement(511766..511876)
FT                   /locus_tag="Nmul_A0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 37"
FT   gene            complement(512247..513188)
FT                   /locus_tag="Nmul_A0461"
FT   CDS_pept        complement(512247..513188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0461"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73769"
FT                   /db_xref="GOA:Q2YBV2"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV2"
FT                   /protein_id="ABB73769.1"
FT                   /translation="MNETSRSLRVAVLAAVLFLLGFNTAYASTLASNLELMEAQSPIDI
FT                   RSNSTYYGNLPKLNFNLNSDTALTVINNGSPDHESTIRANVSPGGGTLMLSGHQWNLAQ
FT                   FHFHTPSEHLINGRASPMEMHLVFSDAANNLLVVGRDIEQGLFKNQALAPIFSDLPKTT
FT                   EETLNIEHFNLNNLLPDYLGSFRYSGSLTTPPFTEGVSWVELASPLYLSGSQINAFKSL
FT                   FPEGNSREIQDLNGRIVLTDVPGFVSIHDDSDPNLLGTLIPGLEASVSVTADLSKLATS
FT                   VPEPSSYGMLLAGLAVISFIGLKRGSRLAGAT"
FT   sig_peptide     complement(513105..513188)
FT                   /locus_tag="Nmul_A0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            complement(513627..515219)
FT                   /locus_tag="Nmul_A0462"
FT   CDS_pept        complement(513627..515219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV1"
FT                   /protein_id="ABB73770.1"
FT                   /translation="MKYKPSLVLLSGCLLAAPLYAEEKPASSEPDTAASYVIDLYVDTK
FT                   TKQIYAEPGEGRVRMGSFEKVPEKPAKPVATSSQDGVVADGKAKGEGGVLVRDVPKSVE
FT                   KSQEKSQGGYGYANWKEKDPFKFNLNPDGSQYIKFGFLNQVWARYEQTNPGSTVLGESV
FT                   DDVTDISLRRTRFVLQGQLTDRVYFYTQYGMNNFNFLSQNADNRKLQSFFHDAFGELRL
FT                   TQGHQMIVGGGLVMANGLSRFSSPSVSTIMTMDVPLVAQATADRTDQFNRKLSVYLRGQ
FT                   IGPLNYRFTASDPFPINTAGLPPEIISPVNAQFARTGHRKQYQGFFMWNFWDKEPMTNP
FT                   YMQGTYLGKKSILNLEGGFITQKNATWTGLTEAAAQFHDMNLWSVAAYLDAPVDKVKET
FT                   AISAYIGYFNTDYGPNYLRMNGNGVNPASTGGNAFPMFGTGNQWYGQIGYLLPKDLLGG
FT                   NNGQLMPYFSFISADFDRLHDQMNVFNGGINWLIKGHNSKLTFDIQNRPIFNSAGYKIS
FT                   NRNQFVLQYQIAF"
FT   sig_peptide     complement(515154..515219)
FT                   /locus_tag="Nmul_A0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(515725..516159)
FT                   /locus_tag="Nmul_A0463"
FT   CDS_pept        complement(515725..516159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73771"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBV0"
FT                   /protein_id="ABB73771.1"
FT                   /translation="MAPAPTKEGLSLMSIFRSILFGGLLFFSAAVLSPPIAADMPGDER
FT                   PSPSAFQTLIASHQNAVQVDCQEATSGNAVSPNGKAAAGHENAPEEGQAAEKSTAPCPQ
FT                   DIEPRKDLLHRILRFFVAPAPSPPNPDVDTNISAGGAGGG"
FT   sig_peptide     complement(516046..516159)
FT                   /locus_tag="Nmul_A0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.505 at
FT                   residue 38"
FT   gene            complement(516178..516663)
FT                   /locus_tag="Nmul_A0464"
FT   CDS_pept        complement(516178..516663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73772"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU9"
FT                   /protein_id="ABB73772.1"
FT                   /translation="MKRPRILTMRKMQTALFAGIMISGAAGMSHAQSDLPDRANRWVQD
FT                   IFVDTNQRNQSLEKDALGWELPPGTHEEKGNRTEKGESDKAAVPQQTDQATDRANAPGG
FT                   WEAPAQGSESGSGSCKYASPEQEDFLCKMVRILYGPDTPRGPNREMDENISVGGAGG"
FT   sig_peptide     complement(516568..516663)
FT                   /locus_tag="Nmul_A0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 32"
FT   gene            complement(516887..517753)
FT                   /locus_tag="Nmul_A0465"
FT   CDS_pept        complement(516887..517753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0465"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73773"
FT                   /db_xref="GOA:Q2YBU8"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU8"
FT                   /protein_id="ABB73773.1"
FT                   /translation="MNMSLLRLSRQTALFSALLVFGMSTSHAEVTPSAQAAMKSQSPID
FT                   FRSDSTYFGRLPALNFNLSSDTSLDVINNGSPDPEKTAVRGNVNPGAGSLTLSGHDWEL
FT                   AQFHFHTPSEHLLNGVAFPMEMHLVFSDSNKDLLVVGRWVQAGAFNSDLDPIFSQIPQN
FT                   TSETLHIDHFNLNTLIPSNLESFRYSGSLTTPPFSEGVNWVMLSQPLFMSSEQINAFSS
FT                   LFPEGDARGIQDLNGRIVLTDVPGFVTAVPEPETYAMMLAGLCLMAFVARGKSRPLTSD
FT                   VPAGSVA"
FT   sig_peptide     complement(517667..517753)
FT                   /locus_tag="Nmul_A0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(518270..519664)
FT                   /locus_tag="Nmul_A0466"
FT   CDS_pept        complement(518270..519664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0466"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73774"
FT                   /db_xref="GOA:Q2YBU7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU7"
FT                   /protein_id="ABB73774.1"
FT                   /translation="MRKTNDYTKPSDALVLFGITGDLAYKKIFPALYAMIKKGMLDVPL
FT                   VGVASTPWSLDQLKERATQSISDSGKIDDKRALDHLLSLLRYVRGDYNNLDTFKALKQA
FT                   LGDARHPVHYLAIPPLLFENVIRGLGALDLAAGARVIVEKPFGRDLESARELNRIARSV
FT                   FPEEAIFRIDHFLGKEAIMNILYFRFANSFLEPIWNRNYVASVQITLAEEFGVEERGAF
FT                   YESAGCLRDVIQNHLFQIVALLAMEPPAYRGLGTVQSEKINIFHAMRPLVPEDLVRGQY
FT                   VGYRQEPGVAEDSDVETFCALRLFIDSWRWEGVPWYLRSGKCLAKTAAEVLVQLKPPPQ
FT                   KLFADSASAACDANYLRFRLSPVSAVAIAARVKHPGKEFKGDQQELCLVEEHFGRESPY
FT                   ERLLHDAMIGDDTLFTKREAVEASWTALDPVLKTYPHVLPYERGSWGPAAADALIEADG
FT                   CWHNPG"
FT   gene            complement(519869..521530)
FT                   /locus_tag="Nmul_A0467"
FT   CDS_pept        complement(519869..521530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0467"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73775"
FT                   /db_xref="GOA:Q2YBU6"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU6"
FT                   /protein_id="ABB73775.1"
FT                   /translation="MKINPNAGNPAQPEMLVNVPRLVTAYYTRIPDSNLPGERVVFGTS
FT                   GHRGSSLEGSFNEWHILAITQAICQYRKQHDIDGPLFLGIDTHALSEPAYASALEVLAA
FT                   NDVEVMLAANDEYTPTPAVSHAILTYNEGRTHGLADGIVITPSHNPPESGGFKYNPPHG
FT                   GPAGVEVTSWIESRSNTFLERNLSDVKRMSFEKALHADTTHRHDFLNSYVADLQNVVDT
FT                   KVISDSKIHMGVDPLGGAGVHYWSAIAERYKLNMTVVNNQVDPTFRFMTLDWDGKIRMD
FT                   PSSRYAMRGMLNMKDRFDIAFACDTDHDRHGIVTRSSGLLPADHYLSVAVHYLFQSRHE
FT                   WASNTAVGKTVVSSQMIDRVTAALDRRLYEVPVGFKWFVEGLGNRSLGFCGEESAGASF
FT                   LRINGKTWTTDKDGIAAALLSGEILARTERDPGEIYSGFEREYGRSEFQRIDAPATPEQ
FT                   KKTLSKLSPDQIRHTEIAGEAIRTILTRASGNNASIGGIKVIADNGWFAARPSGTEDIY
FT                   KIYAESFLGKDHLRCIVAEAQTIVEDAFAGPRTGGP"
FT   gene            complement(521612..523735)
FT                   /locus_tag="Nmul_A0468"
FT   CDS_pept        complement(521612..523735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0468"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73776"
FT                   /db_xref="GOA:Q2YBU5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU5"
FT                   /protein_id="ABB73776.1"
FT                   /translation="MSEQTDLDQTCINTLRSLSIDQVEKAHSGHPGTPMGAAPTAFCLW
FT                   QRFLRYDPDNPDWPNRDRFVLSAGHASALLYSLLHLTGIKGTSPSYEGEDRLAVTMEDL
FT                   KTFRQAGSRCTGHPEYGWTSGVETTTGPLGQGVGDSVGMAIAGQWLAATYNRPGFELFN
FT                   HNVYALCSDGDMMEGVSSEAASLAGHLKLGNLCWIYDDNRITIEGSTDLTFTEDVAARF
FT                   SAYGWSVAHVDDANGLSLLTEAYETFLHTDNRPTLIIVHSHIGYGAPHKHDSREAHGEP
FT                   LGPEESRLAKEFYGCDPDKQFYVPDGVREYFQTGFGERGRAAHAGWRVQYDAYRKQYPD
FT                   LAEQIDRMQQRGLPAGWDSELPIFPADEKGMATRESSGKVLNAIAGKIAWLLGGAADLA
FT                   PSTKTELKGDFYGQFQPPDQYENAKGNYRGRNFHFGLREHAMCAIANGMSLSKLRPYAA
FT                   SFLVFSDYGRAALRLSAMMEIPIIYIWTHDSISLGEDGPTHQPIAHLASLRAIPGLIVL
FT                   RPADANEVVEAWRLIMQLTDRPVCLILTRQAVPTLDRTRYAAANGLARGAYVLADAEDG
FT                   RPAVLLLATGSEVALCVAAHEQLKKEGISSRVVSMPSWEVFEHQGQEYRDEILPPGILA
FT                   RVAVEEASSFGWERYTGAGGCIIAMHCFGLSAPAKVVARRFGFEPGHIAAAAKEQIARH
FT                   NTKSTKSESEKAR"
FT   gene            complement(523946..525586)
FT                   /locus_tag="Nmul_A0469"
FT   CDS_pept        complement(523946..525586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0469"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73777"
FT                   /db_xref="GOA:Q2YBU4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBU4"
FT                   /protein_id="ABB73777.1"
FT                   /translation="MTKPMITPLTQRPAWKALEAHYQTIKGMHLRQLFADDPKRGERFT
FT                   AEAVGLYLDYSKNRITDETLHLLVQLAEECGLRERIEAMFRGDAINVTEQRAVLHIALR
FT                   APRNEKILVDGNDVVPGVHAVLDRMADFSDKIRSGDWQGHTGKRIRNIINIGIGGSDLG
FT                   PVMAYEALRHYSLHNLSFRFISNVDGTDFVEATRGLDPEETLFIICSKTFTTTETLANA
FT                   HTARRWMLRQIKDLEGVRKHFVAVSTNAEEVARFGIDTANMFEFWDWVGGRYSMDSAIG
FT                   LSTMIAVGPENFREMLAGFHAMDQHFYSAPFDRNLPVLMGLLSLWYNNFFGAQTLAVLP
FT                   YEQYLKRFPAYLQQLTMESNGKHITLNGSQVDYQTSPIVWGEPGTNGQHSFYQLIHQGT
FT                   RLIPCDFIGFCQTLNPLGDHHDLLMANLFAQTEALAFGKTEDEVKAEGVPDWLCPHRSF
FT                   EGNRPTNTILAERLTPHTLGALVALYEQSVFTQGTIWQIDSFDQWGVELGKVLAHRIGQ
FT                   ELEDENGKSLKHDSSTNALIQRYNRLKQK"
FT   gene            complement(525583..526359)
FT                   /locus_tag="Nmul_A0470"
FT   CDS_pept        complement(525583..526359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0470"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73778"
FT                   /db_xref="GOA:Q2YBU3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU3"
FT                   /protein_id="ABB73778.1"
FT                   /translation="MQESQSRPVFEAKLRRRGIYLLPNLFTTGALFAGFYAIVQAMNGR
FT                   FEHSAVAIFIAMVLDGLDGRVARLTHTQSEFGAEYDSLSDMVSFGAAPALVIYEWALKG
FT                   MGKWGWIAAFIYCVCAALRLARFNTNIGVVDKRYFQGLPSPAAAALIAGLIWLMLDFDI
FT                   AGTDVRWLAWCITLFAGLTMVSDIPYYSGKEINLHKSVPFITALLLALFFFALIPSHPP
FT                   VVLFSLFFLYALSGYAMWTWRRLAKRKRKMVEGQQA"
FT   gene            526809..527534
FT                   /locus_tag="Nmul_A0471"
FT   CDS_pept        526809..527534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73779"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU2"
FT                   /protein_id="ABB73779.1"
FT                   /translation="MNPKLLRRLSSLAIIATSLAFTVPAAAYTFRDDPSSTWGGDSLTA
FT                   AHTNGNVYTVENLLVQNTTANSLPELNFTIPFAWQKVGETYLPMEWRNDLNGWYTSNFN
FT                   DTGTSLTVKLTSPVADTVAMGELADLSGSRQLPLTEPCFSGSPSCQSGVGRPPETGNTT
FT                   DLIPVFSLGSFAPNEAKRFDVSFTYTFGDNRAGTDGATTSFFGYTVSPIPEPGTYAMFL
FT                   VGLGMVVFMARPRKAGMGS"
FT   sig_peptide     526809..526892
FT                   /locus_tag="Nmul_A0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(527769..528785)
FT                   /locus_tag="Nmul_A0472"
FT   CDS_pept        complement(527769..528785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0472"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73780"
FT                   /db_xref="GOA:Q2YBU1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBU1"
FT                   /protein_id="ABB73780.1"
FT                   /translation="MNVYYDKDADLSLIRDKKVTIVGYGSQGHAHANNLSDSGVAVTVG
FT                   LRKEGASWGKAEKAGLTVKEVAESVKDADVVMVLLPDEQIADVYATEIEPNLKKGATLA
FT                   FAHGFNIHYGQVAPREDLDVIMIAPKGPGHLVRSTYLQGGGVPSLIAVHQDKSGRARDL
FT                   ALSYAAANGGTRGGVIETNFREETETDLFGEQVVLCGGLTALIQAGFETLVEAGYAPEM
FT                   AYFECLHEVKLIVDLIYEGGIANMRYSISNNAEYGDISRGPRVITDATRAEMRKILRQI
FT                   QTGEYAREFILENRAGAPMLKASRRLASEHQIEQVGAKLRDMMPWIKKNKLVDQAKN"
FT   gene            complement(528876..529367)
FT                   /locus_tag="Nmul_A0473"
FT   CDS_pept        complement(528876..529367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0473"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73781"
FT                   /db_xref="GOA:Q2YBU0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBU0"
FT                   /protein_id="ABB73781.1"
FT                   /translation="MRHIISLLMENEAGALSRVAGLFSSRGYNIESLTVAATEDSTLSR
FT                   MTLVTTGSDDVIEQITKQLNKLIEVVKVVDLSEGNHIERELMLIKVRAVDQDREEIKRM
FT                   ADIFRGRIIDVTDKSYTIELTGTGSKLDAFIQAMNHTTILETVRTGASGIGRGERILKV
FT                   "
FT   gene            complement(529376..531133)
FT                   /locus_tag="Nmul_A0474"
FT   CDS_pept        complement(529376..531133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0474"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73782"
FT                   /db_xref="GOA:Q2YBT9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT9"
FT                   /protein_id="ABB73782.1"
FT                   /translation="MFNPTYIADIQHLETQESMSADLTGAEITVRCLQEEGVEHIFGYP
FT                   GGAVLFLYDELFKQDKVRHILVRHEQAAVHAADGYARSSNKVGVALVTSGPGVTNAVTG
FT                   IATAYMDSIPLVIISGQVPTHAIGLDAFQEVDTVGITRPCVKHNFLVKDIAELAVTIKK
FT                   AFYIASTGRPGPVLVDIPKDVSQQKTKFVYPERVTMRSYNPNIRGHAGQIKKAVQLILE
FT                   ARRPMIYTGGGVILSDAATRLTELVRLLRFPCTNTLMGLGGYPATDPQFVGMLGMHGTY
FT                   EANMAMQHCDVLVAVGARFDDRVIGNPKHFYNPDRKIIHIDIDPSSISKRVKVDVPIVG
FT                   NVPDVLDELIKLLELRKEKPDQTALDAWWSQIDSWRERDCLRYDRTSAIIKPQRVVETL
FT                   YKVTNGDAFITSDVGQHQMWAAQFYKFDLPRRWINSGGLGTMGFGLPSAMGVQMANPGA
FT                   NVACITGEASIQMCIQELSTCKQYHLPLKIINLNNRYMGMVRQWQEFFHGNRYAESYMD
FT                   ALPDFVKLAESYGHVGMRIEQPGDVEAALQEAFKLKDRLVFMDFVTDQTENVFPMVPGG
FT                   KGLSEMILV"
FT   gene            complement(531400..531849)
FT                   /locus_tag="Nmul_A0475"
FT   CDS_pept        complement(531400..531849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0475"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73783"
FT                   /db_xref="GOA:Q2YBT8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT8"
FT                   /protein_id="ABB73783.1"
FT                   /translation="MSNPSNLKTMGLKATLPRLRILSLFESSPVRHLSAEDVYRTLISE
FT                   GDDIGLATVYRVLTQFEQAGLLERHHFEGGKAVFELASDAHHDHLVCLQCGRVEEFYDA
FT                   EIEKRQIKIARERGFAIHEHSLSLYADCIKPSCPYRKGDEKDSKS"
FT   gene            531923..532624
FT                   /locus_tag="Nmul_A0476"
FT   CDS_pept        531923..532624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0476"
FT                   /product="SmpA/OmlA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73784"
FT                   /db_xref="GOA:Q2YBT7"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT7"
FT                   /protein_id="ABB73784.1"
FT                   /translation="MRARIITLAVLLLAGCSSVPSLLYKIEIQQGNVITQEMVNKLKPG
FT                   MTRSQVRFALGSPMISDAFHENRWDYLYRFEQRGKLIEQRKLTIFFEDDHLVRIDGSFT
FT                   APVAFLQSQPQVSEAGAAPESTVSSEAVMEKGVTPVPVQVPAGVPFSGPLSAPPSAPLS
FT                   AGTETMDTVPILPALPASPPPSPEASLSAGSGEVSSSAVPESPLPEKPAPRQVPSQATD
FT                   TGIMDADQPKE"
FT   sig_peptide     531923..531994
FT                   /locus_tag="Nmul_A0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.669 at
FT                   residue 24"
FT   gene            532666..533475
FT                   /locus_tag="Nmul_A0477"
FT   CDS_pept        532666..533475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0477"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73785"
FT                   /db_xref="GOA:Q2YBT6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBT6"
FT                   /protein_id="ABB73785.1"
FT                   /translation="MSTLNIAVAGSSGRMGRALLEAVERAPDMRLSAALERSGSPYLGK
FT                   DAGELIGSPCGIGITDNVDTALDGSQVLVDFTRPDGTLVHVDRCREKNIKMVIGTTGFS
FT                   PRQKEALWIASRDIAIVLAPNMSVGVNVTLKLLETAARVLNEDYDIEIIEAHHRHKVDA
FT                   PSGTALLMGEVVAKALGKELSEVAVYSREGHTGEREAGSIGFATVRGGDIVGDHTVMFA
FT                   GTGERIEISHKASSRATFAEGALRAARFLADKRNGMFDMQDVLGLRQ"
FT   gene            533840..534991
FT                   /locus_tag="Nmul_A0478"
FT   CDS_pept        533840..534991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0478"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73786"
FT                   /db_xref="GOA:Q2YBT5"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT5"
FT                   /protein_id="ABB73786.1"
FT                   /translation="MPQHSYAVLALADGTVFRGMSIGAEGISTGEVVFNTSMTGYQEIL
FT                   TDPSYCRQIVTLTYPHIGNTGTNPDDVESGNIDRVYAAGLVIRDLPLASSNWRETQTLP
FT                   EYLRQQGVVAIADIDTRKLTRILREKGAQAGCIIAGQPDETEALKLAREFPGLAGMDLA
FT                   KVVSCLQPYEWNEGEWRLGQGYPVQSHPRFHVAAMDFGIKRNILRKLAQRGCQITVFPA
FT                   QTTADEILASQPDGIFLSNGPGDPEPCDYAIETTRRLLEKEIPVFGVCMGHQLLGLATG
FT                   ARTIKMKFGHHGANHPVQDLGTGKVIITSQNHGFAVDTATLPANARVTHLSLFDGSLQG
FT                   FELAGKPVFCFQGHPEASPGPHDLDYLFDKFAGLMERKRTKAI"
FT   gene            535037..538264
FT                   /locus_tag="Nmul_A0479"
FT   CDS_pept        535037..538264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0479"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73787"
FT                   /db_xref="GOA:Q2YBT4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT4"
FT                   /protein_id="ABB73787.1"
FT                   /translation="MPKRNDIKSILIIGAGPIIIGQACEFDYSGAQACKALREEGYRTI
FT                   LVNSNPATIMTDPETADVTYIEPIIWPMVEKIIAIERPDALLPTMGGQTALNCALDLAK
FT                   NGVLDKYGVELIGASREAIDKAEDREKFKQAMTRIGLGSARSAIAHSLEEALQVQAMVG
FT                   YPAIIRPSFTLGGSGGGIAYNREEFLEICERGLEASPTKELLIEESVIGWKEFEMEVIR
FT                   DRNDNCIIVCAIENVDPMGVHTGDSITVAPAQTLTDKEYQIMRDASIAVLREIGVETGG
FT                   SNVQFAINPEDGRMLVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELRNDIS
FT                   GGAMPASFEPSIDYVVTKIPRFAFEKFPQANARLTTQMKSVGEVMAIGRTFQESLQKAL
FT                   RGLEIGVDGLDEKTTDIETVAAELAYPGPERIWYVADAFRCGMAFDEIHAHTHIDPWFL
FT                   TQIEDLIRQERSITGTPLEALDFSTFRKLKRSGFSDRRLARLMSVTPEAVRSRRHQLDL
FT                   RPVYKRVDTCAAEFATYTAYMYSTYEEECEALPSDNKKIMVLGGGPNRIGQGIEFDYCC
FT                   VHAALALREDGFETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIVAVEKPAGVIVQ
FT                   FGGQTPLKLARDLEANGVPIIGTSPDMIDCAEDRERFQKMLHQLGLKQPPNRTARTAEE
FT                   AFAAAEEIGYPLVVRPSYVLGGRAMEIVHEQTHLERYMKEAVKVSHDSPVLLDHFLNDA
FT                   VEVDVDAVSDGENVLIGGIMEHIEQAGVHSGDSACSLPPYSLSARLQDELRRQTAAMAR
FT                   ALNVVGLMNVQFAIQNDIVYVLEVNPRASRTVPFVSKATGIPLAKISARCMTGVSLVHQ
FT                   DRVREVIPDYYSVKEAVFPFIKFPGVDTILGPEMKSTGEVMGVGQTFAEAFVKSQLAAG
FT                   VKLPRSGKVFISVRQADKPRVVEIARNLAQLGFTLYATRGTAAVLSAAGLSVTPVNKMS
FT                   EGRPHIVDMIKNGEMDLIINTVEDKRSVHDSYSIRHAVLQARVTYYTTLAGARAACVGM
FT                   ANMQELHAYGLQQLHESREAASLNPAS"
FT   gene            538372..538848
FT                   /locus_tag="Nmul_A0480"
FT   CDS_pept        538372..538848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0480"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73788"
FT                   /db_xref="GOA:Q2YBT3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT3"
FT                   /protein_id="ABB73788.1"
FT                   /translation="MSTIPLTVTGAGKLRAELHEMKTVQRPAVIAAIAEARSHGDLSEN
FT                   AEYEAAKERQGFIEGRIAELESKLSNAQIIDPATLDADGACVFGATIDLEDVESATTVT
FT                   YQIVGDDEADIKEGKISISSPISRALIGKYPGDVAEVMAPGGVREYEILDVRYI"
FT   gene            complement(539058..539345)
FT                   /locus_tag="Nmul_A0481"
FT   CDS_pept        complement(539058..539345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0481"
FT                   /product="Protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73789"
FT                   /db_xref="GOA:Q2YBT2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT2"
FT                   /protein_id="ABB73789.1"
FT                   /translation="MLALTPDFRRGLKARAHALKPVVWIGAAGLSDNVVNELDQRLKSH
FT                   ELIKIKVASADWEIRNALLEKICGRLNAAPVQHIGKMLVIYRPEPEKTNS"
FT   gene            539375..539995
FT                   /locus_tag="Nmul_A0482"
FT   CDS_pept        539375..539995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0482"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73790"
FT                   /db_xref="GOA:Q2YBT1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBT1"
FT                   /protein_id="ABB73790.1"
FT                   /translation="MKRTKTSKAWMKEHVNDFFVRQAKKEGYRSRAAYKLMEIAERDHL
FT                   FKPGMTVVDLGAAPGGWSQVAAEKLKGKGRAVALDILEMAPISGVTFIQGDFREASVLA
FT                   ELKEQLKDLPVDLVICDMSPNITGIRVIDQTRGMHLAELALEFCTEQLNSGGNFLVKVF
FT                   QGSGFDEFFRAMRATFHRVVTRKPLASRGRSSEIYLLGLGKRD"
FT   gene            540160..542055
FT                   /locus_tag="Nmul_A0483"
FT   CDS_pept        540160..542055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0483"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73791"
FT                   /db_xref="GOA:Q2YBT0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBT0"
FT                   /protein_id="ABB73791.1"
FT                   /translation="MNNLIKNMAIWLVIALVLMTVFNQFSTRQSGQAPMEYSQFIDEVK
FT                   QGRIAKVTIEGRTLKGTKTDGRRFTTYTPSDPWMVSDLLKAGVIIDAKPEEEPSLLMNI
FT                   FVSWFPMLLLIGVWIFFMRQMQGGGRGGGAFSFGKSKARMLDESTNQVTFADVAGCEEA
FT                   KEEVSELVEFLRDPSKFQKLGGRIPRGVLMVGNPGTGKTLLARAIAGEAKVPFFSISGS
FT                   DFVEMFVGVGAARVRDMFEQAKKHAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQL
FT                   LVEMDGFEGTAGVIVIAATNRPDVLDPALLRPGRFDRQVTVPLPDIRGREQILHVHMRK
FT                   VPIAPDVHAETLARGTPGMSGADLANLVNEAALFAARSNKRLVDMEDFERAKDKIFMGA
FT                   ERKSVLMPERERRNTAYHESGHAVVAQLLPKTDPVHKVSIIPRGRALGVTMQLPTEDRF
FT                   SMDREEILQNIAVLFGGRIAEEVFMGQMTTGASNDFERATEMARRMVTQWGMSDSLGPM
FT                   VYGENEGEVFLGRSVTTHKNVSEATMQKVDIEIRRIIDTQYSLARKLIEENRDKIEVMA
FT                   KALLEWETIDAEQIGDIMEGRTPRPPKPSRTAPTPPKDNAPPAAPAPTATPAQEA"
FT   sig_peptide     540160..540231
FT                   /locus_tag="Nmul_A0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.265 at
FT                   residue 24"
FT   gene            542214..543119
FT                   /locus_tag="Nmul_A0484"
FT   CDS_pept        542214..543119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0484"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73792"
FT                   /db_xref="GOA:Q2YBS9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBS9"
FT                   /protein_id="ABB73792.1"
FT                   /translation="MSPSSIPPVEIFRLSHRPLVMGVVNITPDSFSDGGLFASTDHALN
FT                   HAFHLMEEGADLLDVGGESTRPGSTPVFVEEELRRILPVVEELANQNVRVSVDTSKPEV
FT                   MRAAIAAGAVMINDVRALQMPGALEAVAEGGVMACLMHMQGEPANMQVNPQYDDVVQDV
FT                   KVFLKRRVEAAQAAGIPRERLVVDPGFGFGKNQVHNIELLRHLDQFIDLGVPVLVGLSR
FT                   KSMLGKITGSDINNRIHASIAAALIAAMKGAAILRVHDVRATRDALAVYNAVYDRGSAR
FT                   ENASSLTSRWKPSVEFNSFR"
FT   gene            543137..544528
FT                   /locus_tag="Nmul_A0485"
FT   CDS_pept        543137..544528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0485"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73793"
FT                   /db_xref="GOA:Q2YBS8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS8"
FT                   /protein_id="ABB73793.1"
FT                   /translation="MTRKYFGTDGIRGRVGEAPITPEFVIHLGYSAGKVLTSSDWHLSK
FT                   GERPAVLIGKDTRISGYMLESALQAGLSAAGVDVLLSGPMPTPAVAYLTRALRLQAGIV
FT                   ISASHNPFEDNGIKFFSALGAKLPDATEQEIEAGLNAPLKAMPSAQLGKARRVNDARGR
FT                   YIEFCKSTFPNHLDLRGLRVVVDCAHGATYQIAGPVLHELGAEVVAIGIHPDGLNINHE
FT                   CGATHGAALQEAVRHHRADIGVALDGDGDRVIMTDGEGMLYDGDQLIYLVAKHRKQNGL
FT                   LKGGVAGTLMTNLAIENGLKKLDIPFARANVGDRYVLELLQIKNWQLGGEGSGHIICLD
FT                   KHTTGDGIISALQVLYAMRDSGKTLTELASDVTLYPQQLINVRVPKGFDAHNSLAIKTA
FT                   QAEAERDLDTTGRVLLRASGTEPLIRVMVEGESGQKVKHWAEKIAEVVRNAAAGERSVE
FT                   KALPN"
FT   gene            544726..545745
FT                   /locus_tag="Nmul_A0486"
FT   CDS_pept        544726..545745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0486"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73794"
FT                   /db_xref="GOA:Q2YBS7"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBS7"
FT                   /protein_id="ABB73794.1"
FT                   /translation="MLKSLNRMGLTRAAVLGAVFGATNIGMIAGANAGGLVKIDGSSTV
FT                   FPITEAVAEDFQNAKKGAVRVTVGISGTGGGFKKFCRGETDIVNASRPILQKEMEECKK
FT                   SGIQYVEMPVAFDALTVVINPKNDWANTLTVAELKKIWEPEAQGKITKWNQANPAWPDE
FT                   KLKLYGAGADSGTFDYFTEAIVGKTKSSRGDFTASEDDNVLVQGVASDKNALGFFGFAY
FT                   YVENQKKLKAVAIDSGKGPVLPSEKTVEDGSYQPLSRPIFIYVNIKSAEKPEVRELVEF
FT                   YMKNAPTLVKEVKFFPLPPQAYSTNLEHLNKKKVGTVFGGRTETGVRVEELLEREASL"
FT   sig_peptide     544726..544827
FT                   /locus_tag="Nmul_A0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.909 at
FT                   residue 34"
FT   gene            545984..547900
FT                   /locus_tag="Nmul_A0487"
FT   CDS_pept        545984..547900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0487"
FT                   /product="Ser-tRNA(Thr) hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73795"
FT                   /db_xref="GOA:Q2YBS6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS6"
FT                   /protein_id="ABB73795.1"
FT                   /translation="MAVVRLPDGSERVYEHSVTVGEVAASIGAGLARAALAGKVNGKLV
FT                   DLSARIENDSDVAIITEKDAEGLEIIRHSSAHLLAHAVKELFPEAQVTIGPVIEDGFYY
FT                   DFSYKRPFTPEDLAAIEKRMAEISTRNLKVERQVWDRSEAINFFKNQGEHYKAQIIEAI
FT                   PGDEDVSLYSQGNFTDLCRGPHVPATSRLKVFKLMKLAGAYWRGDSHNEMLQRIYGTAW
FT                   TNKDDQNAYLRRLEEAEKRDHRKLGKQLGLFHLQEEAPGMVFWHPKGWVVWQQVEQYMR
FT                   DIFRNNGYLEIRTPSVLDKGLWERSGHWENFRENMFVTQAEDREFSVKPMNCPGHVQVF
FT                   KQGLKSYRDLPLRLAEFGSCHRNEPSGALHGIMRVRAFTQDDAHIFCTESQVQDEAVQF
FT                   IDLLQKVYNDFGFNDILVKLSTRPAKRVGSEEQWDKAEEALRSALNHKNLIWELQPGEG
FT                   AFYGPKIEFSLKDSIGRIWQCGTLQLDFSMPERLGAEFVAEDNSRQIPVMLHRAILGSL
FT                   ERFIGILIENHAGALPLWLSPDHAVVLNISEGQADYAREVTEELRRAGIRAYADLRNEK
FT                   ITYKIREHSLQKLPYQIIVGDKEVAAQRVAVRTRSGSDLGQMTLPALVDRLKEEIRTRA
FT                   GAA"
FT   gene            547978..548532
FT                   /locus_tag="Nmul_A0488"
FT   CDS_pept        547978..548532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0488"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73796"
FT                   /db_xref="GOA:Q2YBS5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBS5"
FT                   /protein_id="ABB73796.1"
FT                   /translation="MRLIGADGEQIGIVPLAVANNLAEEAEVDLVEIAPTAKPPVCRLM
FT                   DYGKFRYQESKKKHEAKLKQKQIQIKEVKFRPNTDEGDYNIKLRNLISFLDEGDKAKIT
FT                   LRFRGREMAHQEFGVRLLERIKGDLESHAIVEQFPKMEGRQMVMVLSPRKKEIKNSKEV
FT                   KTSNSKETKPTADAESQPERR"
FT   gene            548761..548958
FT                   /locus_tag="Nmul_A0489"
FT   CDS_pept        548761..548958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0489"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73797"
FT                   /db_xref="GOA:Q2YBS4"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS4"
FT                   /protein_id="ABB73797.1"
FT                   /translation="MPKMKTKSGAAKRFTVRAGGTVKRSQAFKRHILTKKTTKSKRQLR
FT                   GSVNVHFSDVASVRAMMPYA"
FT   gene            548971..549330
FT                   /locus_tag="Nmul_A0490"
FT   CDS_pept        548971..549330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0490"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73798"
FT                   /db_xref="GOA:Q2YBS3"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS3"
FT                   /protein_id="ABB73798.1"
FT                   /translation="MPRVKRGVTAHARHKKILDLAKGYRGRRKNVYRVAKEAVMKAGQY
FT                   AYRDRRQKKREFRALWIARINAAARECGLSYSVFMNGLKKAEIEVDRKVLADLAVFDKP
FT                   AFAKIAEQAKASLAI"
FT   gene            549472..550506
FT                   /locus_tag="Nmul_A0491"
FT   CDS_pept        549472..550506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0491"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73799"
FT                   /db_xref="GOA:Q2YBS2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS2"
FT                   /protein_id="ABB73799.1"
FT                   /translation="MTHLDHLLTEAIELFNRTEDLAELEQVKARYLGRHGQLTELLKGL
FT                   GKIPPEERPAAGSRINQAKESLEAALSRRREAIQEKKLEEQLIEEKLDVTLSGRGTGMG
FT                   GLHPITLALERIQSLFHSVGFTVASGPEIETDFYNFTALNIPESHPARAMHDTFYVDDE
FT                   NGGASEHLLRTHTSPVQIRYMESNPPPLKVIAPGRVYRCDSDLTHTPMFHQVEGLWIDE
FT                   SANFSALKGILSDFMQHFFERDDLPVRFRPSFFPFTEPSAEMDIGCVMCKTGCRVCSYT
FT                   GWLEVLGCGMVHPNVFKHVNIDSQKYVGFAFGLGVERLAMLRYGVNDLRLFFENDLRFL
FT                   KQFN"
FT   gene            550707..553085
FT                   /locus_tag="Nmul_A0492"
FT   CDS_pept        550707..553085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0492"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73800"
FT                   /db_xref="GOA:Q2YBS1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS1"
FT                   /protein_id="ABB73800.1"
FT                   /translation="MKFSENWLRTFVNPPLSTRDLAHALTMAGLEVESVEPVAPAFHKV
FT                   VVAEVLSVQKHPDADHLQVCKVKTGAAGNDEPLQIVCGAANVRAGIKVPCALSGAQLPG
FT                   MAIKQTRIRGVESTGMLCSAKELGLEDASSGLLLLSPDAPVGTDFRAYYDLEDNLLTLK
FT                   LTPNRGDCLGLSGIAREVAAITSQNRQSVEIKPVSAQIAETLAIHVDAATACPLYCGRV
FT                   VRGISLDVATPQWMVQRLERSGLRAINPVVDVTNYVMLETGQPLHAFDLARIQGGLAGS
FT                   IHIRFARPGESIELLNGENLVLQPDMLVIADDAKPLALAGIMGGNESGVTSGAVDLFLE
FT                   SAFFSPGVIAGKSFSLGFSSDSAYRFERGVDFGATRAAMERATDLILNICGGRVGPVTE
FT                   LRGSLPARDPIRLGLERVGRVLGVELDEGRVAELLHRLQFGFLNTDAVFYVTPPTYRFD
FT                   LAIEEDLIEELARMYGYNRIAATMPRAKLDILSAPETRRTRSRLRQILVARDYQEVINY
FT                   AFVETSWETELAGNRTPIALKNPLSNQLAVMRSSLLGGLISNLQFNLNRKQSRIRLFEI
FT                   GGCFQKDGQTYSQQEKLAGLCYGDVVEEQWGLPARPVDFYDAKADIEALLWPGELRVAA
FT                   ARHPALHPGKSAEISIDGRIGGFLGELHPRWQQKLGLARSVVLFELNVDVLLARTLPQA
FT                   SEISKYPPIRRDIAVLVPKDVSVQAILDSMRSEKLSIISEIALFDVYQGKGVESDKKSL
FT                   AFRMLLQDTEKTLTDAQADQVVAKLISVLENRFGARLRS"
FT   gene            553136..553441
FT                   /locus_tag="Nmul_A0493"
FT   CDS_pept        553136..553441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0493"
FT                   /product="integration host factor, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73801"
FT                   /db_xref="GOA:Q2YBS0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBS0"
FT                   /protein_id="ABB73801.1"
FT                   /translation="MTLTKAELADLLFEKVGFNKREAKDMVESFYEEVRIALQNGDGVK
FT                   LSGFGNFQLRDKPQRPGRNPKTGEEIPITARRVVTFHASQKLKAMVEKNQHGKDNA"
FT   gene            553422..553787
FT                   /locus_tag="Nmul_A0494"
FT   CDS_pept        553422..553787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0494"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73802"
FT                   /db_xref="GOA:Q2YBR9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR9"
FT                   /protein_id="ABB73802.1"
FT                   /translation="MAKITPDTPLTPIPAKRYFTIGEVSELCGVKPHVLRYWEQEFTQL
FT                   KPVKRRGNRRYYQHHEVLLIRRIRELLYEQGFTIHGARARLGQGFVNPLPVVTLSSSID
FT                   LASLRSEIQDVLALLRS"
FT   gene            553914..553990
FT                   /locus_tag="Nmul_AR0011"
FT   tRNA            553914..553990
FT                   /locus_tag="Nmul_AR0011"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA-Pro2"
FT   gene            554084..554851
FT                   /locus_tag="Nmul_A0495"
FT   CDS_pept        554084..554851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0495"
FT                   /product="5'-nucleotidase / 3'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73803"
FT                   /db_xref="GOA:Q2YBR8"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBR8"
FT                   /protein_id="ABB73803.1"
FT                   /translation="MRILLSNDDGYFAPGLACLAEALSVIADIVVVAPERDRSGASNSL
FT                   TLDRPLSLRKSHNGFYYVNGTPTDCVHLAVTGMLDTLPDMVVSGINDGANMGDDTIYSG
FT                   TVAAATEGFLLGVPSLAISLAGFSAGNFPTAARVAAEIVRRFETDKLHGPVLLNINVPD
FT                   IPYDELQGLEVTRLGRRHKAEPVVKYKTPRGETVYWVGAAGPAQDAGEGTDFLAIQRKR
FT                   VSVTPLQIDLTRYGQLDAVKEWLNSHALGSTRS"
FT   gene            554904..555539
FT                   /locus_tag="Nmul_A0496"
FT   CDS_pept        554904..555539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0496"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73804"
FT                   /db_xref="GOA:Q2YBR7"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBR7"
FT                   /protein_id="ABB73804.1"
FT                   /translation="MTSQRTRARMVERLCTQGVTDEAVLTAMITVPRHIFVEEVLASRA
FT                   YDDVALPINFEQTISNPFTVARMSQLLRAGSNPGKVLEIGTGSGYQTAILAQFSREVYS
FT                   VERIGPLLTRTRGRLRELRINNVRLKHADGLLGLSEAAPFDGIILTAATPHMPPALLEQ
FT                   LAIRGRMVFPRGTSEQVLCVIERNLQGYTETILDEVKFVPMIPGIWQR"
FT   gene            555579..556661
FT                   /locus_tag="Nmul_A0497"
FT   CDS_pept        555579..556661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0497"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73805"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR6"
FT                   /protein_id="ABB73805.1"
FT                   /translation="MSATRIRDMSLNSNLSGLGKDLPRTFFAQRHILPYCLSLALCLLI
FT                   AGCSSTPRQGPMSNKAVPDRQKNGVSTSPQSQRPGVHIVRRGDTLYSIATSNNINPREL
FT                   AAWNNLPDPGAIRIGQEIFLSRPEGPVAAQPTLFAIQESAPSSSVVAPASPAQPRQDSM
FT                   PMPEARQPVPVGKVKTEPKAFKLPYSEQALAQVKSRADAALPVTVVKVAPAVEKTTPAE
FT                   ISTISIPPSEAIRNNAQGEWVWPAKGRVADLFSESTKGIDIVGMRGQTVAASAGGKVVY
FT                   SGEGLRGYGKLIIIKHSDTYLSAYAHNSKLLVKEGETVIKGQKIAEMGSTDAGLVKLHF
FT                   EIRKNGKPVDPLKYLPGISG"
FT   gene            556677..557630
FT                   /locus_tag="Nmul_A0498"
FT   CDS_pept        556677..557630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0498"
FT                   /product="RNA polymerase, sigma 38 subunit, RpoS"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73806"
FT                   /db_xref="GOA:Q2YBR5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012761"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR5"
FT                   /protein_id="ABB73806.1"
FT                   /translation="MMNQQEYTDEEELFEKEDSLEQDDEAADTPSSAITDTSNDFLLTD
FT                   VTQIYFNEIGHNALLTPKEEAELTRRVRQNDFAARQKMIECNLRLVVNIAKHYTNHGVA
FT                   LLDLIEEGNMGMMHALDKFDPERGFRFSTYATWWIRQNIERCIMNQSRTIRLPVHVIKD
FT                   LNIILQAARHLEAHTGKDPKAEDVAHLLGRTVKEVQRMLSLNQSMMSLDAPLDVDPLLS
FT                   IGDAIADDQSPGPDLMWEQSEIKGRVQDWLNRLNDKQRYIIEQRYGLNGYETQTLEQLA
FT                   ASLDLTRERVRQIQLEALQTLRMILRCEGVSKEGVF"
FT   gene            558019..558444
FT                   /locus_tag="Nmul_A0499"
FT   CDS_pept        558019..558444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0499"
FT                   /product="possible sec-independent protein translocase
FT                   protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73807"
FT                   /db_xref="GOA:Q2YBR4"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR4"
FT                   /protein_id="ABB73807.1"
FT                   /translation="MSEPQFFAPDPGLCTEEEISYLVHTFYATARKDPLLGPIFEAHVT
FT                   DWDAHFVQMINFWSMKLRGTGRFRGAPMPKHVALPGLTPELFERWLQLFHQTTSGMENA
FT                   NLQFNADMLARHIGSRLWLRYQMERYPDRQLVELCGA"
FT   gene            complement(558492..559754)
FT                   /locus_tag="Nmul_A0500"
FT   CDS_pept        complement(558492..559754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0500"
FT                   /product="Membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73808"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR3"
FT                   /protein_id="ABB73808.1"
FT                   /translation="MQASRLLLMPLLLTGILFAPNGARAAGFALQNQNGAGNGYAYAGA
FT                   AAVAQDASTIYFNPAGMTYLAPGHHVSGAGNLLIRSLRFKNTGSSPFLSYPLGDNGGQA
FT                   GGLSPIPAFYWSMSLGSAFRLGLGVSPTFGNSTEWNKTFIGRYQGRFSEILAINFNPSF
FT                   AWQLSEDVSIGAGLNIVKFDADLRSMVPVTSLLPLPVDVETKMKGDDVGFGYNLGVMFR
FT                   FSPSTRMGLTYRSTVDLKVDGRLSAPGTVIPASVALELPNTASLAISHMMSDRLRLLAD
FT                   LTWTGWGHIPAIVATSRASGTILANERLGFEDSFRVGLGAQYQYTERLRLHAGFAYDQS
FT                   PVRNARDRSVRLPDSDRFWLAVGLNQKLGERTSIDVGYSHVFFKGAEIERPTFPNPLLQ
FT                   VVRGSFSTNAHIISLQLNHHF"
FT   sig_peptide     complement(559677..559754)
FT                   /locus_tag="Nmul_A0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            560303..560920
FT                   /locus_tag="Nmul_A0501"
FT   CDS_pept        560303..560920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0501"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73809"
FT                   /db_xref="GOA:Q2YBR2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR2"
FT                   /protein_id="ABB73809.1"
FT                   /translation="MSNQNTGSAPYVLPPLPYADNALDPVISANTLGFHYGKHHKTYVD
FT                   NLNKLVAGTDLADMSLEEIITSTAGKADKAGIFNNAAQVWNHTFYWNSLSPKGGGEPPA
FT                   SLKQKIETAFGSVEVCKKELATAATTQFGSGWAWLVNDGDRLQVIKTGNADLPLTKGMK
FT                   PLLTIDVWEHAYYLDYQNRRPDYVNAVLDKLINWGFAADNDK"
FT   gene            560938..562149
FT                   /locus_tag="Nmul_A0502"
FT   CDS_pept        560938..562149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0502"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73810"
FT                   /db_xref="GOA:Q2YBR1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBR1"
FT                   /protein_id="ABB73810.1"
FT                   /translation="MTIPISEQIEIIKRGCSELLLEDELEQKLAQNRPLRIKAGFDPTA
FT                   PDLHLGHTVLLNKMRHLQDLGHHALFLIGDFTGMIGDPSGKNTTRPPLSREQVAENAKS
FT                   YQDQVFRILKPEQTEVVFNSAWMDRLNAADLIKLAATHTVARMLERDDFGKRYQSNKPI
FT                   AIHEFLYPLIQGYDSVALRADIELGGTDQKFNLLMGRELQKHFGQASQCVITMPLLEGL
FT                   DGVNKMSKSAGNYIGITESPGNMFGKLMSISDELMWRYIELLSFEPLRVVRQWQQDVGN
FT                   GRNPRDIKVLFAQEIVTRFHSRQDAEAALADFESRFRRGGIPDDLPENILQAGKEGLPI
FT                   AQLLKQTGLTASTTEALRMIEQGGVKLNGEKVSDKTFRLSCGQMVIVQVGKRKFARVTI
FT                   CEEK"
FT   gene            562629..564157
FT                   /locus_tag="Nmul_AR0012"
FT   rRNA            562629..564157
FT                   /locus_tag="Nmul_AR0012"
FT                   /product="16S ribosomal RNA"
FT   gene            564282..564358
FT                   /locus_tag="Nmul_AR0013"
FT   tRNA            564282..564358
FT                   /locus_tag="Nmul_AR0013"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA-Ile1"
FT   gene            564366..564441
FT                   /locus_tag="Nmul_AR0014"
FT   tRNA            564366..564441
FT                   /locus_tag="Nmul_AR0014"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala2"
FT   gene            564814..567702
FT                   /locus_tag="Nmul_AR0015"
FT   rRNA            564814..567702
FT                   /locus_tag="Nmul_AR0015"
FT                   /product="23S ribosomal RNA"
FT   gene            567825..567942
FT                   /locus_tag="Nmul_AR0016"
FT   rRNA            567825..567942
FT                   /locus_tag="Nmul_AR0016"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(568323..569405)
FT                   /locus_tag="Nmul_A0503"
FT   CDS_pept        complement(568323..569405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0503"
FT                   /product="Sulphate transport system permease protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73811"
FT                   /db_xref="GOA:Q2YBR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041193"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBR0"
FT                   /protein_id="ABB73811.1"
FT                   /translation="MSIEIRNLSKQFGTFSALRDVSLEVKSGELLALLGPSGSGKTTLL
FT                   RVIAGLEAADTGQVLFQGEDATDQHVRERQVGFVFQHYALFRNMTIFENVAFGLRVRPK
FT                   KFRPSTAEIQQRVHELLKLVQLDWLADRYPHQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRSWLRRLHDEMHITSVFVTHDQEEALEVADRVVVMNEGRIEQIGTPD
FT                   EVYEHPASPFVYKFLGKVNLFHGRLHRGRAWIGGIEIDAPEHTEAEELSGVAYVRPHDI
FT                   HVDKVDHALNGEGAIAAHVSHILSVGPVVRLQLVRDDGKDKELIEVEISRERFRELQLT
FT                   RGDQVFIKPSRFDLFPAQIH"
FT   gene            complement(569402..570283)
FT                   /locus_tag="Nmul_A0504"
FT   CDS_pept        complement(569402..570283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0504"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73812"
FT                   /db_xref="GOA:Q2YBQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ9"
FT                   /protein_id="ABB73812.1"
FT                   /translation="MTAIALPLPVPSGRVRPVEESAWVRRSLIGLALAFLTLFLFVPLI
FT                   SVFYEALKKGWDVYIAAITEPDAVSAIQLTLTAAAIAVPLNLVFGIAAAWAVAKFEFRG
FT                   KNLLVTLIDLPFSVSPVVSGLIYVLIFGLQGWLGPWLAEHDIKIIFAVPGIVLATIFVT
FT                   VPFIARELIPLMQSQGAEEEEAAVVLGANGWQIFFRVTLPNIKWGLLYGVILCNARAMG
FT                   EFGAVSVVSGHIRGSTNTLPLHVEILYNEYNFAAAFAVASLLALLALVTLALKTIIESK
FT                   TREKPETAGIQE"
FT   gene            complement(570300..571136)
FT                   /locus_tag="Nmul_A0505"
FT   CDS_pept        complement(570300..571136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0505"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73813"
FT                   /db_xref="GOA:Q2YBQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ8"
FT                   /protein_id="ABB73813.1"
FT                   /translation="MGTFRQHSVLPGFNLALGFTLLYLSLIVLIPISAAFVRTAELTLP
FT                   EFWDVVTTPRVLASYRLTFGASFAAALLNAIFGLLVAWVLVRYHFPGKKLIDALVDLPF
FT                   ALPTAVAGIALTALYAGNGWFGQYLEPVGLKVAFTPAGVFVALTFIGLPFVVRTVQPVL
FT                   EDLEPELEEAAATLGATRLHTFLRIIFPAIFPALITGFALAFARAIGEYGSVIFIAGNM
FT                   PMISEITPLLIITKLEQYDYAGATALAVVMLVISFVLLLIINLLQWWSRSRSSSTV"
FT   gene            complement(571138..572031)
FT                   /locus_tag="Nmul_A0506"
FT   CDS_pept        complement(571138..572031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0506"
FT                   /product="diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73814"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ7"
FT                   /protein_id="ABB73814.1"
FT                   /translation="MSISSSQEKDELARIQESTDYAVTRAENGFIMGHFFNCSLSSVFQ
FT                   PVFDAKTRSVAGHAAYIRSVVSEENPLSPWKVLSLGEGDAPLVRFDRLCRAVHVLNYFS
FT                   GRSHEGNLSVTVQPRLLESVKDDHGRAFKSILDIIGVETSRVVIEIPAEVNRNWKLLKH
FT                   VISNYRSHGYRIAINHNDAGDDWVAELASLYPLYPDVVRLEASVLQRLGDAGPLVDVIH
FT                   RFGAQVLFREIETARQLTGAVRAGADLLQGRFLGIPAQAIEFDLFIPAATTEYRSAEAS
FT                   SRRIRTLQHYIDAARI"
FT   gene            complement(572128..573120)
FT                   /locus_tag="Nmul_A0507"
FT   CDS_pept        complement(572128..573120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0507"
FT                   /product="Thiosulphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73815"
FT                   /db_xref="GOA:Q2YBQ6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ6"
FT                   /protein_id="ABB73815.1"
FT                   /translation="MKAWITTSLTAILLWGGNAWGDKTILNVSYDPTRELYQQFNSAFA
FT                   KHWESKTGEKIAIKQSHGGSGKQARSVIDGLDADVVTLALAKDIDEIAEKASLLPADWQ
FT                   KRLPHNSTPYTSTIVLLVRKGNPKNIKDWDDLVKPGVAVITPNPKTSGGARWNYLAAWE
FT                   YGKRTYGDDAKAKEFVAKLYRNVPVLDSGARGSTTTFVERGIGDVFISWENEAFLAIRE
FT                   LGPDKFEIVAPSLSILAEPSVAVVDKVADKKGTRTIAEAYLQYLYSDTGQEIAAKNFYR
FT                   PTNAAIAAKYASQFPGLKLFKIDDAFGGWKNAHKLHFADGGTFDQIYQK"
FT   sig_peptide     complement(573055..573120)
FT                   /locus_tag="Nmul_A0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            complement(573181..574923)
FT                   /locus_tag="Nmul_A0508"
FT   CDS_pept        complement(573181..574923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73816"
FT                   /db_xref="GOA:Q2YBQ5"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ5"
FT                   /protein_id="ABB73816.1"
FT                   /translation="MQEREATGIKADQMTGGQIKQITSVLDRATGRTRQERGMKFYLGT
FT                   VIAFALAIPPWSGAQADANTIDTEKFKMTEQENRFAQNGAVPVEEKGKADPSGASSKSN
FT                   GNTSAGKTAAAATKEEKKSTGYFRPSSSYSTQPESDPPRYVRTLSKTGIEAFKDIYWLD
FT                   VGIDHRTRYEFRSNDIRRTELRLDQPFLLRSRAYFGIREIFDPLRAAVEFQDSRRYNGH
FT                   FPPDDRDFNEHDLIQAYAELYFKGALGQDDLKQQRPLRLRVGRMAYEALDRRLIGRNEW
FT                   RNTTNTFEGFRINLGQEVNDWEGDLWAYQPVQRLLTEFDERIENQWFYGAIGHWRKWSD
FT                   FITLQPYYMGLTQDGSKTGEIDRHIHSPALRGYGKIGDTGLDFDFNLIYQFGRNGTQEH
FT                   QAHAYITELGYTLKHAWKPRISAFYGYASGDRNPNDNVNNRFERFFGFARPWSADDYIV
FT                   FENIKSPKIKLEFQPFKDLRIDGGYSWYWLASDTDRLNNLFRGNGSNGGSFSNRDATGS
FT                   SGDFIGHNFDIRARYKLAKHIDTTIGYSHFTSGEFVRNRQIAALGRSPGSSDFFYVEVV
FT                   LSAF"
FT   gene            575412..576308
FT                   /locus_tag="Nmul_A0509"
FT   CDS_pept        575412..576308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0509"
FT                   /product="tRNA s(2)C-32 sulfurtransferase"
FT                   /EC_number="2.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73817"
FT                   /db_xref="GOA:Q2YBQ4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBQ4"
FT                   /protein_id="ABB73817.1"
FT                   /translation="MGTGIEMLSRKEQHNANKLHKRLRRLVGTAIADFNMIESGDRVMV
FT                   CLSGGKDSYALLDILRSLQAHAATQFELIAVNLDQKQPGFPEHVLPNYLTSIGMPFRIV
FT                   EQDTYSVVKRLIPEGKTTCSLCSRLRRGVLYRVADELGATKIALGHHRDDILETLLLNL
FT                   FHGGKLKTMPPKLVSDDGKHIVIRPLAYCKEKDLAAYAEMENFPIIPCNLCGSQKNMQR
FT                   QVVKEMLQQWDKKFPGRLENMFSSLQNIQPSHLLDSSLYDFHGLKTGNGPVVDGDRAFD
FT                   PEPFEPGVEELLSLNKD"
FT   gene            576365..577774
FT                   /locus_tag="Nmul_A0510"
FT   CDS_pept        576365..577774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0510"
FT                   /product="Peptidase S1C, Do"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73818"
FT                   /db_xref="GOA:Q2YBQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ3"
FT                   /protein_id="ABB73818.1"
FT                   /translation="MRKPSGSVSQPAPLSVSPLSVSLWLVFIGLLVIALPGYPALPFSD
FT                   TKNGVPTLAPVLQDVTPAVVNISVVTRSAIEENPLFRDPFFRRFFNLPEQEARPERSVG
FT                   SGVIMDAAKGYVVTNYHVIKDAQQVVVTLKDRRQFQAKLVGTDPGTDIALLKIDAKNLK
FT                   ALRLGDSDLLNVGDFVIAIGNPFGLGQTVTSGIVSALGRSGLDIEGYEDFIQTDASINP
FT                   GNSGGALINLKGELIGINTAIIGPAGGNVGIGFAVPSVMVKAVLDQILRFGEVRRGRLG
FT                   ASSEDITHDLAASLGLPSTEGAIISAVEPGSPAEKAGVKPRDVITTVNGKPVRNSIDLR
FT                   NKVGLMPIGETLDLGLIRNGKRLTAKVKIAKLAEASSAGAEAVPEVSGATVADLKPGAR
FT                   RGIEGVMVTDVEVNSPAWLRGIRPGDLIIGVNRRQVRSVQELLAALKASSQGRLTLSLI
FT                   RGDFRVTIRIR"
FT   gene            577954..580554
FT                   /locus_tag="Nmul_A0511"
FT   CDS_pept        577954..580554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0511"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73819"
FT                   /db_xref="GOA:Q2YBQ2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBQ2"
FT                   /protein_id="ABB73819.1"
FT                   /translation="MQEKYHPQEIESEAQQYWQQTAAFKAVEAPEKRKYYCLSMFPYPS
FT                   GKLHMGHVRNYTIGDVLSRYHRMQGYNVLQPMGWDAFGLPAENAAMQNNVPPAKWTYDN
FT                   IAYMRKQLQSLGLAMDWDRELATCQPDYYRWNQWLFLRMLEKGLAYRTTGIVNWDPVDQ
FT                   TVLANEQVIDGRGWRTGALVEKHEIPMYYMKITAYADELLEALNALPGWPERVRTMQAN
FT                   WIGKSFGVEVRFPADAESGMPQDLKVFTTRADTLFGVTYVAVAAEHPVAQHAAKSNPAL
FT                   AAFIEECRQGAMMEAELATQEKKGRDTGLYVIHPLTGARLPVWIANYVLMGYGEGAVMA
FT                   VPAHDERDFEFATQYSLPIRAVIKPVDSGLTVPLAQAYVEHGITFDSGEFSGLAFQPAV
FT                   DAIAVALQQKGLGEKRVHYRLRDWGISRQRYWGCPIPLIYCDACGVVPVPDEQLPVVLP
FT                   EDLVPDGSGNPLAKTPSFYECSCPRCGQSARRETDTMDTFVDSSWYYIRYACTDQHRAM
FT                   VDARVDYWLPVDQYIGGIEHAILHLLYSRFWSKVMRDLGLVLFDEPFANLLTQGMVLNE
FT                   IMFRKTGSGRIVYFNPADVDIQTDEQGRRIGAVLRADGQPVEAGGIGTMSKSRNNGVDP
FT                   QKLVEQYGADTARLFMMFASPPEQTLEWADAGVEGAFRFLKRLWKQVYDHLQQSGVANG
FT                   PIPVAGLGPELKALRFQLHQTIAKVGDDLGRRHTFNTAIAAVMELMNALGKLQDSSPSA
FT                   RGLMQEALENIVLLLSPIVPHICHVLWRELRPGTELLDQPWPQADVAALVQDEIELIVQ
FT                   VNGKLRGKIRVAADTKPVIVEQLALENEQVRRFIDGKAVKKVVMVPGKLVNIVI"
FT   gene            580586..581098
FT                   /locus_tag="Nmul_A0512"
FT   CDS_pept        580586..581098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0512"
FT                   /product="Rare lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73820"
FT                   /db_xref="GOA:Q2YBQ1"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ1"
FT                   /protein_id="ABB73820.1"
FT                   /translation="MKKILLLTCCLLLAACGFQLRGTAALPFDTLYISFPQGHPIGTDL
FT                   RRLVRASTSTRLVDNRKKAEAILEILSVTNDRQIMSVSGGGRVLEFELRYRVSFRLLDA
FT                   KGEELIPTNELALRRIMPFTNQQVVAKEGEEAMLVREMQSDSADQIVRRLGAVKVAELN
FT                   KSPQVNP"
FT   sig_peptide     580586..580660
FT                   /locus_tag="Nmul_A0512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.534 at
FT                   residue 25"
FT   gene            581138..582154
FT                   /locus_tag="Nmul_A0513"
FT   CDS_pept        581138..582154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0513"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73821"
FT                   /db_xref="GOA:Q2YBQ0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBQ0"
FT                   /protein_id="ABB73821.1"
FT                   /translation="MRIAPEQLARHLDKQLAPLYTVSGDELLLAIEAADLIRVKARQGG
FT                   YIEREIFNVDSYFNWTELERCSNSLSLFGERRIIDLRIPSGKPGNQGSAVLEKYCRALP
FT                   PDTVTLVTLPRIDQQGAATRWFKALDAAGAVITVYPVERGRLPDWIGQRLTMQGQNADI
FT                   DTLQFLADKVEGNLLAAYQELKKLALLYPPGMLSFEQVKDAVLDVARYDAFKLSDAMVA
FT                   GDTARYTRILEVLQGEGMALPLIVNTLAGQIRLLVAIRTGLDAGKPPGQLTSQSRVWRD
FT                   RQKIMENAARRLNLEQLASALSHAAKIDRVSKGVASGDPWDELLQLGLRFAKIGQRQ"
FT   gene            582550..583815
FT                   /locus_tag="Nmul_A0514"
FT   CDS_pept        582550..583815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0514"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73822"
FT                   /db_xref="GOA:Q2YBP9"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBP9"
FT                   /protein_id="ABB73822.1"
FT                   /translation="MDIIDIKTYMHSIGREARAASRLIAKAETAAKNRALTQMAVAIKR
FT                   DEQQLLAANARDVENAKERGLEAAMIDRLTLTPKSVASMAEGLLQIAALADPVGEISDL
FT                   NYRPSGIQVGKMRVPLGVIGIIYEARPNVTADAAGLCLKAGNAAILRGGSEAIYSNQAI
FT                   AACVREGLKTAGLPETAIQVIETTDRAAVGELVTMKEFVDVIVPRGGKGLIERISNEAR
FT                   IPVIKHLDGVCHIYIDEEADQEKAIRVADNAKTQRYGTCNTLETLLVHENIAGEVLPPL
FT                   CRIYLDKGVELRGDPASQAIIPEMKEAREEDWYTEYLAPVLSVRVVSSLDQAIEHITIY
FT                   GSQHTDSIITENYSNARRFLREVDSSSVMVNASTRFADGFEYGLGAEIGISTDKLHARG
FT                   PVGLEGLTSQKFIVLGDGHIRQ"
FT   gene            583866..585746
FT                   /locus_tag="Nmul_A0515"
FT   CDS_pept        583866..585746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0515"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73823"
FT                   /db_xref="GOA:Q2YBP8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBP8"
FT                   /protein_id="ABB73823.1"
FT                   /translation="MAQLTEIKVPDIGDFKDVAVIEVLVKPGDTVEKETSLITLETDKA
FT                   SIEVPSPQSGIVKELKVKVGDKVSEGSIILMLEATTAEAAAPAKASEPGGASKQEEPAE
FT                   KPAANVAPPSEKEEEEKTPASVAAPAPESVAPPAAPSIPQGDIHADIVVLGAGPGGYTA
FT                   AFRAADLGKNVVLIERYSTLGGVCLNVGCIPSKALLHVAKVITDAEETAQQGIAFAKPG
FT                   IEIDKLRGWKESIIGKLTKGLTGLAKQRKVKVVRGTGRFTSPNMIEVETSDGKKTVSFE
FT                   HCIIAAGSAAARIPGFPYDDPRIIDSTGALKLESIPKRMLIIGGGIIGLEMATVYDALG
FT                   SRISVVELMDQLIPGADADLIRPLHKRIQKRYEAIYLKTKVTRIEALQEGLRVTFEGSS
FT                   EGGGPEGTGAPEPQVYDRILMAVGRRPNGREIGAEKAGIAVNERGFIPVDKQLRTNVSH
FT                   IFAIGDIAGEPMLAHKASHEGKLAAEIIAGGEKMKSAAFDARAIPSVAYTDPEIAWMGL
FT                   TETEAKKQGIEIEKAVFPWAVSGRALAMARDEGMTKLILDKKTRRILGAGIVGINAGEL
FT                   ISETVLGLEMGADMEDIGLTIHPHPTLSETVFFAAEIAEGTITDLYMPKK"
FT   gene            complement(585829..587052)
FT                   /locus_tag="Nmul_A0516"
FT   CDS_pept        complement(585829..587052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0516"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73824"
FT                   /db_xref="GOA:Q2YBP7"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBP7"
FT                   /protein_id="ABB73824.1"
FT                   /translation="MKKSLCMTLCGTAGFFLLYLSAWASEGGTAPQLNEARQVAQYNYV
FT                   IHILAMLLVGFGFLMVFVKRYGFGATTGTYLVVAVGLPLYILLRANGVFAHEIAPNTVQ
FT                   ALLFAEFAVASGLIAMGAVLGRLRVFQYALLALLLIPAYLLNEWLVLDNGMGMTEGFQD
FT                   TAGSIIIHAFGAYFGLGLSLALTTARQRSQPIESDATSDRFAMLGSMVLWLFWPSFATA
FT                   IVPFEQMPQTVVNTVLALCGATITTYFLSTYFHKGKTSMVDMANAALAGGVAIGSTCNI
FT                   VSPTGAFAIGLLAGAVSVIGFVFIQPALERRFKIVDTCGVHNLHGMPGLLGAFVAVLVV
FT                   PGIAVAQFIGIAFSVVFALIAGLAAGALIRATGTTRLAYEDSEEFTHTEGPEATEIEAI
FT                   VLEGETST"
FT   sig_peptide     complement(586978..587052)
FT                   /locus_tag="Nmul_A0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            complement(587670..588296)
FT                   /locus_tag="Nmul_A0517"
FT   CDS_pept        complement(587670..588296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0517"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73825"
FT                   /db_xref="GOA:Q2YBP6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBP6"
FT                   /protein_id="ABB73825.1"
FT                   /translation="MSLKSSTPLTIAILLSYGLTQPASAEIIYSFTDEHGVVHFSNVPA
FT                   DERYVPFIGSSANSRKSRTASNNGHPVASLKAQYGSVIKEVARAHALEDALLHAVVTVE
FT                   SAYNPRAVSKKGAAGLMQLMPETAQRYGVIDRFDPVQNLHGGARYLTELLRMFNGNLSL
FT                   TLAAYNAGENNVIKYGNRIPPFQETRNYVPKVLELYRRYQSRKRL"
FT   sig_peptide     complement(588219..588296)
FT                   /locus_tag="Nmul_A0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(588509..589288)
FT                   /locus_tag="Nmul_A0518"
FT   CDS_pept        complement(588509..589288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0518"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73826"
FT                   /db_xref="GOA:Q2YBP5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBP5"
FT                   /protein_id="ABB73826.1"
FT                   /translation="MQHTPRRRFGQNFLVDSQTVTDIVHALHPRREDVMVEIGPGLGAL
FT                   TQPLLQSLEHLHVVEIDRDIVKRLRNEFSAKRLTVHEGDALEFDFSSLGESLRVVGNLP
FT                   YNISTPLLFHLSRFTDHLRDMHFMLQKEVVARMVAKPSTSDYGRLSVMLQCRFEMEQLF
FT                   IVPPECFHPPPKVQSAVVRMIPLKKPLIEASQEKLFAEIVSAAFSQRRKILRNTLRDYL
FT                   TGEDYLKLGIDSNLRAENLSITQYVAITNYFNRVRSG"
FT   gene            complement(589358..590338)
FT                   /locus_tag="Nmul_A0519"
FT   CDS_pept        complement(589358..590338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0519"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73827"
FT                   /db_xref="GOA:Q2YBP4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBP4"
FT                   /protein_id="ABB73827.1"
FT                   /translation="MNNPKLALTAGEPAGIGPDLCVQITQLGLPFKLIVIADRELLQER
FT                   AHLLRLPLTITDYSSRAEHRPGEGILHVLHIPLAETATPGKPDAANASYVLKTLERAVA
FT                   GCVNGEFDAMVTAPVHKGVINDAGISFTGHTEYLAQLTNGRPVMMLAGGGMRVALATTH
FT                   LPLKDVASAITSDALEQKLRIIEHDLVTRCGIPKPRIAVAGLNPHAGESGHLGREEIDI
FT                   IIPSLDKLRAGGMSLIGPLPADTLFNPSKLKDYDCIFAMYHDQGLPVLKHASFGTAVNV
FT                   TLGLPIIRTSVDHGTALELAGTGKADPGSLVAAIEMAASLVAHQR"
FT   gene            complement(590375..591697)
FT                   /locus_tag="Nmul_A0520"
FT   CDS_pept        complement(590375..591697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0520"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73828"
FT                   /db_xref="GOA:Q2YBP3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBP3"
FT                   /protein_id="ABB73828.1"
FT                   /translation="MGTKLSSRSPFSLPFLTLLAGMAIAQQPAHSGVETIDHIVAVVNE
FT                   NVITRHELDEMLGAMLKQLQKQGVQPPPPAVLEKQLLERIILNRVQLQLANETGLTVSD
FT                   AELDQTLRRIAQENKMSLQEFDRALAEDGVSFSKFRDEIRDEIILVRLKEREVSNRVSV
FT                   TEGEVDHFLETQEDSPSQSDEYRIAHILIQVSEGADPLKRDAARQRAESALAKLKAGTE
FT                   FAQVAAEFSDAPDAMEGGLLNWRPAAQLTKKFAEILTPMKPGEITGIIPSPNGFHILKL
FT                   VERRNQDTVTTMIDQTHARHILIKISELTSEADAHRRVTELKERLDNGSKFEELAKLHS
FT                   EDASAPTGGDLGWISPGDTVPEFEQAMSALKPGEISSPVQSPFGWHLIQVIERRTQDVS
FT                   QERKRQSARQAIRARKAETAFQEWLQRLRDRAYVEYRLEEG"
FT   sig_peptide     complement(591620..591697)
FT                   /locus_tag="Nmul_A0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.823 at
FT                   residue 26"
FT   gene            complement(591768..594557)
FT                   /locus_tag="Nmul_A0521"
FT   CDS_pept        complement(591768..594557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0521"
FT                   /product="Organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73829"
FT                   /db_xref="GOA:Q2YBP2"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBP2"
FT                   /protein_id="ABB73829.1"
FT                   /translation="MKLRFIRSAGWLFLLFCLACNARADLPPLSSKPEQGRATPSGEGD
FT                   DKPVVIDTERIRGHHEYESGTRSESELRSRSTISTDQIKKPNQKADPAAKDTPSAPQQN
FT                   YTLSPAIKTDSRTGTSAQESEKAESMVLPGGVERLPGPAAEEGEPRLRTRTQSAPRTLS
FT                   AQKRGEKPAKTPAPAEADQDRPGFAEGERIGGHREEAGDEKLRLAGETEPEAIEQKLAE
FT                   AEAETDKQSPVFVVADRLQGHVEEEIEAIGKAELSAGPQFISAERMKYNQGTNDAEAQG
FT                   NVRVEKEGDILEGSDLKFNLLSKTGQLSEPSYRLKDASSRGYAGMLLFEGENQYRLQKA
FT                   SYTTCPVGDDSWVLQVADLKLDNDKKVGTAKNVKLTFKDVPILYTPWMNFSYSGERKSG
FT                   LLAPTYGTGSRTGLELAVPFYWNIAPNYDATFSARLMSKRGLAINNEFRFLGQNSSSNL
FT                   LADIVPRDLDTQTTRWRTSFWHNHYLGAGFSARLDYNRVSDATYFRDFGNNLNLTSRTN
FT                   LLQQGLLSYNRGLGDDGTFNVTSLVQSFQTIQDPLAAIVVPYKRLPQVGLNANKPDVFG
FT                   TGVDVNLSGSWTNFSHPTLVNGSRTVLFPSMSYPLRNSFGFITPKVGMHYTRYSLGEGA
FT                   GVSEENPTRTLPIFSLDSGLAFDRKMSLGGESFTQTLEPRVFYVYVPFRAQDQLPNFDS
FT                   AKTDFSFAQMLAENRFSGSDRINDANQVTFALTTRLLESSTGRERLRLAVGHQLSFIDR
FT                   RITLETPQTIDRRPDFIAAVSGFLTPTISTDTSFQFDQTRLLADVVRSGVSYRPEPGRV
FT                   LNFGYRFTRDVLHQVDASSQWRWSERWQTVARLNYSLQDKRILEGLAGVEYNACCWSLR
FT                   FVLQHLTLATQKSTTAAFLQLELNGLMQIGSNPLTVLQRSIPGYIRTGSQGSGLIEGP"
FT   sig_peptide     complement(594483..594557)
FT                   /locus_tag="Nmul_A0521"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            594599..594892
FT                   /locus_tag="Nmul_A0522"
FT   CDS_pept        594599..594892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73830"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBP1"
FT                   /protein_id="ABB73830.1"
FT                   /translation="MNAYFQAHKSRVTVWKLLYGSMERGIGAPRMQMELLLRAVRRSTG
FT                   TAGGCKQTKAVSVTKKSGKPAGMRLNEQSKHADRMERLNSGRAYFNRKQADA"
FT   gene            594921..596291
FT                   /locus_tag="Nmul_A0523"
FT   CDS_pept        594921..596291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0523"
FT                   /product="UDP-N-acetylmuramate"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73831"
FT                   /db_xref="GOA:Q2YBP0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBP0"
FT                   /protein_id="ABB73831.1"
FT                   /translation="MHIHILGICGTFMGGIAAIAQEAGHKVTGCDAGVYPPMSTQLKSR
FT                   GIELIEGFSSEQTRLNPDLFVIGNVVSRGNPLMEEILDRNLPYISGPQWLSENVLRDKW
FT                   VLAVAGTHGKTTTSSMLAWILEYAGMEPGFLIGGIPQNFGISARLGNSGFFVIEADEYD
FT                   TAFFDKRSKFVHFHPRTAILNNLEYDHADIFRNLEEIEQQFHHLVRVVPGKGLIVSNGQ
FT                   EENLERVLRKGCWTPVERIGVANGWEADVLTDGAVAVSFLGESQGTLLWELLGKHNRMN
FT                   ALAALAAARHAGVAVKAGIAALAEFRNVKRRMEVKGITRDITVYDDFAHHPTAIRTTID
FT                   GLRSRVKGARIIAVLEPRSNTMKMGVWKESLADSLTGADVVFCYAANLGWDLPQALLPL
FT                   GEKAVAFEELDQLIAAITAYAQPGDHVLIMSNAGFGGIHEKLLTRMAAVAADEVASG"
FT   sig_peptide     594921..594983
FT                   /locus_tag="Nmul_A0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.954 at
FT                   residue 21"
FT   gene            complement(596351..596869)
FT                   /locus_tag="Nmul_A0524"
FT   CDS_pept        complement(596351..596869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73832"
FT                   /db_xref="InterPro:IPR022061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN9"
FT                   /protein_id="ABB73832.1"
FT                   /translation="MRKILPSLLLFVVSVGHATDASVRPGLWEITTTSMLLALVPRIPP
FT                   EQMQQLTKLAKQYGLDLPRIENGAATSRICITRKMADQEIPSYLHVHEAGCSIQNAIRT
FT                   GNDYKMDLVCTNPQLQGKGRAEGSFTTPESFSGWTVFTGTMQNTPVNEHADTTGRWISA
FT                   NCGKIKSPR"
FT   sig_peptide     complement(596813..596869)
FT                   /locus_tag="Nmul_A0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.796 at
FT                   residue 19"
FT   gene            complement(597597..599657)
FT                   /locus_tag="Nmul_A0525"
FT   CDS_pept        complement(597597..599657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0525"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73833"
FT                   /db_xref="GOA:Q2YBN8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN8"
FT                   /protein_id="ABB73833.1"
FT                   /translation="MQNGGQTEGKLQPNRRKLFLYNHFRDSPQKNTIDFALISRRRFVK
FT                   LTALLVSGASTFLASCSTLLWKGSSRPFVHLNCPSAAGNKFDYIIIGSGAGGGPLACNL
FT                   ALKGFRVLLLEAGGEDDPCEYYVPAFHARASEHEALRWDFFVRHYADDEQQKRDDKFIP
FT                   ERNGVLYPRSGTLGGCTAHNAMLLIYPHNSDWDYIAEKTGDESWRSENMQKYFKRMERC
FT                   EYATRAEEPDSRHGFGGWLPTNLAEREMLLRDKVLRRLSKAALEESLSGIINPIKRTLL
FT                   KIKTHGDPNDWRFIRRRPEGLCKIPITTRQGRRAGAREYILRVREQCPNFLEVRTHALA
FT                   KRILLDEQNKAYGVEYISGAHQYRADPRHGTAAPGIGETVLAEREVIVSAGAFNTPQLL
FT                   KLSGIGPREELEGHGITVKVDLPGVGENLQDRYELGVVTRLRENIPLIKGMKLRCPAPG
FT                   EAPDSQFSQWLQGVGPYTTNGATIALMKRSFPERPDPDLFIFGLIGDFRGYYPGYANNI
FT                   ARTENAFTWAILKGHTANTAGRVTLRSADPRDVPDINFHYFSEGTNAGEDMESLVAGVE
FT                   AVRNIVRLSSDVIEEEVLPGPEVKSREEIQRFIKNQAWGHHASCTCKMGAATDPMAVVD
FT                   SRFRVYGTRNLRIVDASVFPKIPGFFIASSIYMISEKACDVIREDAERMQV"
FT   gene            complement(599722..602367)
FT                   /locus_tag="Nmul_A0526"
FT   CDS_pept        complement(599722..602367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73834"
FT                   /db_xref="GOA:Q2YBN7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN7"
FT                   /protein_id="ABB73834.1"
FT                   /translation="MKSKRVALTFIAMGLTTLLIGCAYKRPPWIANECVEGPFAKAGAV
FT                   KDEAQCANRSAESFPGADEDYFKDMDYGISQDPQKVVATLEPFVPGISRVPQEAVKAIV
FT                   RGRNNWIVWTGGDDKFWDHLNINSQGSFDLLKVLSNHPHLMKNPGYSRDNRWYWFGLVN
FT                   EPCFRKNVDAQGNPLGRPDRFGLYLDVRDPNCASDPFENEEKYPGVKIGSRGKTVPIGS
FT                   YYGYASGIVGLRLFPNPDFDEAAKKRWDPERYYTDPSYYNDANLVKPYRVGMSCGFCHV
FT                   GPNPSNPPKDPENPQWANLNSNPGAQYFWFDRIFAYEADKNSFAYQFLSTNRPGALDTS
FT                   LISTDYMNNPRSMNGVYNLGARMKNALRSGKEQLTGDELNNKQFNDYREISSESPLRRF
FT                   FEKSGTVFTPRVLKDGADSVGALGAFNRVFVNIGLFSEEWLQHINPLIGGKPFTPFPIA
FT                   TANKNSSYWRATENQTLDTSLFFLAASRPDYLAEAPGGRHHLTADAATLKRGKEVFAEN
FT                   CAGCHSSKLPEKAVKFFPNNGCVGPDYLSCWNQYWNWTKTDEFRQEMKEIVLKEDFLAD
FT                   NYLSTELRVPVTLLETNICASLATNALKGDTWDNFSSTSYKELPSVGSALVHHPVTREP
FT                   RSYPMPDGGRGYIRPPSLASLWSSAPFLLNNTLGKFYPSGTVEDRMKSFYSGIEQLLWP
FT                   EKRYCDQEDLYGGSYYAEKNYGDQERTSCENRTYVTRSGKEVPGIIDRTWARSWLLIPE
FT                   GYLPWYVRLPIHDGVLNLGPIPEGTPVSLLSNLDLEKRGGEVKTLLKTLKGHLGDLIAA
FT                   KVTPDRITDAELRKVYSNLVDPLLGVSKCPDFVVNRGHYFGTDYLPGDEGRPGLGDSDK
FT                   RALIEFLKTM"
FT   sig_peptide     complement(602290..602367)
FT                   /locus_tag="Nmul_A0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.714 at
FT                   residue 26"
FT   gene            complement(602454..603491)
FT                   /locus_tag="Nmul_A0527"
FT   CDS_pept        complement(602454..603491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0527"
FT                   /product="Tyrosinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73835"
FT                   /db_xref="GOA:Q2YBN6"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN6"
FT                   /protein_id="ABB73835.1"
FT                   /translation="MYYSYCVQGVLASSESHIAPVVFLEPFVRSKKMDHSHKTGAHLHP
FT                   KTFDEVIALGFPLDKLELLKDIHKKLVKPLLGGAAAFAPKPPGAPVTRQNQADLSPEKR
FT                   EAFRNAVVRLVEEGKYLELVQFHRDMSHDMHGMMGETGLYRFLGWHRRYLVEFERELQR
FT                   VDAVLRPGATEKLAVPYWRWEDPFPAWLNGFLPANDPDTGTPPPSRKNASPPQKANATD
FT                   VDIIVNQFSIQNTGLNNENDYTKFTYGLEGWGRRPDGTSLPGHNHGHAWVGGIMNNTMS
FT                   SPTDPVFWLHHAEVDRLWHIWQQANSSAEPNLSGSDRIMDPWGESYDDLVDTEDLGYVY
FT                   DSTSL"
FT   gene            604068..604499
FT                   /locus_tag="Nmul_A0528"
FT   CDS_pept        604068..604499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73836"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN5"
FT                   /protein_id="ABB73836.1"
FT                   /translation="MAYDIQQVINMSQDELDKLFSSGEVGEIPDGEAKGTAIIAPGTPY
FT                   NYAIAQVINFFAWQGKIFDAKTSTLKNEISPFGFRAIIAKVYKDDSWFDHKPCIVLDYS
FT                   ETSTVAQRVRDEIRKVADKQYLGKVYWGNKHLIDFFLQF"
FT   gene            604712..606016
FT                   /locus_tag="Nmul_A0529"
FT   CDS_pept        604712..606016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73837"
FT                   /db_xref="GOA:Q2YBN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN4"
FT                   /protein_id="ABB73837.1"
FT                   /translation="MTPQSSFMIVAAVRNGQLKDLRALLASMNNLPGHADPNNELMPFG
FT                   KFDRLHFARFVLIEARTAQEIRAFGVTPRPWQPTLAFLGDIDGDMQTFFLELIERAEPG
FT                   LKKIFSHCEGFSEENQDLLGWMKANNINASATYVNWIGRTVRQIHEEAALHRSLSAYLP
FT                   KTVDDVGRENVRALRQKLLSYVEMEKYKGRLTLTPPEPTPPEWKMRNLLHMIGVPLILL
FT                   LLSPLLLVIALIFALRLRMLERSDPELFIRPSREHLAELTVQEDRDVSNQYSVFGDVKP
FT                   GGVRLLTFKFVLLVTDYLARHIYNRGFLARIKTIHFARWVFMDNNHRVFFASNYDGSHE
FT                   SYMDDFINKVGWGLNLTFTNGVGYPTTRWIIKEGANREHAFKYTQRRHQIPTEVWYKAY
FT                   PGLTAVDLARNSRIRQGVEIRQSNDAEIREWLSLI"
FT   gene            606028..607542
FT                   /locus_tag="Nmul_A0530"
FT   CDS_pept        606028..607542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0530"
FT                   /product="possible peroxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73838"
FT                   /db_xref="GOA:Q2YBN3"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN3"
FT                   /protein_id="ABB73838.1"
FT                   /translation="MKESSDFEFDDLQGLLRFGYGKLTDTSFLLLNIVNADLAKKWLET
FT                   APISSAVTQDPPPETALQIAFSVEGLRVLGLEESVVEGFSDEFIVGMAGDESRSRRLGD
FT                   IGSNAPQQWKWGGNAAQVPHVLLLLYATEGGIGAWQKTIEGEHFSNAFELLQELPTLYI
FT                   GDIEPFGFPDSISQPTVDWMQRQSTDTHERDRYSNLLAPGEIVLGYRNEYGQYTARPLI
FT                   DPRKDKLATMLPGAEDDPPLKDFGRNGTYLVLRQLGQDVPGFWQFLDQVADHIPEKREQ
FT                   LAAAMVGRELDGTPLVPAHIPGISRKEYENDFTYEQDPKGNYCPLGAHVRRSNPRTGDL
FT                   PTSACGPVDRLIKILGFGQRPDEDLVASSRFHRLLRRGRTYGPALAPKDAVERHAPVAE
FT                   RGIQFICLVGNISRQFEFVQNAWTMNSKFDGVQDEKDPMLGNREPLMSGESTDHFNSPD
FT                   PAGPMRTTCHLPQFVTTLGGGYFFMPGLRALKYISALPANRTGSPS"
FT   gene            607539..608744
FT                   /locus_tag="Nmul_A0531"
FT   CDS_pept        607539..608744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73839"
FT                   /db_xref="GOA:Q2YBN2"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN2"
FT                   /protein_id="ABB73839.1"
FT                   /translation="MTKIKNRILKAIHNFLILLLRIERRLEPWFRAQWNYLFREPSAKF
FT                   IQYLINRRRKNEGLQLAEEKFYPDEEESLNKIIDLMMDQMRGRFKPGGYERGGNTKTHG
FT                   IVRATVTIRDDLPEHFRKGIFAYPRTYPAYVRYSGPGPNVPADINDVGFMSMAVKLMGV
FT                   PGEKLMSEEKFTQDFITTSGGATFVTPNTRENAKLQYWSLVDMTLYYFLNPKDSHLLDF
FT                   FMQSLWNETQYNPLGRRYWSCTPYLLGEGQAMMYSFVPKTTDVETHIPGLPFGTPPFNY
FT                   LRENMIKTLNEKDVEFDLMIQLQTDPHLMPIEDSSVRWPEELSPFIPAATVHIPKQKFD
FT                   SDAQFEFAKRLKMNPWHCLPEHRPLGNLNRARFRMYYELSKFRQEMNETTHLEPTGDEI
FT                   FD"
FT   gene            complement(610090..611751)
FT                   /locus_tag="Nmul_A0532"
FT   CDS_pept        complement(610090..611751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0532"
FT                   /product="Arachidonate 15-lipoxygenase"
FT                   /EC_number="1.13.11.33"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73840"
FT                   /db_xref="GOA:Q2YBN1"
FT                   /db_xref="InterPro:IPR000907"
FT                   /db_xref="InterPro:IPR013819"
FT                   /db_xref="InterPro:IPR020834"
FT                   /db_xref="InterPro:IPR036226"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN1"
FT                   /protein_id="ABB73840.1"
FT                   /translation="MSNKLPQNEENTGKEERKNYLLQRQAEYQYAYEYAETIAVARKLP
FT                   WREIPGIGYWLRGGMNLLRLIPSLPSLSVTFLRYLLGKPMESYRDYVFFPASPPNPDLV
FT                   DSFQQDLIFGLQRVIGVNPVMLRAVTRQNPLPEKLPEAEMRKIFEEQIDEIDYMAATAQ
FT                   KRIYVLDYAVLDVLQSNPGYIDGQKQYVTTPIVVLFLQPDGMLRPVAIQLYQDDRSDNP
FT                   IYTSKDGNLWLTAKMFAQVADGNHHILYTHATRIHYVMEAIIMASRRQLYKSHPLYVLL
FT                   NPHLQHTLNVNHQHTFLKDRKGRPGRYGELFAGDYDSMTQCMANGMTSFNFKESAFSDD
FT                   IARREVDNPDLFYPYRDDGILLWNAIQSFSKEYVDLYYKSEADVTDDYETQAWAHDISA
FT                   QDRGRIPGFPARFESRQELSETLGHIIFLCTAFHSCIHFNQYKYPGFVPNMPHSAYAPP
FT                   PAGKNAEIDGAGLLKFLPTFRAAYSQTWTYFLTNFCVNSIGQYNLKQFDSEAHEVIERF
FT                   GDRLEEIEEEIDQRNSRRSFAYDRMNPRFIPNGVTI"
FT   gene            complement(611823..613418)
FT                   /locus_tag="Nmul_A0533"
FT   CDS_pept        complement(611823..613418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0533"
FT                   /product="Animal heme peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73841"
FT                   /db_xref="GOA:Q2YBN0"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR029580"
FT                   /db_xref="InterPro:IPR037120"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBN0"
FT                   /protein_id="ABB73841.1"
FT                   /translation="MYEFFFPILFRIANRFPWLVRIVSRITWLRRFISDAFINWQAYST
FT                   NPRPRPFSLASSYTTWQSLTDKSFTGRHLAEAEGDQNLPDMQRVVDLWRRKENKEIPSV
FT                   DTSILFAFFAQWFTDSFLRTDFRDRRKNTSNHEIDLCQIYGLREEITHYLRLKKDGKLK
FT                   SQIIGGEIFPPYLFNVEETTTGNWVFADKEFEKLHPREVLDFVFSNVPEERLKRVFAAG
FT                   LEHGNSSVGYTIMNTVMLREHNRICDLLKEAYPKWDDERLFQTARNIMVVLLIKVVLAD
FT                   YVSRFTQFGFTLDPSPDLAERQRWYRTNWISLEFNLLYRWHSMVPESYRVGNQSYPLDA
FT                   FRNNTPLVIQHGIGRLITAASMQRAGRIGLHNTHDYFFYPLPIADDNRSVMERSIAMGR
FT                   QARLRPFNDYREAFSMPRLRSFEELTEDNELQRELKDLYNDRIDDLEWQVGIFAEDHDE
FT                   GFSLGRLMVRMVGYDAFTHALTNPLVSIYVHNEKTFSKVGQSVIEETSSLADIVKRNVR
FT                   DSDTVLASFNTSVQ"
FT   gene            613763..615859
FT                   /locus_tag="Nmul_A0534"
FT   CDS_pept        613763..615859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0534"
FT                   /product="Peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73842"
FT                   /db_xref="GOA:Q2YBM9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM9"
FT                   /protein_id="ABB73842.1"
FT                   /translation="MSPSHQPPESQPTVKVFDPLELDRSVIAIPLLRQMEEELRGIEAF
FT                   RAAHPFPEDGEFNTLIEYNREFDGKPEEMRELVVKMAEEAAAKALEASKKRVEESKEIA
FT                   PAGTRGTPVRGGSTRSRADIYGNPFLMEQRRDKDLQEAVGNQKIGPVSEDGAYSFASLH
FT                   ATIIRRILAANERLSQGEEASKKPPILRIHPTRYEVIIDINLEYPGGREEARRWIYQNI
FT                   EEAKNKAKVYDAGQDIHLKKEQRESGYMFACLEARTIKALIELDVAQAKVKAREAQAKV
FT                   GDTSHEAKARAAKINPAKFRAIFRIWPDFEISASITHSIATIKADAAQNSFSARGAGIT
FT                   WAVMDSGIKQDHGHFRKHNNVDKDSTWHKDFTADGSDPFNDENGHGTHVAGIIAGEWRP
FT                   AGAPGGTQVAAPAEVSPPAGDSAAPSRIPVAVSRYLKTGSEDVEYQQIKLVDGISGMAP
FT                   RCKLISLRVLDENGKGSVSNLIAAIAHVQEINGYGRKLLIHGVNMSLGYTFEPEWFACG
FT                   QSPLCVEVDRLVKTGVVVVVAAGNTGYGTLKAATGALSAGMALTINDPGNAELAITVGS
FT                   THRDMPHVYGVSYFSSKGPTGDGRLKPDLVAPGEKIISCATGQLKSEGAQGIECDYVET
FT                   SGTSMAAPHVSGAIAAFLSVRTEFIGKAERVKEIFVDTTTDLRRDRYFQGSGLVDLMRA
FT                   IQSV"
FT   gene            615898..617214
FT                   /locus_tag="Nmul_A0535"
FT   CDS_pept        615898..617214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73843"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM8"
FT                   /protein_id="ABB73843.1"
FT                   /translation="MNEIAGIPYVEASFDKNGQGPEEEVALPAGVTDLIIMSHGWNNNK
FT                   SKAEDLYNGFFASFAAAAQPNDLSARKLVILGVFWPSREYDTSVAVSGTPATGGGGAAL
FT                   GGGNGGSIKRLEEKLDDMKEIFTEAEQKKLLDEAKALLPDLEEKASVRDLFVNKMRSLL
FT                   DPSAAGKEDASNIFFKDGGNELMKNLKAEEEDLGEDVAGGGAALPLGVSTPARAEGGAA
FT                   GLVEILSGFKAAAINLLNYTTYYEMKTRSGTVGKNGVAPLIDKLASQVERIHLIGHSFG
FT                   CRVVTSAALGSKTDKIKSMILLQAAFSQNGFSKIEQGFYRAIVDNHRVKGPVLITHTPN
FT                   DRAVGLAYPLASRISGDKTMAFGDKDDLFGAMGRNGAQKMEQGEAVEGKLLSVGGPYAF
FT                   KANTYFNLEASDFIKNHNDIKGKEVGYVVRKVVATAGMG"
FT   gene            617543..619396
FT                   /locus_tag="Nmul_A0536"
FT   CDS_pept        617543..619396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0536"
FT                   /product="Ribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73844"
FT                   /db_xref="GOA:Q2YBM7"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM7"
FT                   /protein_id="ABB73844.1"
FT                   /translation="MNVFYEEEGTFKVGAVLADNMTSLQVEAPHGKRAKIKAASVLLRF
FT                   DAPSLTEFMDVAQKKAEDLDPNFLWECCESEVEFASDALAADYFGDRVTPEEAAAVLIR
FT                   LHSAPMYFYKKGRGRYKAAPPKALEAALASQEKKRRQAEQQARYMQSLSEFVLPEEFKP
FT                   SLFNLLYRPEKNSVEWKALDAVCAAMKLSVSQLLQKCGAIPSTHDYHLNRFLLEHFPEG
FT                   TDFDDLGADQLAVLPDLPVADVTAFSIDDVTTTEIDDAFSVTPLTLGSFRIGIHIAVPT
FT                   LGIAPGSPLDKVAEQRVSTVYIPGNKITMLPEPVIQQYTLSEKQLRPAVSMYLDVADDF
FT                   TVTATTTRVEQVKVAANLRHDTLEEQFNESTLAGGNINHPFGRELTALWNFARKMEALR
FT                   GKTNDSNNERIDYNFNLHGDHIVITERRRGSPIDKVVSELMIYVNAEWGRLLADSGVAG
FT                   IYRSQGNGKVRMSTSPAPHQSLGVSQYAWISSPMRRYVDFINQRQLVGLLRGEEPPYTR
FT                   ESESLHMFMRNFESTYEVYGDFQRSMERYWCLRWLLQENVQVTGAQVLKENLVKLDRLP
FT                   LVARVASLPELPSETAVEVEISNIDLLELTFSIKFLRKLQA"
FT   gene            619465..620466
FT                   /locus_tag="Nmul_A0537"
FT   CDS_pept        619465..620466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0537"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73845"
FT                   /db_xref="GOA:Q2YBM6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM6"
FT                   /protein_id="ABB73845.1"
FT                   /translation="MSASPTITTLNTTLREFKPDASYSSPLNRVSRLKTAILVSVILHV
FT                   VVLSGVTFKFPLPQIRAVSAPLEVMLVNREPALPPAAEDRKEALPRVARASPAVKGNAS
FT                   RHPAQPSLPLPKQEDTANIPGETIADSAAAVQEAGPRELRTPPLMAAPENDSHQSADEP
FT                   DPLLAPAQPQIKTGQDQNAIFDTADLVQRGLAIARVAARGDASLETYQKPLKRKFIGSR
FT                   TRDYRFARYAEDWRLKVERIGNLNYPEAAKREQLYGSLQLTVGIRSDGSLESVEINRSS
FT                   GKKILDQAAVRIVKLAGQNGFAPFPPELSRDTDILHITRSWVFTSANELTSE"
FT   gene            620577..621410
FT                   /locus_tag="Nmul_A0538"
FT   CDS_pept        620577..621410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0538"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73846"
FT                   /db_xref="GOA:Q2YBM5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBM5"
FT                   /protein_id="ABB73846.1"
FT                   /translation="MVMSDLYAVIGNPVAHSKSPLIHAGFARQSGQDVRYEAILAPLDG
FT                   FVETVAAFRQRGGKGANVTVPFKLEAHTLSSCLTERAKAAGAVNTLVFGADDILGDNTD
FT                   GAGLVRDVAVNLGYALDDRRVLLMGAGGAARGVIRPLLEHEPAALVIANRTPQKADDLQ
FT                   RLFASSGNVLSAAYEDLRGQEFDLVINATSASLQGDLPPLPKGIFAGASLAYDMMYGKG
FT                   LTSFLQFAQQQGAARLADGIGMLVEQAAESFFLWRGIRPETEPVIGMLRSSLGSP"
FT   gene            621497..622189
FT                   /locus_tag="Nmul_A0539"
FT   CDS_pept        621497..622189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0539"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73847"
FT                   /db_xref="GOA:Q2YBM4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBM4"
FT                   /protein_id="ABB73847.1"
FT                   /translation="MFFKRWFWRIFLFFIAVIFVYQFWIFSQIVYWNYFNPSSSAFMQT
FT                   RLETLREKNTKAALRTRWIPYEQISPHLKRAIIAAEDAKFLEHEGFDFDAIQKAYEKNL
FT                   KKGRLIMGGSTISQQLAKNLFLSGDKTPWRKLQEAFITLMLEKVMSKRRILEIYLNVIE
FT                   WGNVVFGAEAAARHYYGISASSVSREQAARLAAMVPSPRFYDENRNTPWLSKKTRMILG
FT                   RMASASIP"
FT   gene            622407..623843
FT                   /locus_tag="Nmul_A0540"
FT   CDS_pept        622407..623843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0540"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73848"
FT                   /db_xref="GOA:Q2YBM3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM3"
FT                   /protein_id="ABB73848.1"
FT                   /translation="MANNLRETENLQEHLQRVIQLLYEHKLAEGLLPPQPLPEQGLMDG
FT                   LLHGQSLAELQKLLDELHPADVAHILEVMPLEDRLLIWDLVKAERDGEILLEVSDAVRE
FT                   TLIASMERGEMRAAAEQLDADEIADIAPDLPRDVLEDVFQSLPMEEREKLRAAMSYPED
FT                   AVGALMDFDVVTIREDVTLEVVLRYLRRLNELPDQTDLLFVVDRNEYFKGVLPLNRLLV
FT                   SDPAALVSSVMSKETIVFYPDERAQQAAQAFERYDLVTAAVVNAEGKLVGRVTIDAVMD
FT                   FIREESASEALSVGGLSQEEDLFAPIWKSLKNRWTWLAINLVTAFVASRVIGLFEDSIE
FT                   KLVALAALMPIIAGIGGNSGNQTITMIVRALALGQLNGGNARMLISKEIGVSAVNGVVW
FT                   GAVVGGFAYIIYRNISLSLVMMLAMMLNLLLAALMGVLIPLTLHSLGRDPAAGSSVMIT
FT                   AVTDSGGFFIFLGLATLFLL"
FT   gene            complement(623868..625124)
FT                   /locus_tag="Nmul_A0541"
FT   CDS_pept        complement(623868..625124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0541"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73849"
FT                   /db_xref="GOA:Q2YBM2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM2"
FT                   /protein_id="ABB73849.1"
FT                   /translation="MSGFPSFSYRNGHLWAESVQLERIALEFGTPCYAYSRAALTTAYC
FT                   EFDDAFAGRDHLVCYAVKANSNLGILNLLARLGSGFDIVSGGELQRVLKAGGDPQKIVF
FT                   SGVGKQPAEMKAALEAGILCFNVESEAELHGLNRVAGEMGKVAPVSLRVNPDVDAKTHP
FT                   YISTGLKENKFGIPFDEAEALYASAQALGNVRVAGLDCHIGSQLTELAPFIETCKKMLG
FT                   LLDRLEAQGLEIEHLDLGGGLGIRYAGENPPSAREYVEALRSVVGNRRQKILIEPGRSL
FT                   VGNAGVLLTTVEYLKPTPHRDFAIVDAAMNDLMRPALYKAYHEILPVVARNEMDAKTYQ
FT                   VVGPVCETGDFLGHDRHLALAQGDLLAVMSAGAYGMSMSSNYNARPRAAEVMIDGDRIH
FT                   LIRERESVEQLMAGEKILP"
FT   gene            complement(625455..626666)
FT                   /locus_tag="Nmul_A0542"
FT   CDS_pept        complement(625455..626666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0542"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73850"
FT                   /db_xref="GOA:Q2YBM1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM1"
FT                   /protein_id="ABB73850.1"
FT                   /translation="MKILIVDDEYRKVEEIFNVLADAGISCAGVKHETTAQAARILLRR
FT                   QDYDLLIIDLHLPAAIGGKPDNEGGITFLDMIRLDEKVKLPASVLFITGREELIESAYT
FT                   KVIERGAILCQYHSDSDEWKKILIGRAKYDSQRLARDEQVDVVIVTALRNPELDAVLNL
FT                   PYQWIQKRIKDDPLTYHYGKIPRIDSNISVVAVSPNRKGMPSSAAVASKLALMFKPKIL
FT                   LMVGICAGIRDKCSLGDIIVADPTWDWGSGKHGLDSNGSPVFHAAPRQVPLNSALSQVA
FT                   SDLANDESVMNGIRKGWSEEVPGGKLKVHIGPMASGASVIADDRSARLIAIQQHRELIA
FT                   IEMEAYAVMAAAEYTSIPNLTAMIIKSVCDFADAEKNDTWQKYASYTSAAFADQLFRNS
FT                   NISV"
FT   gene            complement(626663..627151)
FT                   /locus_tag="Nmul_A0543"
FT   CDS_pept        complement(626663..627151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0543"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73851"
FT                   /db_xref="GOA:Q2YBM0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBM0"
FT                   /protein_id="ABB73851.1"
FT                   /translation="MRRKTMNILVIEDDEDKSKKIEEFISLEFPAANVQLAKSLNSGLK
FT                   ALIAGSEVLDIVLVDMSMPTYDISQQEPSGGAPESFAGRELLAQMRLRSINVPTIVVTM
FT                   FDSFGETPKRVSLEQLIADLKSRYSPPFKGFVYYNSAQEGWRSALKQLIAESNALARK"
FT   gene            complement(627117..630680)
FT                   /locus_tag="Nmul_A0544"
FT   CDS_pept        complement(627117..630680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL9"
FT                   /protein_id="ABB73852.1"
FT                   /translation="MASSKRIRNPKKIRNKQSARQDRIIGEIASAIRMRGHLEIAKLKI
FT                   QTSVDELFTFFPRIFRQKNALDFVHGPAFPVKPSELFSKPALYQPAGPFNELIWGVCRC
FT                   LQFSEELKDFTHLREEYERSLLRNSKSKCNEILNVIERKFGCSIWLIQNKIAAAQFWEG
FT                   IEEARKLGQLYEDECKDHQLMPWIIRFIGKRIEATGLKGYLKTELLRMFGDYSNPILQS
FT                   YLRAKLFELSHIHTDDVPATLYVEAQSCVIDHYETLVFILQSAARTRAISTGMIPVIEK
FT                   PLVAIFRRTQDIRLAGVLRGLDIVPSTVTVYNKQRAELIELYTKGEYPLMAQNSETYLR
FT                   DFPEDMSIQVMRLKACLQAGISYPDQQGVLKEAFRSLHEVLSLSTNTYSAAFALITLSE
FT                   RFYGHSWVHYLEAVTRYELRPEQAAFPPDPLRDIFIREPHVTPFSAVAANGQAKIKILN
FT                   DEQLKILFPYTRAVYDLVSSGQIDEPLPISEIRKQKYLAVYHLAFGSPIRAAEHFQWLI
FT                   VNTTGVENIRARGGAALALLKLDRISEAVDTTVAAYIENQNVPTLLPIKQVADALKEPA
FT                   DWPRSISTSLLFQLYTLYCGPEKIAQLRYSFELFQVNNRINEPSDLAERIEEFGKPFVI
FT                   AYLRNIWTPEIMRHTILYSGTREIEEARIKVCRILAELDPEGEVVYFDEIKERVKQQEI
FT                   AKGTRLIEQSKVYVEIEAIKKSLKTKLEDSYIRYKSSSQTSVLKPEQSFAKNFITNLGA
FT                   VFAKENSISVPLALSKIQTLNLNLDMGSESDVQFEALFSEVTNEFLRGDHGLNAYLSTT
FT                   IRHGTLSNTLRKPVADERLITSREEGSKSYIRNQYWGHGEKGYSEYQAEWQLILDALDT
FT                   FSSEFDSVIEYLKDELIQIRIVHELKDSGENKNALFVYRSSQWERKFVQEQDKAFTNMD
FT                   EFVNYYVDILWEKTDLNLRNVQYVLDTDIRARLMEPFVKLTNHLNRVPAPGINDLLNAV
FT                   GRAKTNVQNQLGLVISWFKRSEVYDRQDCAADFPFHIALNMVKNTMFNATGWNGASVSL
FT                   SRDTPLMPGRTLDGMVYVFHVLLENAVLRSGLEMDELTVKAELSFSNGVFNARISNNLA
FT                   PAKVTQAERDKLSKLRDSLRSDESPRRAQREGRSGLHKIWRTINSPIYKEPKLDFYHLE
FT                   DSFVVEVNFKLEKKDHEYLGH"
FT   gene            complement(630830..631699)
FT                   /locus_tag="Nmul_A0545"
FT   CDS_pept        complement(630830..631699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0545"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73853"
FT                   /db_xref="GOA:Q2YBL8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL8"
FT                   /protein_id="ABB73853.1"
FT                   /translation="MRYRMIERCRDAFPIRLMCRCLHVSTSGYYDWRDRPLSQRAHDDR
FT                   RLLERIRKIHDGSDGVMGSPRVWKELRYEGEACGLNRIARLMRQQRLYGIPQRKRWHKK
FT                   VCGLRPENVHNHLQRDFTASEPNSRWVTDITYVRTQESWLYLCVVVDLYSGIVVGWSMS
FT                   HCQDPQLVLQAVLMALWQREAKTPVILHSDRGCQFTSDEYQRFLQGHNLICSMSAVGSC
FT                   ADNAPAESFFGLLKRERVYRRQYRTRAEARTDIFDYIERFHNPRKRRQLEMRQKQDLGL
FT                   TKPSGEMG"
FT   gene            complement(631696..631983)
FT                   /locus_tag="Nmul_A0546"
FT   CDS_pept        complement(631696..631983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0546"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73854"
FT                   /db_xref="GOA:Q2Y9H2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Y9H2"
FT                   /protein_id="ABB73854.1"
FT                   /translation="MATRRKYAAEFKQEAVQLVRSGNVPASRIARDLGIDPNMLSRWCR
FT                   EMGSVGNKAFQGQGRPRDEEMAALKRELIQVRKERDFLKEAAALFAKASK"
FT   gene            complement(632096..632752)
FT                   /locus_tag="Nmul_A0547"
FT   CDS_pept        complement(632096..632752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0547"
FT                   /product="Protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73855"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL6"
FT                   /protein_id="ABB73855.1"
FT                   /translation="MRCRRKTIGMRVSSEGLTVRIPMRESLSWVESVLQKRADWIVTKL
FT                   DEWKNRKPTRPAWEEGAIFPLLGEPWQVTVTAAGAVQMMQASENARSKDEQPGLSLSAG
FT                   VAAEQIESAVMKWYRQHALTCFTERIALYANKLGVALPQLRLSSARTLWGSCNSRGIIR
FT                   LNWRLVQKPLDLVDYVVAHELSHLIEMNHSKAFWETVGSVYPGYATARKRLKEIG"
FT   gene            complement(632769..633620)
FT                   /locus_tag="Nmul_A0548"
FT   CDS_pept        complement(632769..633620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0548"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73856"
FT                   /db_xref="GOA:Q2YBL5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL5"
FT                   /protein_id="ABB73856.1"
FT                   /translation="MNWIPVVLRSTLYALLQLIITPFYFLIVFAAFPLSRLNRYRITSG
FT                   WAHLMLFLLTAVCGIRYRVLGKENILPTPSIILSKHQSAWETIAFQQIFPPQVWVLKKE
FT                   LLLVPFFGWGLAMTNPIAIDRSSRKAALKQIVEQGKDRLRQGFCIVIFPEGTRIAPGKR
FT                   GKYGIGGAWLGTHTGAPVIPVAHNAGRFWGKNAFIKRPGTITVSIGAPIDPSDMEPGEL
FT                   NAKVEAWIEAEVARIDNLHPDENPNPDQTQEEPRREEDCLPKDENEQTRGKRTAPYKPE
FT                   RQ"
FT   gene            complement(633617..634150)
FT                   /locus_tag="Nmul_A0549"
FT   CDS_pept        complement(633617..634150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0549"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73857"
FT                   /db_xref="GOA:Q2YBL4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL4"
FT                   /protein_id="ABB73857.1"
FT                   /translation="MKLVILDRDGVINYDSAAFIKTPDEWKPIPRSLEAIAHLTQAGYR
FT                   VVVATNQSGIGRGLLDMVSFNAINDKMCKAAVQAGGRIDAIFFCPHAHTDNCDCRKPAT
FT                   GMFKEISERFGLDLKGVPAIGDSLRDLQCAAAVGALPVLVLTGKGKKTEAEDDLPENTK
FT                   IFADLSAAVNALTQ"
FT   gene            complement(634166..636385)
FT                   /locus_tag="Nmul_A0550"
FT   CDS_pept        complement(634166..636385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0550"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73858"
FT                   /db_xref="GOA:Q2YBL3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL3"
FT                   /protein_id="ABB73858.1"
FT                   /translation="MTEATQATQGLATRNLLVELLVEELPPKSLKKLGESFAQGIAAGL
FT                   KRQGLAREDAAATPFASPRRLAVHLTCVAAQAPDTSSLKKLMPVAVGLDENGQPTPALL
FT                   KKLRSLCGDADPVPFLSQLKRAHDGKTETLFLDSVVKGATLAEGLQTALAGTLEKLPIA
FT                   RMMTYQLADGWNTINFVRPAHALVALHGKEVVDVSILGLTAGRETQGHRFEAMTSPLIV
FT                   KDADSYEHQLQEEGAVIASFSHRRAEIERQLLAAARKEDLKLTRYDALLDEVAALVERP
FT                   RVLTGEFETGFLDVPQECLILTMQANQKYFPLLDARGQLSHRFLIVSNIRPVDARSVIA
FT                   GNERVLRSRLADAKFFFDQDRRKTLASRVEGLQRVVYHNKLGTQAERVERIWAIAQTIG
FT                   LQLGGNELAARAGEAAMLAKADLLTDMVGEFPELQGIMGRYYAKHDGVAEEVADAIEDH
FT                   YKPRFAGDELPRNAVGVCVALADKLETLVGLFGIGQIPTGDKDPFALRRHALGVIRILI
FT                   EKEVPLALNILLEQTADIFGQRIKGSAETIAKTATETLEGFIYERLKHYFSAEAIEGQI
FT                   TGFGRSPNEDRSTFSPQQIDAVLALRPQLLNDVKKRLLAVRAFAALPEAESLAATNKRV
FT                   GNILRKAEVDAGGEIDTDLLQTPAEQALHQALDRIIPEADAAFAAGDYTASLQALAALK
FT                   VPVDQFFDTVMVNTEDAALRHNRLALLAQMQKIMNRIADISRLAL"
FT   gene            complement(636382..637287)
FT                   /locus_tag="Nmul_A0551"
FT   CDS_pept        complement(636382..637287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0551"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73859"
FT                   /db_xref="GOA:Q2YBL2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBL2"
FT                   /protein_id="ABB73859.1"
FT                   /translation="MRTFQEIILALQHYWTRQGCALLQPYDMEVGAGTSHTATFLRALG
FT                   PEPWKAAYVQPTRRPKDGRYGENPNRLQHYYQFQAVLKPAPSDILELYLGSLEELGFDL
FT                   RQNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGMNCKPITGEITYGLE
FT                   RLAMYLQGVDNVFDLTWTKGLSYRDVYHQNEVEQSFYNFGHSDLDFLFQAFASHEAQAR
FT                   HLVEQGLPLPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRELARSVAHAYYESRK
FT                   RLGFPLAPVEWTQELLEKAA"
FT   gene            complement(637377..638879)
FT                   /locus_tag="Nmul_A0552"
FT   CDS_pept        complement(637377..638879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0552"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73860"
FT                   /db_xref="GOA:Q2YBL1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL1"
FT                   /protein_id="ABB73860.1"
FT                   /translation="MNKIIRSELLVCFLLGALTVPGFAPFYLFPIPLATLALLCHFWRN
FT                   SARPRTAGLLGFSFGMGMFSAGVTWLYISLHDFGAMPMPVAVLALIFLCSYLALFPAMT
FT                   GWTLRKLDIASPIVWALTAGALWALSDWLRSVLFTGFPWLTLGYSQAPLSPLAGFAPII
FT                   GVYGISLLVVLSAALLCLLVRKEFRKPLHFLPLLTLWLAGEGLQQIHWTEPEGEPVTVS
FT                   LLQGNIPQDMKWREDQLISSMENYARLVLQSDSRLIITPEISIPLYRNEVSPVYLAHLA
FT                   AHAKRNNGDVLVGLVEAAGGRSEYYNSMFSFGTSPEQSYRKYHLVPFGEFIPLKPVFGW
FT                   IINVLKIPLSDFSRGALGQQPMNIAGQRVAVNICYEDVFGEEIIQQLPQATLLANVSND
FT                   AWFGRSIGPRQHLQISQMRALETGRYMVRATNTGVTAIINERGRVLQEAEIFTTTALHG
FT                   TAQGFAGATPYVRFGNSLILGLCGILLGLAVLSAFRETRKKR"
FT   gene            complement(639118..640305)
FT                   /locus_tag="Nmul_A0553"
FT   CDS_pept        complement(639118..640305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0553"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73861"
FT                   /db_xref="GOA:Q2YBL0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBL0"
FT                   /protein_id="ABB73861.1"
FT                   /translation="MSTADPTLDLLAYHAFPHLASALRARKDAILREWEKSVASTLPAA
FT                   DALTLRNLRDSVPLILEEVIEAFSSSHPVTTQALVEGSGLHGESRFQENYNIRELVVEY
FT                   QLLRRVMIEQISEELNGELDETSNVALNMAVDAALQSGTVIFVENLQRQLKSATEIQSK
FT                   YLSFLSHDLRNHLSQITLYIQILAMKLAKIPELADNVADLELVRSIILKTTAGMDRLLQ
FT                   SEQLRKGYFHLAMEVVDLNSLLSQAVRQVTPEAEMKGIELSIDVPEGAKVLSEEALLVP
FT                   ILQNLLGNAVKYSSGGRIEVTARHNAREDSAWILSVSDQGPGIAPENLTHLFDAFQRAD
FT                   TYGKPGIGLGLSIASEATRLLGGKLEVDSVVGVGSTFRLLLPRQIPEDEVSDPGG"
FT   gene            640663..642036
FT                   /locus_tag="Nmul_A0554"
FT   CDS_pept        640663..642036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0554"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73862"
FT                   /db_xref="GOA:Q2YBK9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBK9"
FT                   /protein_id="ABB73862.1"
FT                   /translation="MPGNKQTWARKKNRLHWLLYEGLEIVSNSQAFTLTRKTLRGLILL
FT                   SSIPLFGMVAAFGIAPDTAVEDVPVEQVVLGLEIPEIRSRPAEGMTFWRHERIQQGDTI
FT                   GSLLSRLEVNNQDVARLIRDTSELKALHPLAAGRMVHAETSAAGELLLLRYFPGGSDQV
FT                   VLEKRDGSYVVSDRPALLETHIQMKSGVIESSLFAAIDRAGIPDSIASQIVDILSSQID
FT                   FHRDLRKGDRFTVVYDSLYGNGEPTRAGRVLAVEFVNQGVPYRGVYFPGSDGGEGGYYT
FT                   PDGKNLRRVFLRSPLEFSRISSGFSSGRFHPILKKWRAHKGIDYVAPTGTGVKAVADGV
FT                   VAVAGWEAGYGNFIILEHEGSYATVYGHLSAFAKGLRKGQRVRQGYVIGRVGATGLASG
FT                   PHLHFEFRVNGIQRDPLKEPMPEGKPIAPAHLAAFYESTKSSMARLDMLHGTNLALLD"
FT   gene            642089..643189
FT                   /locus_tag="Nmul_A0555"
FT   CDS_pept        642089..643189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0555"
FT                   /product="Protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73863"
FT                   /db_xref="GOA:Q2YBK8"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBK8"
FT                   /protein_id="ABB73863.1"
FT                   /translation="MKAAYYIGIMSGTSLDGIDAVLADFEAPRPVLLDNFYLPYPEKLR
FT                   EQLKALHFPAHGELHRAATLGNQLARHYAEAVGGLLRKSGVAPPEVAAIGCHGQTIRHC
FT                   PQAEAGYTIQLCNSPLLVELTGIRVVSDFRSRDIAAGGQGAPLVPAFHQALFADPHVHR
FT                   VIVNIGGISNLTDLPRNGSVTGFDCGPGNAMMDEWCARHTGQAYDEEGRWAATGKTLSV
FT                   LLEKLLALPFFSLPPPKSVSRELFSTTWLEGYLKGDESPADVQATLLELTVAGIARCIL
FT                   GYCGDATEIYVCGGGARNSYLIASLQEALSGRKVGLTDSLGVDADWLEAFAFAWLARQL
FT                   IQGIPGNIPSVTGAKGPRLLGAIYPA"
FT   gene            complement(643277..643618)
FT                   /locus_tag="Nmul_A0556"
FT   CDS_pept        complement(643277..643618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0556"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73864"
FT                   /db_xref="GOA:Q2YBK7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBK7"
FT                   /protein_id="ABB73864.1"
FT                   /translation="MTDIPTPLIFTDNAANKVRELIEEEGNNDLKLRVFVAGGGCSGFK
FT                   YGFTFDELISEDDTVMEKNGVKLLVDAMSFQYLAGAEIDYQENAEGAQFIIKNPGAAST
FT                   CGCGSSFSV"
FT   gene            complement(643697..644122)
FT                   /locus_tag="Nmul_A0557"
FT   CDS_pept        complement(643697..644122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0557"
FT                   /product="Protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73865"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBK6"
FT                   /protein_id="ABB73865.1"
FT                   /translation="MFEKIGRPHNQIDSLIGVDTHIEGNIIFSGGVRIDGRVTGNITGF
FT                   SDLPSTLVLSDQAVVEGVIHVSHAVINGTVVGTIKVTEYVELQPKAKVCGDVHYKGMEI
FT                   HLGASVQGMLLHTEILERESNVVTLLPAAQINDLKHV"
FT   gene            complement(644132..644908)
FT                   /locus_tag="Nmul_A0558"
FT   CDS_pept        complement(644132..644908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73866"
FT                   /db_xref="GOA:Q2YBK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBK5"
FT                   /protein_id="ABB73866.1"
FT                   /translation="MIKSRNKRHKMAAAPAAVRLQTPAHVRWATLAILLVAALILSWSM
FT                   YDAGRKAGIPDRIEPPREEKTETGPEMERLSQLNARLQQENDELRIKMAGLDQQLQMDQ
FT                   AARLDIASQVKTLQGENTRLKEELAFFQNLGSASGKAGQRISIGGLKLEKGKLPGEYRY
FT                   SLLLVQSGVRGKDFHGNLELAVNFQQNGEKMVQPLTSSETSDDSSKKLDVSFRFYRRVE
FT                   STFWLAPDAIVDSLQVKVFEKGETQARLMQTVNLSL"
FT   sig_peptide     complement(644828..644908)
FT                   /locus_tag="Nmul_A0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.913 at
FT                   residue 27"
FT   gene            complement(645222..646250)
FT                   /locus_tag="Nmul_A0559"
FT   CDS_pept        complement(645222..646250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0559"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73867"
FT                   /db_xref="GOA:Q2YBK4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBK4"
FT                   /protein_id="ABB73867.1"
FT                   /translation="MLKIGIVGGTGYTGVELLRILSQHPEVNIEAITSRKEAGMDVAQL
FT                   FPSLRGRIELKFSDPAEANLEKCDVVFFATPNGIAMKQVPSLLDAGVRIIDLAADFRIK
FT                   DIAVWEKWYGMPHACPELVAEAVYGLPEINRDRIKTARLIANPGCYPTAVQLGFLPLVE
FT                   SGAADLDHLVADAKSGVSGAGRNAEIHTLFAEAADNFKAYGVSGHRHLPEIRQGLSQAA
FT                   KHPVGLTFVPHLTPMIRGIHATLYVKLLKEVDLQALYENRYVNEPFVDVLPAGSHPETR
FT                   SVRGSNLCRIAVHRPQGGDTAVILSVTDNLVKGAAGQAVQNMNLMFGLPETLAITHLPL
FT                   FP"
FT   gene            complement(646423..646815)
FT                   /locus_tag="Nmul_A0560"
FT   CDS_pept        complement(646423..646815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0560"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73868"
FT                   /db_xref="GOA:Q2YBK3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBK3"
FT                   /protein_id="ABB73868.1"
FT                   /translation="MNGTYSYGTGRRKSAVARVFIKPGSGVITVNNKPVDEFFSRETGR
FT                   MVVRQPLELTGNLDRFDILVNIHGGGESGQAGAVRHGITRALIDFDATLKPVLSNAGLV
FT                   TRDAREVERKKVGLRKARRRKQFSKR"
FT   gene            complement(646818..647252)
FT                   /locus_tag="Nmul_A0561"
FT   CDS_pept        complement(646818..647252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0561"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73869"
FT                   /db_xref="GOA:Q2YBK2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBK2"
FT                   /protein_id="ABB73869.1"
FT                   /translation="MKTFSAKPHEVNREWFVIDAAGKVLGRLAAEIAHRLRGKHKPIYT
FT                   PHVDTGDFIVVINVDKMRVTGNKAESKMYYRHSGYPGGIYETSFAKMHARFPGRPLEKA
FT                   VKGMLPKGPLGYAMLKKLKIYAGAAHPHAAQQPRQLEVRA"
FT   gene            647597..648469
FT                   /locus_tag="Nmul_A0562"
FT   CDS_pept        647597..648469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0562"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73870"
FT                   /db_xref="GOA:Q2YBK1"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBK1"
FT                   /protein_id="ABB73870.1"
FT                   /translation="MSQKHPVIAVTGSSGAGTSTVKNSFEHIFRREKLTAAVVEGDSFH
FT                   RYDRDAMKKAVAESEKDGGRPISHFGPEANEFEKLETLFKEYGETGGGETRLYLHNDEE
FT                   AAPYQQKAGTFTPWASIKPGSDLLFYEGLHGGVQSDTVDVARYVDLLVGVVPIVNLEWI
FT                   QKIHRDMNARGYSAEAVTHTILRRMHDYVHYITPQFSKTHINFQRVPTVDTSNPFIARD
FT                   IPTLDESFVVIRFRDPRNVDFPYLLAMIHNSFISRPNTIVVPGGKMGLAIELILTPLIL
FT                   DLVVASRKK"
FT   gene            648673..650904
FT                   /locus_tag="Nmul_A0563"
FT   CDS_pept        648673..650904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0563"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73871"
FT                   /db_xref="GOA:Q2YBK0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBK0"
FT                   /protein_id="ABB73871.1"
FT                   /translation="MSSLLTALNPEQLEAVTLPHQSALVLAGAGSGKTKVLTTRIAYLI
FT                   QSGEVSPHGILAVTFTNKAAKEMLTRIAAMLPINTRGMWIGTFHGLCNRLLRAHHQDAG
FT                   LPQTFQILDSADQLAVIKRILKNLGADDEKFPPRQVQWFINNAKEEGLRASQVEAYDDY
FT                   TRKMVEFYASYEHQCNKEGVVDFAELLLRSYELLMRNEIVREHYRSRFLHILVDEFQDT
FT                   SRLQYKWLRLLAGPKTAVFAVGDDDQSIYAFRGANTGNMREFEQDFRIPRIIKLEQNYR
FT                   SHGNILDAANTLIRNNNGRLGKNLWTSEGRGEPIRVYNAPTDFDEAAFIVDEVKSLRAE
FT                   GVQLSQIALLYRSNAQSRVLEHALFNASLPYRVYGGMRFFERQEIKHALAYLRMIANPE
FT                   DDNALLRIVNFPARGIGLRSLEQLQDEVRQQGGSLWEAMLKKCRGREPATSGLLNKSSA
FT                   GVGENKEPDRPRRGIEGFVALIESMRQVCETLPLPEIVEHMLEHSGLIRHYQAEREGAD
FT                   RLENLNELVTAATAFVHEAEDDGLAVFLNHASLEAGEHQAGGGEDALQLMTVHSAKGLE
FT                   FHSVFLSGLEEGLFPHDNSRNEAGGLEEERRLMYVAVTRAKRRLYLSFAQSRMLHGQTR
FT                   YNIPTRFIEEIPQGVLKWLQPVQKTAPWRPAPLSPTQEVAQRPQIREMGVREATASPWR
FT                   VGQNVVHAKFGAGVIVNCEGRGADARVEVKFGRNGSKWLLLEYAKLTAL"
FT   gene            complement(650989..651726)
FT                   /locus_tag="Nmul_A0564"
FT   CDS_pept        complement(650989..651726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0564"
FT                   /product="possible transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73872"
FT                   /db_xref="GOA:Q2YBJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBJ9"
FT                   /protein_id="ABB73872.1"
FT                   /translation="MNIRQVDGRRGWEWIAEGFQLFRRVPMVWILLCTTLLLIAATLGL
FT                   IPTAGQFIFTLLSPVFLAGLMIGCRTLEHGGQLEIGHLFAGFRNPGPLITIGGIYLVGQ
FT                   VLIVGIFMLVGGDVLMSLLLEGKRVDENELKNVSGDMLSASLVALTLSIPLLMATWFAP
FT                   LLAVFDEMPPVEAMRTSFFACVKNIVAFQIYLIVLVAFTIIAMIPYGLGLFVLVPTVFA
FT                   SIYTSYMDIFQVGANSGDVSESA"
FT   gene            complement(651780..652730)
FT                   /locus_tag="Nmul_A0565"
FT   CDS_pept        complement(651780..652730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0565"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73873"
FT                   /db_xref="GOA:Q2YBJ8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBJ8"
FT                   /protein_id="ABB73873.1"
FT                   /translation="MSVFTIVTHEQLSAWLRNYSIGKLVNLQGISSGIENTNYFVTTSH
FT                   GKYVLTLFEKLTSAELPYYLNLMAYLARHGLPCPSPVADLANKFLGELNGKPASIVTCL
FT                   PGKSQESPTATHCAEVGELLANMHLSGLSYPEKMENLRGPRWWKAAAQEVMPFLSEDEA
FT                   AILGEELRFQSSHRTESLPRGVIHADLFRDNVLFKDGAMGGVIDFYFACNDVLLYDLAI
FT                   TANDWCLNENAELDPERTLSLLEAYHRTRPLLEIERDAWPVMLRAGALRFWLSRLQDYH
FT                   LPRAGELTHVKDPAHFMRILQSHAAARSKLAEVWI"
FT   gene            complement(652788..653153)
FT                   /locus_tag="Nmul_A0566"
FT   CDS_pept        complement(652788..653153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73874"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBJ7"
FT                   /protein_id="ABB73874.1"
FT                   /translation="MRRIVVALLLSSVLPAAAQSNQPKDLRPIPEVPEPPELSLPSTGI
FT                   EDEEESLEPQVTITKRGEDQIEEYRLNGRLYMIKVIPRIGLPYYLIDNRGDGTFSTHDT
FT                   GGLDQRIRPPMWVIREF"
FT   sig_peptide     complement(653097..653153)
FT                   /locus_tag="Nmul_A0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.575 at
FT                   residue 19"
FT   gene            complement(653209..653937)
FT                   /locus_tag="Nmul_A0567"
FT   CDS_pept        complement(653209..653937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73875"
FT                   /db_xref="GOA:Q2YBJ6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBJ6"
FT                   /protein_id="ABB73875.1"
FT                   /translation="MSLKNKAARTMTNDFQEKAWSGRESWRVFGIMAEFVEATERLHSV
FT                   MPAVSIFGSARTLPDHPYYELTEQIARQLSDAGFSVISGGGPGIMEAANKGAYYGESPS
FT                   IGLNIQLPHEQHRNVYQDVSQTFRHFFARKYMFVKLATAYVVLPGGFGTLDELMEALTL
FT                   VQTGKTRRMPIILVRSDFWRGMLEWLQNVLVAEGMIAPEDMDLIQVIDEPAEVVDAIFK
FT                   YYETRGFEPSVAEREIQLNL"
FT   gene            653959..656676
FT                   /locus_tag="Nmul_A0568"
FT   CDS_pept        653959..656676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0568"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73876"
FT                   /db_xref="GOA:Q2YBJ5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBJ5"
FT                   /protein_id="ABB73876.1"
FT                   /translation="MKTLLLVDGSSYLYRAFHALPDFRNRNNEPTGAVYGVLNMLRRLH
FT                   KDYQADYSACVFDAKGKTFRDELYAEYKANRPPMPDELAAQIAPLLECINAMGWPMLSV
FT                   EGVEADDVIGTLVKQAEGENMRCIISTGDKDIAQLVNPQVTLVNTMTNEMLDEAGVLGR
FT                   FGVPPERMLDYLALVGDAVDNIPGVAKVGPKTAVKWLNQYGTLDNLLVHAGEIGGVVGE
FT                   NLRNALGWLSRSRQLLSIKCDVSLPVSLHDLGPQPPDMVKLAELYERLDFKSWLRELQQ
FT                   ESQAEGAADALSRGFAPAGSNLVQADYQTILTPEQLDEWMMRIAAAPLASLDTETTGLD
FT                   PMRAELVGISFSVEPHHGAYIPLGHRYTGVPRQLPLDFVLEKLKPWLTDPSAPKLGQNL
FT                   KFDRHVFANHGIGLKGIVHDTLLQSYVFESHRPHDMDNLALRHLGIKTITYDEVTGKGA
FT                   ARIGFEQVDIERAAQYAAEDADVTLQLHQHLYAEVGKDAKLDHIYRTLEMPVMDVLFEM
FT                   ERNGVLLDIKLLETQSRELGEKMLALEERACTIAGLPFNLNSPKQIQEILFDRLKLPVM
FT                   KKTPSGVPSTDEDVLQKLALDYPLARALLDYRGLAKLKSTYTDKLPRMVHPVTGRVHTN
FT                   YAQAVAVTGRLASNEPNLQNIPIRTAEGRRIREAFIAPSGYRIISADYSQIELRIMAHI
FT                   SQDAGLLKAFAQGEDIHRATGSEIFGVPLETVNSEQRRYAKIINFGLIYGMSEFGLATQ
FT                   LGIERAAARTYMDRYFSRYPGVADYMQRTRKTARENRYVETVFGRRLWLSEINSSNGMR
FT                   RQAAERAAINAPMQGTAADIIKLAMIEVHDWLRRHELRSKLVMQVHDELVLEVPENEIE
FT                   TIKRELPLLMGNVAQLQVPLLVEVGVGPNWEQAH"
FT   gene            656785..657048
FT                   /locus_tag="Nmul_A0569"
FT   CDS_pept        656785..657048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0569"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73877"
FT                   /db_xref="GOA:Q2YBJ4"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBJ4"
FT                   /protein_id="ABB73877.1"
FT                   /translation="MVIIRLARGGAKKRPFFNMVVADSRNARDGKFIERVGFYNPRAAE
FT                   GEESLRVKLDRVTYWQSKGAQPSDTVKKLIKQFDSRQEVAGS"
FT   gene            657071..657577
FT                   /locus_tag="Nmul_A0570"
FT   CDS_pept        657071..657577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0570"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73878"
FT                   /db_xref="GOA:Q2YBJ3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBJ3"
FT                   /protein_id="ABB73878.1"
FT                   /translation="MVIMGRVAGPYAVAGWIKVFPYTEYVDGLLDYPDWWLGSEGGKWH
FT                   KFKVIEGEVHGSVLLASLEQCADRDAAARLKGLKIAIPRRLLPALPESGEEGYYWSDLI
FT                   GLAVINLQGEVLGKVAGLLETGANDVLQVQNPEETERLIPFIDQVIIKVDLAAGRITVD
FT                   WGLDY"
FT   gene            657580..658350
FT                   /locus_tag="Nmul_A0571"
FT   CDS_pept        657580..658350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0571"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73879"
FT                   /db_xref="GOA:Q2YBJ2"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBJ2"
FT                   /protein_id="ABB73879.1"
FT                   /translation="MTFDFDVITLFPEMFNAVTRYGVTGRANENAIYRLYTWNPREFTE
FT                   DNYRRVDDRPYGGGPGMVMLAEPLEKAITAARERQRACGIGSTKVVYLSPQGRPLNQNV
FT                   VMELSELSALVLLAGRYEGVDERLIERQVDYEISIGDYVVSGGELASMVLMDCVVRQLP
FT                   GVLGDPESANQDSFTAGLLDFPHYTRPEVYRGSVVPEVLLSGNHARIERWRLQQSLGRT
FT                   WLRRPDLLALKMEKGLTAEERKLLEEFQHAYEAN"
FT   gene            658405..658812
FT                   /locus_tag="Nmul_A0572"
FT   CDS_pept        658405..658812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0572"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73880"
FT                   /db_xref="GOA:Q2YBJ1"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBJ1"
FT                   /protein_id="ABB73880.1"
FT                   /translation="MNLIEQLESEEISRLGKTIPDFAPGDTVVVNVKVVEGDRKRIQAY
FT                   EGTVIAKRNRGLNSAFTVRKVSSGEGVERTFQTYSPLIASIEIKRRGAVRRAKLYYLRD
FT                   RSGKSARIREKLPARASARKAENGTQKTEQA"
FT   gene            complement(659152..659742)
FT                   /locus_tag="Nmul_A0573"
FT   CDS_pept        complement(659152..659742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0573"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73881"
FT                   /db_xref="GOA:Q2YBJ0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBJ0"
FT                   /protein_id="ABB73881.1"
FT                   /translation="MNMRLLLLASITMGLLAGCGEPKQLAPSSATTPSGTETASPETPP
FT                   ESSAPPAAEAGTVPAEPTPPAAAKVEPPKNLAARKLAPERIKRGEEIYRKNCASCHGPN
FT                   GEATPGWRTPGPDGRYPPPPLDGSAHAWHHSTETLEKMIQDGSVDGAMPAWKGKLTNQQ
FT                   IGDVIVWIKSLWPDEVYDIWHKEIENKPQPKQN"
FT   sig_peptide     complement(659680..659742)
FT                   /locus_tag="Nmul_A0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.489 at
FT                   residue 21"
FT   gene            complement(659862..660335)
FT                   /locus_tag="Nmul_A0574"
FT   CDS_pept        complement(659862..660335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0574"
FT                   /product="Protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73882"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI9"
FT                   /protein_id="ABB73882.1"
FT                   /translation="MKISRHAVLAGIMFAAFAGGAHASATVDVYKSSTCKCCAKWVDHM
FT                   RANGFTVNTHDVGNKEAREQAGIAPALGSCHTALVDGYAIEGHVPAQDVKRLLRERPRA
FT                   LGLTAPGMPHGSPGMEGERNDPYDVLLINKQGETSIYSRHLPSDPKTSVMRLK"
FT   sig_peptide     complement(660264..660335)
FT                   /locus_tag="Nmul_A0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            complement(660332..660796)
FT                   /locus_tag="Nmul_A0575"
FT   CDS_pept        complement(660332..660796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0575"
FT                   /product="Blue (type 1) copper domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73883"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI8"
FT                   /protein_id="ABB73883.1"
FT                   /translation="MKKFLIASALSLGLVSIDTLAQEDTEALGKPGDSSQVSRTVEITA
FT                   VDNRFKPDAIKVKQGETIKFLITNLGKKKHEMMIGTAEEIDKHGKMLKKHPDHAHPDQP
FT                   DMVSVEPGQTGELVWHFTEAGTVNFACPLPGHFKGMNFPGMKGTITVGAK"
FT   sig_peptide     complement(660731..660796)
FT                   /locus_tag="Nmul_A0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            complement(660972..661943)
FT                   /locus_tag="Nmul_A0576"
FT   CDS_pept        complement(660972..661943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0576"
FT                   /product="Mg2+ transporter protein, CorA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73884"
FT                   /db_xref="GOA:Q2YBI7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI7"
FT                   /protein_id="ABB73884.1"
FT                   /translation="MIRSVVKDNHSLCIIHGLPRREGDEHVVWLEINAPTPEDIVCLKQ
FT                   RFGIDTTRQAGSVFDDGTFMYMRAKLLRLGSNGTPSFGDVTFMLGEQLVAILCQDPDFH
FT                   PFDTALQRMNRRPSHGRNPKSVLRLLLQVANDSADTVIDRLADELERSAEEISEISDGY
FT                   NAQGRELGVPDLIETMQDLNEREDIISRCLEAQLSLARTVRYLSGEIDNVTEAELQVLT
FT                   TELAEDVAGVKEHAYFEHEKVRYLQNAVTNILNIKQNQIVKVFTIITAVFLPPTLVGTF
FT                   YGMNFAVMPELAWEYGFIYSMGLTVSAALLPLIYIKRKGWLR"
FT   gene            662571..663152
FT                   /locus_tag="Nmul_A0577"
FT   CDS_pept        662571..663152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0577"
FT                   /product="Protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73885"
FT                   /db_xref="GOA:Q2YBI6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI6"
FT                   /protein_id="ABB73885.1"
FT                   /translation="MEAFLVSAGVVALAEIGDKTQLLAFILAAKFRQPVPIVLGILVAT
FT                   LLNHAFAAAIGSWILTQLGPGTLNWILGLLFIGMAIWTLIPDQFDETQSGTGGDSAGVF
FT                   SATLLAFFLAEMGDKTQVATAALAAQYRMFSAVVAGTTLGMMIANVPAVYLGERLANRI
FT                   PPRLVRGIAAAVFALIGITVLLEASKNLAL"
FT   gene            663194..664417
FT                   /locus_tag="Nmul_A0578"
FT   CDS_pept        663194..664417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73886"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI5"
FT                   /protein_id="ABB73886.1"
FT                   /translation="MAFFPTGYAGILPQLPCLLPLLLLFLLGGCASPIALNRAVDAYDD
FT                   ATTGAASRQLLVNIARAYHNQPVHFTGVSNVAATFDFRVSAGATPALTGNAGGILMPVF
FT                   GGSVAENPTITIVPVEGEEFTRRLLTPFQENKLTLLLRQRFDVDLLMRLMAQEVRVNDN
FT                   EGRQASYRNRPFDSPGYGMFRRVVLHLSAIQDHNHLHAEPLILEQTWTIPAGSVTAEGF
FT                   QALQKEFSVRYDARENTYILVKQAAGPILITNYDPNILSPEERKRLSNEAREWSPNDVA
FT                   FDIRPNHFGGEWPMKGIFRLRSFHAILNFLGRSLGDEPEYHVEKDIRTPPLEDDENPVD
FT                   TMELLVTDSAPGEADLWVRVYDQYYSVHTRGPLARWNRSAFQLLYLLFQMTVTDLPRSG
FT                   VPSITIAK"
FT   gene            complement(664492..664809)
FT                   /locus_tag="Nmul_A0579"
FT   CDS_pept        complement(664492..664809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0579"
FT                   /product="Protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73887"
FT                   /db_xref="GOA:Q2YBI4"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI4"
FT                   /protein_id="ABB73887.1"
FT                   /translation="MTITSSNGWYRSDDTGKRLILTLHIQPGARRTEVVGSHGDALKIK
FT                   LAAPPVEGAANVALLAFLAGVFGVPQRQVILRQGARSRRKIVEIDGTACGADTLLKQTA
FT                   S"
FT   gene            complement(664812..665396)
FT                   /locus_tag="Nmul_A0580"
FT   CDS_pept        complement(664812..665396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0580"
FT                   /product="Protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73888"
FT                   /db_xref="GOA:Q2YBI3"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI3"
FT                   /protein_id="ABB73888.1"
FT                   /translation="MISQMLIFLLDTLLGLFSLALLLRFYMQLVRAPYGNPLSSFLIAI
FT                   TDFLVKPARRVIPGYRGMDLSTLLLAWIAQVMLLGSVLMLKGYSLSFSSGSTIGGVAGG
FT                   LALLGLVEIIKTTLYIIMVAVIIQAVLSWVNPYNSLAPLLDSFTRPFLGVIRERIPPIG
FT                   NIDLSPLFVLIVIQLLLFVTAGMEREISRLF"
FT   gene            complement(665449..666264)
FT                   /locus_tag="Nmul_A0581"
FT   CDS_pept        complement(665449..666264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0581"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73889"
FT                   /db_xref="GOA:Q2YBI2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI2"
FT                   /protein_id="ABB73889.1"
FT                   /translation="MNITFIGGGNMACALIGGLLQQDYSPAQIRVVEINAETRERLRHE
FT                   FGVGTVAELARGMIEEREIIVLAVKPQQLSIVARALAPLLERNLVISIAAGIRANALSQ
FT                   WLGGYLRIVRAMPNTPALIGSAVTGLYAMAGVNDEEKREAETILRAVGTVLWVESEELL
FT                   DAVTATSGSGPAYVFYFIEAMQKAGQELGLDADQARKLSIETFLGAARLANESMDEASV
FT                   LRARVTSPGGTTERAIRSLENDDVKIGIIRAIRTAYQRSREMGDELGRT"
FT   gene            complement(666278..667096)
FT                   /locus_tag="Nmul_A0582"
FT   CDS_pept        complement(666278..667096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0582"
FT                   /product="Formamidopyrimidine-DNA glycosylase /
FT                   DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73890"
FT                   /db_xref="GOA:Q2YBI1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBI1"
FT                   /protein_id="ABB73890.1"
FT                   /translation="MPELPEVEVVRRGIASGLEGRKIAGLTVRNPNLRWPVPELERTLC
FT                   GLEIRTVTRRGKYLLLDCGAGTLILHLGMSGSLRLLALAANIAPQKHDHIDLLLDKGMV
FT                   LRFRDPRRFGAVLWTTGNATDHPLLSHLGPEPLTEAFDGKLLYSKTRNRSASIKEVLMN
FT                   SRIVVGVGNIYANEALFLAGIDPANAAGRIGARRCAGLAQAIKETLGRAIEAGGSSLRD
FT                   FVGSDGNPGYFQQQYWVYSRTGQPCRKCGTNIEQIRQGQRSSFYCPRCQK"
FT   gene            complement(667236..668588)
FT                   /locus_tag="Nmul_A0583"
FT   CDS_pept        complement(667236..668588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73891"
FT                   /db_xref="GOA:Q2YBI0"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBI0"
FT                   /protein_id="ABB73891.1"
FT                   /translation="MHLKRKKLRLRGTQSATFLIILILLVALPGYLAWENRVQWDVTQN
FT                   KSNSLSPASLEVLKQMEGPLLGSVYISSQDAQLGNVSKIIRDFLTPYQHAKPDFAVTFI
FT                   DPSEHPDVAREAGVEGNGEMLVEYNGRVERLTTFNEHTLVNLLMRLMRTGSRPVVTLSG
FT                   HGERRLDGIGNRDLGEFGQQLTAKGFRIQPLNLLTTPEVPAETSLLVIASPQADLSEGE
FT                   VDRILAYIERGGNLLWLLDQQPLHGLQPLAEKLELTLTPGVVIDPQAGQLKAPVTFSVG
FT                   ATYGEHPITRNFDYLTVFPFARQITINENDAWHSLSLVEAGENGWVETGDLNAGIAFDA
FT                   MYDVAGPVSIAAVLSRTVNDQEQRVAVIGSGYFLANAYLGYGRNLDFGVNLVNWLAGDE
FT                   DLIAIQPRTTIDNSLTLKEPALTIIAWGFLIVMPLIFLGSGMTIWWRRKRR"
FT   sig_peptide     complement(668487..668588)
FT                   /locus_tag="Nmul_A0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.537 at
FT                   residue 34"
FT   gene            complement(668591..669325)
FT                   /locus_tag="Nmul_A0584"
FT   CDS_pept        complement(668591..669325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0584"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73892"
FT                   /db_xref="GOA:Q2YBH9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH9"
FT                   /protein_id="ABB73892.1"
FT                   /translation="MITIIARKELGVLFGSPLAWVILALAQLVFAWFYLANLEGFLQVQ
FT                   PQLVRIAHPPGATEAIAAPLFSIGAVVLLMITPLLTSRLIAEERRNHTLPFLISAPVSM
FT                   TEIVLGKFLGLMIFLSAIIALIVALAISLLAGGRLDSGLLLSNIAGLWLLSACFVALGL
FT                   YISCLSTQPAIAGAAALCILFALWIMDNAESGENGITRSLSPFAHFENFNRGMIDTFDL
FT                   AYFALFIFFFLALSVRWLKLYR"
FT   sig_peptide     complement(669245..669325)
FT                   /locus_tag="Nmul_A0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.431 at
FT                   residue 27"
FT   gene            complement(669322..670065)
FT                   /locus_tag="Nmul_A0585"
FT   CDS_pept        complement(669322..670065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0585"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73893"
FT                   /db_xref="GOA:Q2YBH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH8"
FT                   /protein_id="ABB73893.1"
FT                   /translation="MSAKTEQKTVSAQGLSRHFGARTAVDQVSLELWQGEVLGLLGPNG
FT                   AGKTTVMRLLTGNLAPSTGRVEICGLDLQKQTLGAKACIGYLPEVPPLYRELTIDEYLR
FT                   LAVRLRRLARSKTDDAIRKAAERCGLENVRRRLIGSLSKGYQQRAGIAQAIIHDPAVII
FT                   LDEPTSGLDPNQMRDVRSLIRELGAVRSVIFSTHALSEVESVCDRVQIINHGRQVFEGS
FT                   VDMIKLEGTRLEEIFTQSTLEKIET"
FT   gene            670292..672013
FT                   /locus_tag="Nmul_A0586"
FT   CDS_pept        670292..672013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73894"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH7"
FT                   /protein_id="ABB73894.1"
FT                   /translation="MSLKVPGALPLLFLAACSHLPAKTPLTAEKPAEKKESEQSRVPSQ
FT                   DLTPSMLFDFLLAETALQRGDTEIGLRTYLKLAKNTQDPRVAQRATEAALQARQPAFAL
FT                   EAAKIWTELDPESIPARQMMAALLVHFDRLDEARPHLEKLLAVAGDKIDDAFMQLNSLL
FT                   VRSPNKNAIFELVKQLAQPYPDLPEAHFAESQAAWFAERFDIALEEMKKALALRPEWEM
FT                   AAIYEGRILSRESNARAIEFFDDYLKRYPKANDTRITYARLLLAERDYSKAREQFQKLL
FT                   TENPDNPDVAIAVGLLSLELQNYDVAESNFKRALELGYRDPGMVRFYLGGISEKKQQIP
FT                   QALNWYRSVTEGTQFIPAQIKYAILLSRTGKTKEGLHHLQQLPVANDQQRAQVIIAEAQ
FT                   LLRESGAYKKAFQLLSSSLEKLPDSPELLYDRALAAEKIGKADIMEQDLRKLIELRPDH
FT                   AHAYNALGYGIAEHSSKRLPEALELIEKAIKLSPIDPYIIDSLGWVHYRMGDINQGLSY
FT                   LRQAFAMNPDPEIAAHLGEVLWVQGMKDEAKEIWQTALKNHPGNEALIGVMKKFMK"
FT   sig_peptide     670292..670363
FT                   /locus_tag="Nmul_A0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.280 at
FT                   residue 24"
FT   gene            672033..672776
FT                   /locus_tag="Nmul_A0587"
FT   CDS_pept        672033..672776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0587"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73895"
FT                   /db_xref="GOA:Q2YBH6"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH6"
FT                   /protein_id="ABB73895.1"
FT                   /translation="MPCVDSESVRFVNPACRKLRNFGRFSLSSLGSLGSLGSLGSLRSW
FT                   HLVFLTPAFFYGCATLAPEEKNVASTVIMEPGAMEAKSAGFQLIGRVSVKEGRNGFSGG
FT                   VQWRHMQDDDQILLLSPVGQAVGQIERSADGVSLITAEQEHYYADNVEELTERVLGWRL
FT                   PLSGLQYWVQGTNSPDTPSEIDLDMMGRVAAIRQNGWEITYAGYSQAVPAEAPQSEAAR
FT                   ARLLTLNRNGLRIRLVIDEWNTVND"
FT   gene            672751..673635
FT                   /locus_tag="Nmul_A0588"
FT   CDS_pept        672751..673635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0588"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73896"
FT                   /db_xref="GOA:Q2YBH5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBH5"
FT                   /protein_id="ABB73896.1"
FT                   /translation="MNGILSTTEVDSQAELSCPAPAKLNLFLHVVGRREDGYHLLQTVF
FT                   RLVDFADQLHFGLRADGVIKLHTPTPGVPEEQDLCVRAAKLLQRESGTPWGANIFLEKR
FT                   IPMGGGLGGGSSDAATTLLALNRLWKLGWRRNQLLKLAPELGADVPVFVFSENAFAEGI
FT                   GEKLLPIALPPAWYLILTPPVHVSTAKVFSSKELTRNTIPIKIPPFSTEQGHNDLEPVV
FT                   CASYPEVARHLEWLRQLEGARMAAMTGSGACVFAEFATESGARSALGKIPYGMKGFVAQ
FT                   GLDRHPLHDFAEQ"
FT   gene            673637..673711
FT                   /locus_tag="Nmul_AR0017"
FT   tRNA            673637..673711
FT                   /locus_tag="Nmul_AR0017"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA-Gln1"
FT   gene            673818..674768
FT                   /locus_tag="Nmul_A0589"
FT   CDS_pept        673818..674768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0589"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73897"
FT                   /db_xref="GOA:Q2YBH4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH4"
FT                   /protein_id="ABB73897.1"
FT                   /translation="MAYDSLMVFTGNANPKLAQDVVRHLNLRIGRATVGRFSDGEVMVE
FT                   ILENVRGKDVFVLQSTCMPTNDTLMELLVLVDALKRASASRITAAMPYFGYARQDRRPR
FT                   SVRVPITAKVVANMLTSVGIDRLLTMDLHSDQIQGFFDIPVDNIYSMPILLGDLWKNDF
FT                   KNLVVVSPDVGGVVRARQMAKRLECDLAIIDKRRPKANIAKVMNIIGEVDGRTCVIMDD
FT                   MVDTANTLCEAARALKEQGAERVLAYCTHPVLSGGAVERIGNSALDKLVVTDTIPLRED
FT                   AQACERIEQLSVASLLAETMLRISNEDSVSSLFME"
FT   gene            674918..675604
FT                   /locus_tag="Nmul_A0590"
FT   CDS_pept        674918..675604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0590"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73898"
FT                   /db_xref="GOA:Q2YBH3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBH3"
FT                   /protein_id="ABB73898.1"
FT                   /translation="MQIEISAEKRELQGKGASRRLRGSGKVPGIIYGGENPAQPIELDH
FT                   NNLYHQLKLEAFHASILTMSVEGQKEKVLLRDIQMHPFKPQVLHIDFQRVASNKKIHMK
FT                   VPLHFINEDIAPGVKLAGGLVSHVLTELDVSCLPKDLPEFISVDVGELAAGNTIHLSNL
FT                   QLPEGVEIPALMKGEDLPVATIAIPRGVAAEEAAGGVAAGDIPTSVQKKEGVAKEGEKK
FT                   DAGKKK"
FT   gene            676160..676735
FT                   /locus_tag="Nmul_A0591"
FT   CDS_pept        676160..676735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0591"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73899"
FT                   /db_xref="GOA:Q2YBH2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBH2"
FT                   /protein_id="ABB73899.1"
FT                   /translation="MKLIVGLGNPGREYAATRHNAGAWWVVRLADQLGVTLKADGKFHG
FT                   LCARIGQGESESWLLNPQTYMNASGRAVAALCRFYRIQPEQMLVVHDELDLPPGVSRLK
FT                   LDGGLGGHNGLKDIVAHLGTREFWRLRIGIGHPGEKHAVVNYVLQPPRKEEAALIDTAI
FT                   NDSLEVWPLIAEGNYQAAMMRLHTQKQS"
FT   gene            676959..678062
FT                   /locus_tag="Nmul_A0592"
FT   CDS_pept        676959..678062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0592"
FT                   /product="GTP-binding protein, HSR1-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73900"
FT                   /db_xref="GOA:Q2YBH1"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH1"
FT                   /protein_id="ABB73900.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGIVE
FT                   VPDSRLTELAAIVKPQKVQSAVVEFVDIAGLVAGASKGEGLGNKFLATIRETDGIINMV
FT                   RCFKNDNVVHVSGKVDPISDIETIQTELALADLATVEKVVQRETKLAKSGDKEAVKFVA
FT                   LLEKVREHLDQGKPVRSLGLAEGLDKEQQELLKPLCLLTAKPAIYVANVDEKGFTGNPL
FT                   LARVEEYAAGEGAPVVAICAALESEIAEMPDEDKQVFLADMNLEEPGLNRLVRAAYQLL
FT                   GLQTYFTAGVKEVRAWTISKGDTAPQAAAVIHTDFEKGFIRAEVISYDDFVTCKGEQGA
FT                   KEAGKMRLEGKEYVVRDGDVMHFRFNV"
FT   gene            complement(678338..678517)
FT                   /locus_tag="Nmul_A0593"
FT   CDS_pept        complement(678338..678517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0593"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73901"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBH0"
FT                   /protein_id="ABB73901.1"
FT                   /translation="MSGTRGSGGKAETGRSGGTAGTSGAGGTTGTGGAGGTTGTGGAGG
FT                   TAGTGASGGGSGGY"
FT   gene            complement(678825..678950)
FT                   /locus_tag="Nmul_A0594"
FT   CDS_pept        complement(678825..678950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0594"
FT                   /product="ISRSO14-transposase orfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73902"
FT                   /db_xref="GOA:Q2YBG9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG9"
FT                   /protein_id="ABB73902.1"
FT                   /translation="MVEAGKPTQNAYIESFNGRFRDECLNDHWFTALAKARIRIL"
FT   gene            complement(679239..679664)
FT                   /pseudo
FT                   /locus_tag="Nmul_A0595"
FT   gene            679815..680273
FT                   /locus_tag="Nmul_A0596"
FT   CDS_pept        679815..680273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG8"
FT                   /protein_id="ABB73903.1"
FT                   /translation="MDGRLRMERLSLHPFHWSLPIMEKEIRKFLTSLSMLGLLASCAET
FT                   STLEARNDNASMAGQIIRTSIDHDELARRYESRARKLLEIAAEHEKRLQYHEDKSPSYG
FT                   RHGQDFQSHAILVQKYKRAAEKATQAAFHHRMASQPAKRDYIASIALH"
FT   gene            complement(680997..681344)
FT                   /locus_tag="Nmul_A0597"
FT   CDS_pept        complement(680997..681344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0597"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73904"
FT                   /db_xref="GOA:Q2YBG7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG7"
FT                   /protein_id="ABB73904.1"
FT                   /translation="MAMLLSEGQMSDYKGARVLLPSLPKAKTLIADRGYDAAWFRAALR
FT                   AKGMTPCIPTKRNRKIQIKYDKTLYRQRHRIENMFARLKDWRRIAMRYDRCAHTFFSAI
FT                   CIAATVIFYLN"
FT   gene            complement(681386..681754)
FT                   /locus_tag="Nmul_A0598"
FT   CDS_pept        complement(681386..681754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0598"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73905"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG6"
FT                   /protein_id="ABB73905.1"
FT                   /translation="MRDLFYLSETQFNRIKPYFPLSHGVPRVDDLRVISGIIYVIRNGL
FT                   QWKDAPREYGPHKTLYNRFVRWSRLGVFNRIFVELTGKEETPERLMIDATHLKAHRTAA
FT                   SLLKKGMFPAVSVAQRAA"
FT   gene            complement(682064..682291)
FT                   /locus_tag="Nmul_A0599"
FT   CDS_pept        complement(682064..682291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0599"
FT                   /product="Helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73906"
FT                   /db_xref="GOA:Q2YBG5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG5"
FT                   /protein_id="ABB73906.1"
FT                   /translation="MPTSVRLTPEIEERLNFLAAQTGRSKAFYLREIIERGLDEMEDCF
FT                   LAADVLERVRKGKEKIYPPAEIKKDLDLED"
FT   gene            682307..682630
FT                   /locus_tag="Nmul_A0600"
FT   CDS_pept        682307..682630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG4"
FT                   /protein_id="ABB73907.1"
FT                   /translation="MKYGYSLYLNFWSDTFLSMSSNNRLYTLELKMPDNVKAKKGDEMI
FT                   YKVLITPVEPSIDDRPNFSGLLADYEIEANSKTEAEEMAFIRFCQESPFRSHNREDYTI
FT                   SVN"
FT   gene            683304..683597
FT                   /locus_tag="Nmul_A0601"
FT   CDS_pept        683304..683597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0601"
FT                   /product="type I antifreeze protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73908"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG3"
FT                   /protein_id="ABB73908.1"
FT                   /translation="MPIYEYRCGSCGFEKEYLQKVSDAPVAACPACGSDAFNKLISAAG
FT                   FQLKGSGWYVTDFKNKNGGQSKPKADADACVAKSESAPAGDSACPACTPIDG"
FT   gene            683619..684287
FT                   /locus_tag="Nmul_A0602"
FT   CDS_pept        683619..684287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0602"
FT                   /product="Protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73909"
FT                   /db_xref="GOA:Q2YBG2"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG2"
FT                   /protein_id="ABB73909.1"
FT                   /translation="MKRYFITGLLIWVPLGITAWALKFLISTMDQSLLLLPSSMRPENL
FT                   VGIYIPGVGTVLTLLVVFLTGIFTTNIIGQRLVIFWEGVLWRIPVVKSIYYGVKQVSDT
FT                   LFSSQGEAFRKALLVQYPREGSWTIAFMTGYPGGDVVNHLTGEYVSVYVPTTPNPTSGF
FT                   FLMMPRSDVIELDMSVDAALKYIISMGVVTPPNGKKPVEPQAALLHPQDSVSSASSDKS
FT                   "
FT   sig_peptide     683619..683684
FT                   /locus_tag="Nmul_A0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.661) with cleavage site probability 0.552 at
FT                   residue 22"
FT   gene            684314..686080
FT                   /locus_tag="Nmul_A0603"
FT   CDS_pept        684314..686080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0603"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73910"
FT                   /db_xref="GOA:Q2YBG1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBG1"
FT                   /protein_id="ABB73910.1"
FT                   /translation="MRTNYCGLIDVQYLDQTVILYGWVHRRRDHGGVIFVDLRDREGLV
FT                   QVVCDPDNPTAFQVAEKIRNEFVVRITGRVRHRPPGTVNPNLISGEIEVLVSSIDILNA
FT                   SLTPPFLMDDESLSEATRLEHRYLDLRRPQMQENLRLRYKVAMAVRLFLDQHGFIDVET
FT                   PMLTKSTPEGARDYLVPSRVNTGHFFALPQSPQLFKQLLMVSGFDRYYQITKCFRDEDL
FT                   RADRQPEFTQIDIETSFLNESQIMQMMERMICTVFKSVRNIDLPTPFPRLTHGEAMSKY
FT                   GSDKPDMRVSLVLTELTDVMQEVEFKVFREAALRTGGRVAALRVPGGGALSRKEIDDYT
FT                   GFVAIYGAKGLAYIKVNALEKGMDGLQSPILKFLPENVIQIVLERTGAKDGDLIFFGAD
FT                   KAQVVNEALGALRAKVGHDRGLAESGWKPLWVVDFPMFERDEEENRWKALHHPFTSPAE
FT                   GHEDLLETDPEKALSKAYDMVLNGSEIGGGSVRIHRQEVQSKVFRALNIGADEANEKFG
FT                   FLLEALQYGAPPHGGIAFGLDRIVAMMAGAESIREVIAFPKTQRAQCLLTHAPSTVGEK
FT                   QLRELHIKLRHA"
FT   gene            686195..686668
FT                   /locus_tag="Nmul_A0604"
FT   CDS_pept        686195..686668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0604"
FT                   /product="dihydroneopterin triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73911"
FT                   /db_xref="GOA:Q2YBG0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBG0"
FT                   /protein_id="ABB73911.1"
FT                   /translation="MVRIYKIPVSILVIIHTPDMQVLLLERADHPGYWQSVTGSQDEGE
FT                   TLVQTAVREVAEETGLDARRYALTDWNIVNEYEIYEEWRWRYAPEVTHNTEHVFGLLVP
FT                   HPVPVSVAAREHLRHTWLPWQEAAEKVFSPSNAEAIRRLATLGGKGNNGNKGQ"
FT   gene            686851..687951
FT                   /locus_tag="Nmul_A0605"
FT   CDS_pept        686851..687951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0605"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73912"
FT                   /db_xref="GOA:Q2YBF9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF9"
FT                   /protein_id="ABB73912.1"
FT                   /translation="MQAEAIAFERFDNLNDDDCEQRIVQAKAALGRRAVILAHHYQRPD
FT                   VYKHADLTGDSLQLSRLASGTDADYLVFCGVHFMAEVADILSKPEQITILPDLSAGCSM
FT                   ADMASLLKVQRAWHELSEVLDPDEVVTPVTYINSAADLKAFCGEHGGIVCTSSNAMKIL
FT                   QWSFSRREKVLFFPDQHLGRWSGHKLDIPLEQMAVWDFDEPMGGLSPEQIRNAKILLWK
FT                   GHCSVHQMFQPQHILRFRNQHPEGKVISHPECSFEVCKNSDYVGSTDYIIRTIREAEPG
FT                   TRWLVGTELNLVNRIAEEFKAQGKIVQFMASTICMCSTMARIDPQHLAWALENLVAGKV
FT                   VNQIKVPAADAVLAKRALERMLEVSR"
FT   gene            687988..688740
FT                   /locus_tag="Nmul_A0606"
FT   CDS_pept        687988..688740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0606"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73913"
FT                   /db_xref="GOA:Q2YBF8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF8"
FT                   /protein_id="ABB73913.1"
FT                   /translation="MLNKLHIATYNIHKGFSHFNRRVMVHQLRDSLRALNADIIFLQEV
FT                   VGEHKGHGARFENWPESPQYEFLADSIWTDFAYGKNAVYDEGHHGNAILSRYPILRWDN
FT                   VDVSAHRFESRGLLHCEIGIPQWRENLHCICVHLGLFKRGRSRQLQLLEKHIEELVPQD
FT                   APLVIAGDFNDWREVASRILVQRLALAEVFELTEGRPARTYPSTLPLFRLDRIYVRGFH
FT                   IEKAQVHQGHPWSKISDHAVLSAQMILR"
FT   gene            688740..689834
FT                   /locus_tag="Nmul_A0607"
FT   CDS_pept        688740..689834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0607"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73914"
FT                   /db_xref="GOA:Q2YBF7"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF7"
FT                   /protein_id="ABB73914.1"
FT                   /translation="MPPALHSEIDAAAALLKKGGVVAFPTETVYGLGAEVSSPSAVARI
FT                   FEIKKRPLDHPLIVHFADASRLSHWAREVPQQAWRLAECFWPGPLTLILPRSRHVPEKV
FT                   TGGQDTVGLRVPDHPVALALLRELGPDRALAAPSANRFGHVSPTTAAHVREEFGDELDM
FT                   VLDGGPCQVGLESTIVGFEGQTAVILRPGGIQLAALAEVLDGNVMLSQEAERSVRVPGA
FT                   LPSHYAPSTPLELLPADPLWARALELEAKGMRVAVMGWRRREHSLPRHHPENEPVVFSA
FT                   MPEEPEEYARQLYATLRRFDRGHFDRLLVEKPPETAAWVAIADRLRRASSRTHPGANAV
FT                   LRGEQSSSSLTREDENETIYGQTG"
FT   gene            689846..690625
FT                   /locus_tag="Nmul_A0608"
FT   CDS_pept        689846..690625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0608"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73915"
FT                   /db_xref="GOA:Q2YBF6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF6"
FT                   /protein_id="ABB73915.1"
FT                   /translation="MDSKVRAVLFDVDGTLADTERDGHRPAFNAAFQELGLDWEWDVDL
FT                   YGRLLEITGGKERILHFMEHHVPEELNRSELGEWIARLHKIKTRHYVGMLESGGIPLRP
FT                   GVARLIRHLRDRNIKIAIATTTTPENVTALLKSTLGEDSPGWFDVIGAGDIVPGKKPAP
FT                   DIYHWVLDQLKLPAKQCIAVEDSENGLRASLAAGLDTVVTVNGYTRFQDFTGAKLVLSD
FT                   LGEPTKPFSVLEGEAGVANGINGSGWVDMDLMLKLKG"
FT   gene            690794..691243
FT                   /locus_tag="Nmul_A0609"
FT   CDS_pept        690794..691243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0609"
FT                   /product="Phosphate-starvation-inducible E"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73916"
FT                   /db_xref="GOA:Q2YBF5"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF5"
FT                   /protein_id="ABB73916.1"
FT                   /translation="MLQARTINYSRRLLQFFEGVGLVVIALATIFAGYQETMLMIHNGR
FT                   VNLADLLLMFLYLEILTMVGLYFESGKLPVRFPLYIALVALARYITVDVKEMDNIRLLG
FT                   VSAAIVLIALGVLVIRYGHVRYPYVEDLEELTEAASKEREQKIRD"
FT   gene            691245..691748
FT                   /locus_tag="Nmul_A0610"
FT   CDS_pept        691245..691748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0610"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73917"
FT                   /db_xref="GOA:Q2YBF4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF4"
FT                   /protein_id="ABB73917.1"
FT                   /translation="MEGQINKPQVGVIMGSSSDWEVMKHAVEVLKKFHVPYEAEVVSAH
FT                   RTPDRMFEYAETAGGRGLKCIIAGAGGAAHLPGMVAAKTLLPVLGVPVTSRQLQGLDSL
FT                   LSIVQMPRGIPVATFAIGEAGAANAGLFAVALLAMEDAGLARQLAEFRETQMATVASMT
FT                   LPLS"
FT   gene            691745..692965
FT                   /locus_tag="Nmul_A0611"
FT   CDS_pept        691745..692965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0611"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73918"
FT                   /db_xref="GOA:Q2YBF3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF3"
FT                   /protein_id="ABB73918.1"
FT                   /translation="MSTRPGAMLGLLGGGQLGRMFTMAAQSLGYSVTVLDPEERSPAGS
FT                   IAERHLRADYLDREALNELASTCAGVTTEFENVPAEALRVLAERCIVSPAAESVAIAQD
FT                   RILEKNFLAANGFGVAPYTVIQNARTSQDATNPDGALPQRQPQFFPDLFPGILKVSRFG
FT                   YDGKGQVRVSNASELDSAFAGLNRESCVLEKLLPLEREVSVIVSRGFDGEVVTFPVSEN
FT                   QHCNGILDISIVPARVSPEIARNACDIAIRIAEKLDYRGVLCVEFFVLAEGRLLVNEIA
FT                   PRPHNSGHYSINACVTSQFEQQVRILCRMPLGSTSMHGAAVMVNLLGDLWQKGEPEWEQ
FT                   VLRHSDVKLHLYGKRDARPGRKMGHYTVLAETTDAALRLALEIKQSLQPSHSTLETHES
FT                   PRNESRN"
FT   sig_peptide     691745..691819
FT                   /locus_tag="Nmul_A0611"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.798 at
FT                   residue 25"
FT   gene            693042..693857
FT                   /locus_tag="Nmul_A0612"
FT   CDS_pept        693042..693857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0612"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73919"
FT                   /db_xref="GOA:Q2YBF2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF2"
FT                   /protein_id="ABB73919.1"
FT                   /translation="MDEDKLLIVQTDRLSAFDVILPTPVPGKGRLLTALSSFWFEKLEH
FT                   IVPNHLTHIAPESVVTEDERGQVTERAFVVKRLRPLPIEAIVRGYVVGSGWKDYKKTGM
FT                   ICGIPLPAGLEEAGRIPGGALFTPSTKAAQGAHDENIPFAEAEKLLNEGGEGLAAQVRD
FT                   IALALYTQAADYAITKGIIIADTKFEFGQDQAGRLYLIDEALTPDSSRFWPADQYAPGK
FT                   NPPSYDKQFVRDWLETQNWNKKAPAPALPPEVLAKTAEKYREALHRLVD"
FT   gene            complement(693854..694651)
FT                   /locus_tag="Nmul_A0613"
FT   CDS_pept        complement(693854..694651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0613"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73920"
FT                   /db_xref="GOA:Q2YBF1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF1"
FT                   /protein_id="ABB73920.1"
FT                   /translation="MEWWPAYLILGTVVGFFAGLLGIGGGLVIVPVLTFIFTAQDFPPD
FT                   RILHLALGTTMAAIIFSSAASLRTHHVHGAVNWQVVKFITPGIILGTLGGATVVSMLSS
FT                   RFLSIVFVVFIYYAATQMLLNIRPKPSRTLPGRLGMLAAGSVIGAISSFVAIGGGLLTI
FT                   PFLSLCNVKLQHAIGTAAAVGFPIAVAGGIGYMINGMAQPQPLPEYSLGYVYLPALGWI
FT                   VLGSTLTAPLGAKTTHVMQTATLRKIFVVLLYLLGTRMLLRLF"
FT   gene            complement(694734..695198)
FT                   /locus_tag="Nmul_A0614"
FT   CDS_pept        complement(694734..695198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0614"
FT                   /product="Protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73921"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBF0"
FT                   /protein_id="ABB73921.1"
FT                   /translation="MMEMRYWLMKSEPSDVSIDDLASMPDQTVAWYGVRNYQARNFMRD
FT                   QMRVGDRVFFYHSTCEEPGIAGIAEVSKLAYPDATQFEPENKYFDPKATPENPRWFNVD
FT                   VRLIKKTRLVGIKELRGYPELANMRILQKGNRLSITPIDPAEWDFIMGIL"
FT   gene            695349..696932
FT                   /locus_tag="Nmul_A0615"
FT   CDS_pept        695349..696932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0615"
FT                   /product="Animal heme peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73922"
FT                   /db_xref="GOA:Q2YBE9"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR037120"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE9"
FT                   /protein_id="ABB73922.1"
FT                   /translation="MINNKLMTRLLKFLWRIGESWPWLGRKLNEFAINRVVNVCRHRPH
FT                   PWSTVHPYTSWTSLTDQHWSARHLPPKKQPAQLPSSSELLGLFRQQDGKQRLSDKSTLL
FT                   FPAVAQYLTDGFIRTRMPQAGEPETVRLQNTSNHQIDMCPLYGRLPEQTAALRLKSETK
FT                   GERGRLKSQFIAREEFSPFLFDNGKPKQEFAVLDEPLGLERALDRVPERREELQAHIFA
FT                   FGGDRTNAVPQVAMLNTLFLREHNRLAGEIERMHPQWDDERVFQTARNNVIVIFIKIIV
FT                   EEYISHISPLVPYRADPSVAWNAPWNKPNWITTEFSLLYRWHSLVPDAITWNGHLYLLG
FT                   ETSMNNKLLLDGGLRRAFADMSSQRAGRLGPFNTAEFLWEIETRAIEQGRLAELAPYTD
FT                   YRHYVSLERPQDFADISTDPRVVDFLRKTYRRVEDIDFYVGLFAEDLVEDSPLPSLMLR
FT                   MVAVDAFSQALTNPLLSQYVYNEETFSVPGWAAIQSTGTLWDVLDRNAPSDQRGDLYIG
FT                   LTLPDWMPSS"
FT   gene            complement(697161..698495)
FT                   /locus_tag="Nmul_A0616"
FT   CDS_pept        complement(697161..698495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0616"
FT                   /product="esterase/lipase/thioesterase family active site
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73923"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE8"
FT                   /protein_id="ABB73923.1"
FT                   /translation="MKFHSVELHVTVLILLMVLGGCAPFVQYRTEYDLCVNPTSELSRE
FT                   CENHAILEFPAADGARYLLNFIEFDDQGQLWDRRQMWSVIDKLSAEAASKDLLITVFVH
FT                   GWKHNAKHTDKNIQTFRNVLAGLSENELLISKKTGRPARQVAGIYLGWRGESITMPVVE
FT                   DLTFWDRKNTAQKVSRGGVTEVLNRLELLKRVKENVSEGNSNTRLVIVGHSFGGAIVHA
FT                   SLVQILENRFVRTMGPVGVQSDVEGFGNLVVLINPAFEALQFSSLSDMSTERGTYFKSQ
FT                   LPVMAILTSEADKALRNSFPIGRHLSTFFEKDRDIRRTNAVTGQEEIIDEGEANVTAVG
FT                   LFQPYETHRLYPSHALPKGVAGQSSSSESVSSGLAAKSAWEDDKPGSKIPIANLTLERS
FT                   NISAPRNPYLVTRVDKNLITDHTHIDDGRIIEFIKQLILISTTSP"
FT   gene            698972..700189
FT                   /locus_tag="Nmul_A0617"
FT   CDS_pept        698972..700189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0617"
FT                   /product="poly-gamma-glutamate synthesis protein (capsule
FT                   biosynthesis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73924"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE7"
FT                   /protein_id="ABB73924.1"
FT                   /translation="MTVGPLYAQAVRDGVQISVKNGDQTAPGPRSPGGHTSIKLFLCGD
FT                   VMTGRGIDQVLPHPGNPILFEGYMKSATGYVELAEEANGPIPHPVPFSYIWGDALAELE
FT                   RRKPDVRVINLETALTRSDEVQDKAVNYRMNPDNIPCITAAKIDCCVLANNHVLDWGYE
FT                   GLAETLKTLKRADIKIAGAGLNVQEARQPAEMTVPGKGRVLVFSLGSETSGIPWNWAAR
FT                   TDRAGVNLLPDFSAKTVREIRDRIKQVRLPGDIVVASIHWGNNWGYAIPVEQQDFAHGL
FT                   IDEAGVDVIHGHSSHHVKGIEVYRGKLILYGCGDFLNDYEGISGHETYRGDLTLMYFVS
FT                   AEPQTGKLVSLSMVLMQVRHFKLNRASDVDASWLKNILNREGKKLGTSVELTADNTLML
FT                   RWMLQG"
FT   gene            complement(700464..701831)
FT                   /locus_tag="Nmul_A0618"
FT   CDS_pept        complement(700464..701831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0618"
FT                   /product="putative cytochrome c1 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73925"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE6"
FT                   /protein_id="ABB73925.1"
FT                   /translation="MREMLISRSVISPVLILAGMLLTLSSAEVKAVPSFARQTGMPCST
FT                   CHVQAFGPLLTSIGRNFKLSGYTDVNPDRTKFIPITGMIRGSFTHTNNGQLGGAADRFG
FT                   PNNNATIDEASIFYAGRITSKIGAFAQGTYDGVSNTGALDNTDIRFANGADLAGNRLVY
FT                   GISVNNNPTVQDLWNTTPAWGFPWASSPLAPTPAAGLFIESLGSQVVGATVYTMWNDML
FT                   YVEGGGYTSLPRNIQQGIGTFDAGQNRIDGGAPYGRVALQNNWQGHYGAIGSFGMRANA
FT                   NPQRIQGASTDQYTDFGFDATYQYLANPRHILELNATYIREHRDLNASVGLGFAEKRHG
FT                   SLDVVRVRSGYTFLQTYSLNLAYAQTSGTRDNVIYSPDPIDGSLSGKPNSQAFTVEVSY
FT                   IPFGKSTSVLSTFANLKLTAQYIHYFQFNGGFRNYDGFSRNAPGNDTVYLNGWMAF"
FT   sig_peptide     complement(701748..701831)
FT                   /locus_tag="Nmul_A0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.390 at
FT                   residue 28"
FT   gene            702231..702911
FT                   /locus_tag="Nmul_A0619"
FT   CDS_pept        702231..702911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE5"
FT                   /protein_id="ABB73926.1"
FT                   /translation="MQSTILKFPIRDIHLSTAQRTIGEVHMNTHSDSAAQTDPRRSYLT
FT                   FQDILETVSHEPGQGHLLEQIEKIVRVQQRERLYGILSQISEDQLLPVQVLLERDLPQR
FT                   GKCNSAYNRFRIPSWKRYDDIYWQSLIDYTILALRTFKEIDFCAIRGKLVLHYFDIPGG
FT                   TSRVQDVIRRLVWLIDNDHLSVDFTRSRWMESWSHTVASMSREEIFTAASIVEVAPKLL
FT                   LSGE"
FT   gene            702944..703417
FT                   /locus_tag="Nmul_A0620"
FT   CDS_pept        702944..703417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0620"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73927"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE4"
FT                   /protein_id="ABB73927.1"
FT                   /translation="MPLPRDAPPARYLDDMKVGLRFAGDPRVVQEQEIIAFARQFDPQP
FT                   FHIDAALASQTLFGGLIASGWHTAAMTMRLLLEAFPIGDGTIGLGGEAAWPNPVRANDA
FT                   IHIEGEVSAVKPSRSHDDRGIVTVRTETKNQNGDVVQTLTANLLVFRRKSKSA"
FT   gene            703910..704443
FT                   /locus_tag="Nmul_A0621"
FT   CDS_pept        703910..704443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0621"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73928"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE3"
FT                   /protein_id="ABB73928.1"
FT                   /translation="MVACCRSAPGRGRSGRAIHRLNRRACAPALGWRVKKNGSDQAIGR
FT                   SRGGLTTKIHACVDALGNPLRLILTGGQVADITQGPALINSIKTDAVVADKGYDSHVFV
FT                   AVITETGAEAVIPSRSNRCASREFDRERYKARNLVERFFNRLKQFRRLATRYDKLANRF
FT                   NAFLHLACAYIWLL"
FT   gene            complement(704602..704883)
FT                   /locus_tag="Nmul_A0622"
FT   CDS_pept        complement(704602..704883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73929"
FT                   /db_xref="InterPro:IPR008486"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE2"
FT                   /protein_id="ABB73929.1"
FT                   /translation="MSNRFLRWAKTWIEENIPPGANSDIESYEVKAKRLSEKLFAEAAA
FT                   ANFTNFETEEERERVTPLVLAAVSDSRDFDIDAYHLKSQLAQENEDGD"
FT   gene            705130..705408
FT                   /locus_tag="Nmul_A0623"
FT   CDS_pept        705130..705408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73930"
FT                   /db_xref="GOA:Q2YBE1"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE1"
FT                   /protein_id="ABB73930.1"
FT                   /translation="MKDLFYLSETQFNRIKPYFPLSHGFPGLMICGIIYVIRNGLQWKD
FT                   APREYGPHKTLYNRSCAGADWACSTASLRNCLVKRKRPTAGNRFHAS"
FT   gene            complement(705620..705916)
FT                   /locus_tag="Nmul_A0624"
FT   CDS_pept        complement(705620..705916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73931"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBE0"
FT                   /protein_id="ABB73931.1"
FT                   /translation="MNHLFSFGSKKLQAIVFNTLLLGSISMVNAQSQNINGENTPKPVV
FT                   TEEKLSNKSDATNEAKKKEKKKSKQELMKTENYKGGQPPEGGRVGQGGFVDPD"
FT   sig_peptide     complement(705824..705916)
FT                   /locus_tag="Nmul_A0624"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.828 at
FT                   residue 31"
FT   gene            complement(706088..707563)
FT                   /locus_tag="Nmul_A0625"
FT   CDS_pept        complement(706088..707563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0625"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73932"
FT                   /db_xref="GOA:Q2YBD9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD9"
FT                   /protein_id="ABB73932.1"
FT                   /translation="MNPVQLDPDGNRLPIKLDTTSNGEFAPVPLSPANLAANRLAHEAA
FT                   DTNAKRTGVSRRHFLISACDAASTLLAFNAANAAAGRTGGFFDLTKEAALEPALAQAEI
FT                   GDKGEFIFDVQGHFVNPKGAWLQKLVPGAKPLSQMPKTECALGLESGSHSYLQCLGPDE
FT                   FIKDVFLDSDTDMMVLSFVPSRPDAEPLTIQEADAVRRIVDRMEGTHRVLLHGRVNPNQ
FT                   QGDLERMDELKDRWGVSAWKTYTQFGPEGKGYFLSDETGTRFIEKARSLGVKVICVHKG
FT                   LPFGRQSYEHSKCTDIGVAAKRFPDVAFLVYHSGFVTSVPEGPFQGQGADEGVDTLIRS
FT                   LIDNDVPPNRNVYAELGSTWRYLMRNPEAAAHVLGKLLKYCGEDNVLWGTDSIWYGSPQ
FT                   DQIQAFRAFQIASELRARYDYPEITPQLRAKIFGLNAARVYSISLEEVKKYTGRDRIAH
FT                   ERLAYLEHPQPHFLTYGPKTRREFLNLPGAGQP"
FT   gene            complement(708354..708668)
FT                   /locus_tag="Nmul_A0626"
FT   CDS_pept        complement(708354..708668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0626"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73933"
FT                   /db_xref="GOA:Q2YBD8"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD8"
FT                   /protein_id="ABB73933.1"
FT                   /translation="MNTGTGKPLDVTIMGREFRVSCSDEDREGLLQAVAYLNKKMREIR
FT                   DSGKVLGSERITVMAALNITHELLKARSKEGFDTEEFRRRIDHMQAMLDAAMPEQDKLF
FT                   "
FT   gene            complement(708665..708868)
FT                   /locus_tag="Nmul_A0627"
FT   CDS_pept        complement(708665..708868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73934"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD7"
FT                   /protein_id="ABB73934.1"
FT                   /translation="MMEPELDTLEEKITQFVRLCQQLRTENIQLRQQLAVTTSHNRLLV
FT                   EKIGAAASQLEVLLSRIPESKE"
FT   gene            709362..711428
FT                   /locus_tag="Nmul_A0628"
FT   CDS_pept        709362..711428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0628"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73935"
FT                   /db_xref="GOA:Q2YBD6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD6"
FT                   /protein_id="ABB73935.1"
FT                   /translation="MGLFRRHLLPWMFISVPSGALAVSSDPAERLLPDVVVTATRFSES
FT                   IDKLPSGVSIVNAEQIRNSAATTLPELLQQLSGIHTRNVDGSPDPQIDIRGFGITGDQN
FT                   TLVLLDGQRMNENELTGIRWSTIPLDTIERIEVLHGSGSVVYGAGATGGVINIVTRAAK
FT                   PGRISGTGGVSFGSYSGTEFNGTFNAAGNNVGLALTANALRTDNYRVNNALRQSNLQGD
FT                   LRYLFSSGRALLKFGLDDQKLELPANRTEAQLQTDRKGTSTPRDFSTRQGAYVTLRGEK
FT                   ETEFGDLAADLSFRDNHRTALFDDYNLDGFNAKTFVNSRSDQWLFNPRMKLPFAAFGME
FT                   HELVLGVNFEWWDYRSRRFTGPETVPGSASADIPRTDVVATQLNRAIYFQHASTLPKGT
FT                   VVSLGGRLQWVDNRANDRFNPAVYASGRQSRMVYAYDAGLRQPLGEAFSAYGRFGRSFR
FT                   IATVDENYNQFGGPMFDSIVKILEPQTAHTGELGLDYKQKSLRARASLYRTNLNNEISF
FT                   INIDPFLFFANVNLPPTRRQGFELEGSWTVTGALDIFGSYTFIDARFRKGDFGGVDVSG
FT                   NLVPLVPRHKVSAGGTYRLGSSTRAAVVMNYVGEQVFDNDQANTATGRMPDYVTVDLKV
FT                   THQMRKLLLSMAVNNLFDEKYFSYAIRNSAGTSFSALPARERNVWLTVKYQFD"
FT   sig_peptide     709362..709430
FT                   /locus_tag="Nmul_A0628"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.952 at
FT                   residue 23"
FT   gene            711715..713586
FT                   /locus_tag="Nmul_A0629"
FT   CDS_pept        711715..713586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0629"
FT                   /product="ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73936"
FT                   /db_xref="GOA:Q2YBD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD5"
FT                   /protein_id="ABB73936.1"
FT                   /translation="MRPVRLMQNTQNTGARQLCLRLTRYVAPYWDAIILATGCMIATAA
FT                   TVPMLAALMQPTMDEVIANRNPELLQLVLLGIISLFAVRAVAGHLATYVLHWAGSKLAV
FT                   DLLCEIFDKLLVLPHSYYESCPGSNHISVDHVSRITSDAPEVARAFVNVMTVMIRDTST
FT                   VIGLLGWMFYLNWPLALLILLMSSVILLVTQLLGERLREMGRESERAIEGLTRILKGAA
FT                   LNFMVVKLYGGEQYENQRMREQAEEARRFFMKRAAVASLYVPLIQTIGAAAIVLTLYFA
FT                   ANEAVASELTTGSFASLITAILLLIVPGRRIAEVGGTFQRGLLAAGSLFSLLDGEVESE
FT                   TGTVVIQRVRGELQFEEVGYGERTERNPGTSLKVRSLGNSDPAAVLRRGLNSGLHDVTL
FT                   IIQPGETVAVVGCAETMDVLTYMVPRFLTPTSGRILLDGHDLRSITLASLRANIALVSP
FT                   HTTLFNDTVAANIAYGAMGRATEARITWAARAAHASEFIRKLPDGLQTMVGDGGVELPV
FT                   SQRVRIAVARALLKNAPLLILNEKLGMLEPDSVPLVQAAFDTVMQGRTTFVIADRLSTL
FT                   EKADQVVMVDKERIVDRGSHRELMARDGAYTRLIRRVFGSKTAVAAR"
FT   gene            715310..717409
FT                   /locus_tag="Nmul_A0630"
FT   CDS_pept        715310..717409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0630"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73937"
FT                   /db_xref="GOA:Q2YBD4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD4"
FT                   /protein_id="ABB73937.1"
FT                   /translation="MKKEFELNYSLSVLKAAIEATVDGLLVTDRRGKVLCYNQLYVNMW
FT                   PIPGELLAHARHQAILGYCAGQLRDPEQFLRSIEEIYATLAPESFNVFEFRNGRVFERC
FT                   AKVKTLEGSDIVLVWSFRDITERRQGESYKAQLAAIVESSNDAIIVKDLNGIITGWNAA
FT                   AEELFGYRSGEIIGSSILTLIPPDRLEEEDRIMNLVKSGKRTDHFETVRWGKGKKSIDV
FT                   SVTISPVKDSAGNIIGASKIARDITQRKESQERIEYLAHYDLLTGLPNRALFTDRMRIA
FT                   IENASRYAFRLALLFVDLDRFKLINDSLGHAIGDKLLKAVAERMQSTVRQADTVSRLGG
FT                   DEFVVLLGRIHTATEAARVAEKLIAVLSQPYQIEQHELLLTASVGISIYPDSGKDVNSL
FT                   MRNADVSMYSAKGQGRNRYQFYSEDLTSGADERLRLEYDLRSALARDEIFPVYQPQLEL
FT                   ATGRVVGVEALMRWKHPERGLVSPASFIPVAEDSGLILSLGEHILRESCLQARQWHEQQ
FT                   GFEGTIAVNVSAVQFRQNDFTDVVLRALADSGLSPECLELELTESVVMHGVESATQKMC
FT                   FLESRGIKLAIDDFGTGYSSLSYLRQFAIDRLKIDRSFVRDLPQDTDAKAIIRATVAMG
FT                   RSLGLRVMAEGVETEGQAEYLRSVQCDESQGYLYARPMRPDDFEAWLKGRKPDFRGSRY
FT                   QMAQS"
FT   gene            complement(717475..719487)
FT                   /locus_tag="Nmul_A0631"
FT   CDS_pept        complement(717475..719487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0631"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73938"
FT                   /db_xref="GOA:Q2YBD3"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD3"
FT                   /protein_id="ABB73938.1"
FT                   /translation="MPAPKLNIRTVIAFGHDVVAAAIAWSLAYLFRFNFEIPFVYLASL
FT                   EEILPWVVPIHAAAFLFFGLYRGLWHYASLPDLRRILFAVSASAAAVPLVLYMLQILVG
FT                   VPRTVLILAPILLLFIMGSSRLAYRFWKEHRLYGRSKTGGNLVLVIGASDAAVGLVKEL
FT                   ARNVEWRVAGFLDDDPAKRGLMLHGFKVLGRINDLPEVARKLGVAHAIIALTSSASDRR
FT                   KSYRTHSDRRRPDRLLRDRRRALQLCAAAGVKALIVPSYNDLVSGNIKVSQIRTVEPED
FT                   LLGRDPVVLDNDGLHDLLTGKTVLVTGAGGSIGSELCRQIVKFAPAQLVLFELNEFALY
FT                   SIEQEFQADFPEIPMIFAIGDVKDEARLSQVFLQYRPAIVFHAAAYKHVPLMEQENAWQ
FT                   AVLNNVRGTYVLAQTAIRYGVEKFVLISTDKAVNPTNVMGASKRLAEMVCQALQQSIAS
FT                   PDSPTENASGKIVLGSRLERRQEPRFVMVRFGNVLGSAGSVIPKFREQIEKGGPITVTH
FT                   SEITRYFMSIPEAAQLVLQAGLMGGKRRGGEIFVLDMGEPIKIADLARDLIRLSGLSED
FT                   EIKIVYNGLRPGEKLYEELLADDENTLPTPHPKLRIAQARQVDRKWLTALLAWLEEHPA
FT                   LSDEEVKRELPRWVPEYVSAESVIPVSQVRESRIA"
FT   gene            complement(719489..720547)
FT                   /locus_tag="Nmul_A0632"
FT   CDS_pept        complement(719489..720547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0632"
FT                   /product="Glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73939"
FT                   /db_xref="GOA:Q2YBD2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD2"
FT                   /protein_id="ABB73939.1"
FT                   /translation="MDWHGLKYACMRLISHQGYNPIMNSGSPILYLIPPFIAFAVSLGT
FT                   ISCLIKGNILKILDQPNSRSLHTRPVPRTGGLGLMSGIFVSWTFLPVKPPVSIWVAIVL
FT                   LVTISFADDVRSLPVWPRLVIYTGLGIWFSAVTLAATYGWLVAVAAALCITWMLNLYNF
FT                   MDGSDGLAGGMTLIGFSCYGATAWISGNEAFAIANFCIAAAAGAFLLFNFHPARIFMGD
FT                   AGSIPLGFLAAALGMMGWINGCWPPWFPLLVFSPFIVDASVTLIKRGLRGEKIWRAHRE
FT                   HYYQRLVRSGLGHRNTALIGYVLMSATAISALWATQQHTNVQFGMVTAWIGIYLVMICL
FT                   CDRRLRHAPDSP"
FT   gene            720720..721988
FT                   /locus_tag="Nmul_A0633"
FT   CDS_pept        720720..721988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0633"
FT                   /product="Sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73940"
FT                   /db_xref="GOA:Q2YBD1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD1"
FT                   /protein_id="ABB73940.1"
FT                   /translation="MKKISLNTQILWGVFAGLFLGLGLSLLDEESVIFRAGLYGAELLG
FT                   TLFIDLLKMVLIPLVFTSIAVGVANLRAHQQMHKVWKATLGFFLFSMALAILLGLTAAN
FT                   IVRPGEGLQLAMFQDDMQNFQAGQMPLTEFVAQLLHSLFQNPMTALAQGNVLAVVVFAL
FT                   LLGIAMVVGGERYANILILLQELLELMLMLVGWIMRLAPLGIMGLLVKLAATQDVTLLA
FT                   TLVEFIAVVIGATLLHGMVVLPLILYLVTGMTPFKFWRGAREALLTAFATSSSSATLPV
FT                   TLRCVEQHLHVKRDIAGFVIPLGATLNMDGTALYEAVAALFVANLIGIELNLAQQMIVF
FT                   LTAMLAAMGAPGIPSAGMVTMVVVLQSVGLPAEAIAILLPVDRLLDTFRTAVNVEGDMV
FT                   GSLVVQKWVRKESIRGSRSDSEG"
FT   sig_peptide     720720..720803
FT                   /locus_tag="Nmul_A0633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.592 at
FT                   residue 28"
FT   gene            722327..723550
FT                   /locus_tag="Nmul_A0634"
FT   CDS_pept        722327..723550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0634"
FT                   /product="Glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73941"
FT                   /db_xref="GOA:Q2YBD0"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBD0"
FT                   /protein_id="ABB73941.1"
FT                   /translation="MFALPGFAGLFLALVSVAVVAAEPHSSGETHHHPAMHSAKSVKTA
FT                   LAVGVTLDQDGRLWLARVVDQHLLVSWSEDSGSSFSEPAVVTPEPENISIDGENRPKIE
FT                   VARDGSVLVTWTQVLPQKYSGNVRFSRSIDSGRTFSKPITLNDDGRVTSHRFDSLAIDG
FT                   DGRVIVAWLDARDRDAAREKGEEYRGVSLYTTQSFNNGESFGRNRRIQEHTCECCRTAL
FT                   IWSREGPIVLLRNIFGANTRDFALINLDKGGIRRVNRDEWQVDACPHNGGSLATDRRGQ
FT                   LHLVWFTNGPADQGLFYKRIDGNWESKPKPIGNADAQANHASVVADGETVILTWREFDG
FT                   NAYSAKMMYSNDSGESWSEPMRLMESDGATDYPIPLIDNRKVLIVWNTAKEGLRILPIE
FT                   RVTARYSG"
FT   sig_peptide     722327..722392
FT                   /locus_tag="Nmul_A0634"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            723668..726292
FT                   /locus_tag="Nmul_A0635"
FT   CDS_pept        723668..726292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0635"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73942"
FT                   /db_xref="GOA:Q2YBC9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC9"
FT                   /protein_id="ABB73942.1"
FT                   /translation="MKRIPFALVGLLCVPSAWAMQEIEQPKQFSQKRIPVRLPATSLSM
FT                   NPAQSDTPVSSMGSETRSGMLVAEATAVTTSGQPQTGETGTGKPDKDREDKENKGGKEK
FT                   KDDIPAVQKETVFKEMVVTGETERDTHFTSPSTRVTRAQIERQNAQTTEEVLKYMPSLQ
FT                   IRQRYVGDPNGVLGIRGADMFSTARNMVYADGLPLHNFLQATFNGAPRWSLVGPNEIDS
FT                   VDVVYGPFSAEYSGNSIGGVVNIKTRMPHKQEFYVESSLFIQPFKIYGPDKGTFIGDRQ
FT                   YVSYGNRIQDKFTVFLAYNRLEAQSHPQSYFIDNTGLFDVPGGTPVSGGIRTPDTRGTP
FT                   SVIYGDTGPEKVNTHLFKGKFGYDITSNLQALFTVAYEDRTRHQNRPRNYLRDGSGNLF
FT                   WGGPAPTCAPGAPCANPENALGNASLDGTRFDVMQRGFGGSQDKRETLNLGLSLRGALT
FT                   PDWNIDTTMSYFDVLKDIRASAFFNQGDPANSGTGQLQDFRRFSWLNYDLKLSAPVLLG
FT                   NDKVSFLAGYHFDQYNLSFRQYSLTDYSTLTRGALQANRNNDGQTSMHAMFAQSTFRFL
FT                   PQWDVTAGVRQEWWAATKGVVGNLEVPDRSLAATSPKVSVGYEPGQWKYRYSFGRAHRF
FT                   PVIAELYQSLSTPTSILTANAMLKPENGVHHNFMVEYGLPKGYIRVNAFRDDIKDAIQQ
FT                   VNTVSGVVITSGFQNIGQVSTTGVELIYDQRRILGSKLDFMFNGTWMNAKVEKGPIVDF
FT                   TTSTGVPADYNLTGKQIIRLPHWRANFFGTYHMTEAWDISLSGRYTSDSFNDPDNGDHV
FT                   NNVFGSQSDFFFMDFKTSYRYKFQNGLKSRFSFGISNLNNDKAWVFHPYPQRTYLVEAA
FT                   FSY"
FT   sig_peptide     723668..723727
FT                   /locus_tag="Nmul_A0635"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(726339..727169)
FT                   /locus_tag="Nmul_A0636"
FT   CDS_pept        complement(726339..727169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0636"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73943"
FT                   /db_xref="GOA:Q2YBC8"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR025138"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC8"
FT                   /protein_id="ABB73943.1"
FT                   /translation="MNLIIQGLEIQNSDLRELAKLVDANHIERITGQAFRLENAARREE
FT                   VAAYCAEADLDFAFVDPSARLSDFGLVAMDMDSTLLAIESIDEIADMQGVKAQVAEITQ
FT                   RAMRGEIVFAESLRLRTALLEGLDEDALQRVYDERVRLSPGAEKMLQRMKSAGLKTMVI
FT                   SGGFTFFTDRVKARLDLDYAAANRFEVSNGKLTGKVLGDIIGATGKGEVLKKVREELGL
FT                   KREQVIAIGDGANDLKMMEEAGVSIAYHAKPVVQAKATYALNHVGLDGVVNLFR"
FT   gene            727670..728533
FT                   /locus_tag="Nmul_A0637"
FT   CDS_pept        727670..728533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73944"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC7"
FT                   /protein_id="ABB73944.1"
FT                   /translation="MQLLRQVLRLYRYLKMWPEKISAQVVVVLIGVNIAACSHIQKVHS
FT                   PAPEPAGNFPLAREVAQFEFGCSNLRAEREAQQQEIQRLQKLLAEKEAYIRSQEVRQQD
FT                   QQKALQETSNRAAHAQVRLRRLATRPAAASTIAEVEMVMENLKSSPFTGSELILQNQAQ
FT                   RLLDAAVSAYEGDNYAAAMDYASQAREFINMMKNNRARKVSDAHQVTVLFQMPIPLRAS
FT                   ADSKLREKPGLKAPILGVLKKESAMTAEAYRGEWLQILTADGRSGWIFSTLVEAQVAKG
FT                   IDMGVK"
FT   gene            complement(728537..730246)
FT                   /locus_tag="Nmul_A0638"
FT   CDS_pept        complement(728537..730246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0638"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73945"
FT                   /db_xref="GOA:Q2YBC6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC6"
FT                   /protein_id="ABB73945.1"
FT                   /translation="MALLKSIKSKLVVFATVASLIPSLGLGLKSIKSKLVVFATLATLI
FT                   PSLGLGLLTFRQSEAQTNANVTRELRALTDYAGREMEFWLDRRAHEAHVTAASGAVIEA
FT                   LSASYQRRADMLAKYPGALARYLQSVQGKLDAIRELTVMNASGKIIASSAEKPAGATLP
FT                   DEWPQNSVTEGLVITPPHWNEQYNTATLSVAVPVLSYDNVLMGALVAVLDLRNLQPHLK
FT                   SSSTSPPGEVFLLDPDGRVLIGTLAEGETMAQLDGPSLRELLARPGESMFFKGLTRREV
FT                   IGLADVFHEFPLTILAERDRAAVYGDWIELRNMLLILVGMLVLIVAAAAFQMGRSIVVP
FT                   LQRLMRAADRIADGDLEVRLSATRNDEIGHLTKVFDQMADRLRRNHAEIMAAHEAMQQQ
FT                   NRMLEKLSITDSLTGLYNRNKLDAILADQLARFRRTQRPFALLMLDIDHFKTLNDTYGH
FT                   ITGDKILAKVAQILLQSIRSIDYAARYGGDEFIIILVETYIDQAVKTAERIRTHVEKLT
FT                   YPAGKSTISITVSIGAVECRSDDSTTTAVFSRADNALYEAKRAGRNQAYFSR"
FT   sig_peptide     complement(730064..730246)
FT                   /locus_tag="Nmul_A0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.464 at
FT                   residue 61"
FT   gene            complement(730434..733904)
FT                   /locus_tag="Nmul_A0639"
FT   CDS_pept        complement(730434..733904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0639"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73946"
FT                   /db_xref="GOA:Q2YBC5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC5"
FT                   /protein_id="ABB73946.1"
FT                   /translation="MAFKLTIPSSGSTIRYGHFDGSSDSLALAQLALEAKKAKPVTIIT
FT                   ASALAAQRLLEEIPFFAPELRTRLLPDWETLPYDTFSPHQDLVSERLATLYQLMNGACD
FT                   ILIVPVTTALYRMPPPEYLAAHTFFLARGETLDLNALRSQMTLAGYSHVTQVLSPGEYS
FT                   VRGGLIDLFPMGSPLPYRIDLLDNEIETIRTFDVDTQRSVYPVTEIRLLPAREFPLDEE
FT                   GRTRFRGRFREKFEGDPSRSLIYKDISKGGSPAGIEYYLPLFFEHTATLFDYLPQTALL
FT                   CLHHELYQTVESFWHDTQARYQLLRGDSDRPLLKPADLFLTTEAFFGALKPYPRIEIPP
FT                   EERATKTGGAEVQGLSIPLPPLQIDRRAVNPAEKLSAFIAEFESSGGGRTLLLAESLGR
FT                   RELIADHLKQYRLNPDICDNYAQFRASTSPFVLGVGPLHNGFIYPEKGIAFVTESELYA
FT                   RHLHGRGERDSRKTSAVADAVLRDLSEIKAGDPVVHEQHGIGRYLGLVSMDLGEGETEF
FT                   LSLEYASGDKLYVPVSQLHLIGRYSGASPESAPLHKLGSGQWDKAKRKAMQQVRDTAAE
FT                   LLNIYAQRAARVGHAFRLKEQDYEAFVEGFGFEETPDQATAIAAVIDDLTSARPMDRLI
FT                   CGDVGFGKTEVALRAAFVAVADGRQVAVLVPTTLLAEQHFQNFSDRFGLIAEEWPVKIA
FT                   ELSRFRSGKEQAQALAGLADGQIDIVIGTHKLIQKGVRFKNLGLVIIDEEHRFGVRHKE
FT                   QLKSLRSEVDVLTLTATPIPRTLALSLEGLRDFSVIATAPQRRLAIKTFVNRFSEGIIR
FT                   EACLRELKRGGQIYFLHNEVSTIQTMHDKLARLLPEARIGIAHGQMRERELEHVMKDFY
FT                   QQRFNLLLCTTIIETGIDVPTANTIIIHRADKFGLAQLHQLRGRVGRSHHQAYAYLLVP
FT                   EEEALGTQARKRLEAVQSMEELGAGFYLAMHDLEIRGAGEVLGESQSGEMQEIGFTLYA
FT                   NMLEAAVRSLKEGKEPDMQHPLGVATEINLHVPALLPEDYCSDIHERLILYKRMANCTS
FT                   DEQLDEMQIELTDRFGLLPDPVKALLDCHRLRIAAAPLGIIRVEASSESIQVQFTPNPP
FT                   VDAARIVALLQRSRDYQLSGPDRLKIKTCIPEAGERVRRIMDLFTELGT"
FT   gene            complement(734129..735970)
FT                   /locus_tag="Nmul_A0640"
FT   CDS_pept        complement(734129..735970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0640"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73947"
FT                   /db_xref="GOA:Q2YBC4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC4"
FT                   /protein_id="ABB73947.1"
FT                   /translation="MPNIIVRDYPHQTFDTLIRHGFHPVLARVYSARGIEEPGQLEIDW
FT                   SRLIPFARLKNATAMAQFLATAIALRKRLLIVADYDSDGATACAVGIRALRKFGAQVDY
FT                   LVPNRFEYGYGLTPEIVRVAAAGVHRPDILITVDNGIASVEGVAEANRLGMQVLVTDHH
FT                   LPGDTLPEAAVIVNPNQPGCDFPSKHLSGVGVMFYVMLALRAELRAKGMFASPQQEPNL
FT                   GSLLDLVALGTVADVVKLDDNNRLLVQQGLKRIRKGSGCAGINALINIACRNFSQTSTY
FT                   ELGFMIGPRLNAAGRLDDMSLGIECLITDDPPRAAQLALQLDTFNRKRQEIESHMRDSA
FT                   LNMLENIFSGSSGLQDSPTLRPSDMPQRSGVFRSHDSPQEGTSAYALTLFDPGWHQGVI
FT                   GILASRIKDKFHRPVITFAPGGQDELKGSGRSIPGFHLRDALDLVSKRYPGLLLKFGGH
FT                   SAAAGLTIRTCDFEKFRAAFEQTARELLGPADLKRVIETDGDLDESEITLELAEQLVRQ
FT                   VWGQGFPQPAFRSRFHVEDQRVVGQKHLKLKLRKARPAAGNNPPEKPVLLYDAILFLQD
FT                   GPLPGVIDAVYRLQVNDFKSDVSLQFILEHWSEATMM"
FT   gene            complement(736043..737203)
FT                   /locus_tag="Nmul_A0641"
FT   CDS_pept        complement(736043..737203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73948"
FT                   /db_xref="InterPro:IPR009599"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC3"
FT                   /protein_id="ABB73948.1"
FT                   /translation="MRYLNIIAAMLFFTSTVHAAVTEDAYIAGYAAGVLKHGFGMEIPT
FT                   LVVKDGIITVPEDKLKSENQAQVVQALSKIPGVTGVTIAEKSVSRIAEREAFKPIQHPS
FT                   AISREPGAATTETAGVPAAGPTVLATGMLPEGHLFKPLLADPRWAHFSAAYRNYVGNNI
FT                   DGNNNAAVSFGETIPFYRANFGQSTVQWEAGLQAAVFSDFNLGAPSSDLINSDFIASAY
FT                   GSVRAGHFSAFGRIYHQSSHLGDELLLRRLTSLQRINLSYEGADLRLSYELPYGLRVYG
FT                   GGGGIFHKEPSNIKPWSIQYGVEFRSPWRIAFLPLRPIVAVDLKNHQQNDWNADVSARA
FT                   GVQLDHFRAFGRNLQFLVEYFHGNSPTGQFFRQRVDYLGIGAHYHF"
FT   sig_peptide     complement(737144..737203)
FT                   /locus_tag="Nmul_A0641"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            737586..737843
FT                   /locus_tag="Nmul_A0642"
FT   CDS_pept        737586..737843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73949"
FT                   /db_xref="GOA:Q2YBC2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC2"
FT                   /protein_id="ABB73949.1"
FT                   /translation="MATSALKSSNDFTQFWPSVVVVAGYAVAFFFLSLALRTLSVESHT
FT                   LSGLAPVSSSYRSSPGPFPGKRSMVPPFWVSRSLLPVSLS"
FT   gene            738138..739229
FT                   /locus_tag="Nmul_A0643"
FT   CDS_pept        738138..739229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73950"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBC1"
FT                   /protein_id="ABB73950.1"
FT                   /translation="MMSIRRIVWQLSMCAGITLSTNAYAIALFQSESVAPAALQSEYHV
FT                   SWVRREADDPEGTGGHSTHPSWNGSPNFLLPLASGYFDILSPFENFASPSTALYLTLLR
FT                   GDEAFGVNIAGFTNDEAGLVNMLALPDLFMQAQWQPAEGNSQTTPFTPHSNSGNMARAR
FT                   NTPHACAQLREVRRNRLELRDDDCIGLGGGSEGNGNANRNGSKAGGGSNAIIARNKNAR
FT                   DSNAGDGAYTGGGGGGGGGAGGGTPGTGEKGNGGMSPPDSNNSEPDNGSEGNAGGTEGA
FT                   VSNHGNENGGTGEGGNGGTGGGDGSGGNGGTGNWNNPDEGEGPPPSEVTEVTPLPEPAT
FT                   LALLALGLAALCAVRRNQGKIAD"
FT   sig_peptide     738138..738215
FT                   /locus_tag="Nmul_A0643"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.784 at
FT                   residue 26"
FT   gene            complement(739575..739994)
FT                   /locus_tag="Nmul_A0644"
FT   CDS_pept        complement(739575..739994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0644"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73951"
FT                   /db_xref="GOA:Q2YBC0"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBC0"
FT                   /protein_id="ABB73951.1"
FT                   /translation="MPSRPDKNLETFPNPTQERDYHIHMEIPEFTCLCPKTGQPDFATL
FT                   ILDYIPDKKCVELKSLKLYIWSFRDENAFHEAVTNRIVDDLATALQPRYLRLTAKFYVR
FT                   GGIFTTVVAEHRHSGWTPLPSVDLFHFDSQPSTRG"
FT   gene            740138..743710
FT                   /locus_tag="Nmul_A0645"
FT   CDS_pept        740138..743710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0645"
FT                   /product="condensin subunit Smc"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73952"
FT                   /db_xref="GOA:Q2YBB9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBB9"
FT                   /protein_id="ABB73952.1"
FT                   /translation="MRLSHIKLAGFKSFVDPTEIPFPGDLVGVVGPNGCGKSNVIDAVR
FT                   WVLGESRASALRGESMQDVIFNGSTTRKPVGRASVELAFDNSLGKAAGQWSSYAEICIK
FT                   RVLRRDGESTYYINNIHVRRRDIADIFLGTGLGGRGYAIIEQGMISRIIEAKPEELRVF
FT                   LEEAAGISKYRERRRETESRLADTRENLLRVNDICQELEKQLVRLGQQAETARRFEDLQ
FT                   SRLDKAQNLLWFARKQEAASQRALAEKEIQSLQTTLEAEAAALRRAEKQLEEKRADHFA
FT                   ASDLLHDAQGELYAANAEVAYTEQQIQHVRENYQRIAQQIAATRHQLEHYATQADTSVD
FT                   SLNRWHEEYKQARSDSEASKQKATVENEKLPLAEAAFRTRQEKLAEVQRDLLLAEQSEQ
FT                   LEKSHRDHAEKALQQLEMRRKRLLVEYAALPESKVEELSELTREAEATAHDLKQKQEEF
FT                   AQTENLLLDAEEVKREFARNVQALEQQVVQAEARLSALQRLQGRLESSEGLNTWFARHR
FT                   LDSLPRLWQGIQIEKGWEDALEAVLRERLNGTRVGQLEVALEWANPPPGKCALFEPAEM
FT                   KLQKTTKAGKIAGAEGGGGKPPRDGEAGVALRSYLTCSDTSVKSVVDEWLSGIFAIDSL
FT                   EAGLSRRNLLSPGEMLVTREGCVVTSHSLTFYSPDSQLHGVLARQREIGQIEVEMEALR
FT                   AKLDIEQSALDTAGDTCYDLESSLSSLRHENEQLQQLHHNVQMQALKLTQTVERSEQRR
FT                   KQIDSDLAEIEQHAEAEASRQCSAEARLAEHGVRIKFLQEQVRTEQLARDTAEESLTGQ
FT                   RRLAQNASREMQEAIFHEKTCEHKIAEAENAIEGIERSVGELKAHLEKLQVEQDSFDEG
FT                   ELVGVLEERLTLREQREQKLAEARNALEALATELRQIEQERMASEQKLHPLREAINHMR
FT                   LKEQEARITENQFGEQLQGCEIPEEELINSLGKTRPAALQSEVNRLRGDITALGPVNTA
FT                   ALEELESCQTRKTYLDSQARDLEEASETLRNAIRRIDRETRERLLETVEKVNAHLGDMF
FT                   PTIFGGGHAKLMLRGEEILDAGVQIVAQPPGKKNSSIHLLSGGEKALTALAFVFSLFQL
FT                   NPAPFCMLDEVDAPLDDSNTERFCNLVRKMSRQTQFVFISHNKIAMEMAQQLIGVTMQE
FT                   KGVSRVVAVEIEEAVRLGDTALAT"
FT   gene            743718..745043
FT                   /locus_tag="Nmul_A0646"
FT   CDS_pept        743718..745043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0646"
FT                   /product="ZipA, C-terminal FtsZ-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73953"
FT                   /db_xref="GOA:Q2YBB8"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YBB8"
FT                   /protein_id="ABB73953.1"
FT                   /translation="MGNLSELQISLIGIGIVVVLGVIVFNWTQQRRYRRKAEQAFSREH
FT                   EDILLGASASVKGEERIEPRLSPGAEPHEPEAAPSRHSNASPEVAEPAQKVNVNPALHP
FT                   PSRPKAGKAVERTWFKGPASFTVPARRSGDEDSRHEGGVVPERFSVPAAASGDEERPVE
FT                   GDNVSDAVDYVVEIARETPFADLTLAEVLDRKFDFSKPVRWMGKQSADASWEEIVTDTR
FT                   GREGRASYVSLKGFLQLADRAGPVSEVSLGEFRDMAENFAARVNATARCPDIYKSYRRA
FT                   LMLDEFCTQVDVMAGINIISRDNSVFTGAKIRVMAEACGFKLGNEGMFHYRDENNVVLF
FT                   SLGNYEPSPFLPDNIRTLTTRGITLFLDVPRVANGERIFNQMVHLAETFSEALGGFMVD
FT                   DNRVPLSDTGIRKIKQQLSSIQSVMISRNIPPGGQIALRLFA"
FT   gene            745040..747163
FT                   /locus_tag="Nmul_A0647"
FT   CDS_pept        745040..747163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nmul_A0647"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nmul_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABB73954"
FT                   /db_xref="GOA:Q2YBB7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2YBB7"
FT                   /protein_id="ABB73954.1"
FT                   /translation="MSERLSEISRHMRELRDAIELHNIRYYELDTPTIPDADFDKLFRE
FT                   LEELEQRHPELITPDSPTQRVGIPPLKAFPQVVHRTPMLSLSNAFTEGEVEAFDRRVRQ
FT                   SLGIAQVEYAVEPKFDGLAISLCYENGMLVSGATRGDGYIGEDVTLNLKTIRSIPLGLR
FT                   AGDGSAEVPAFLEVRGEVLMLKADFERLNRQQREKNEKTFINPRNAAAGSLRQLDPCIT
FT                   ANRNLRFFAYGIGVCEGGNVPHDTHSHLLDYLSSLRFPVMRERRTVTGVAGLLEYHHEI
FT                   NGLREQLSYDIDGTVYKVNELEYQEKLGFVSRAPRFALAHKFPAQEATTELLGIDVQVG
FT                   RTGALTPVARLKPVFVGGATVTNATLHNEDEIRRKDVMIGDRVTVRRAGDVIPEVVAVQ
FT                   KESRPSNAKPFVMPEHCPVCGSRTIRLPGETLTRCTGGLFCPAQRKQAILHFASRRAMN
FT                   IHGLGDKLVDHLVDNAIIRTPADLYKLGLAALAALDRMGEKSAGNIINEIEKSKDTTLA
FT                   RFIYSLGIRNVGEATARDLARYFGGLDRLMDADVETLQQVSDVGPVVAQSIADFFGERH
FT                   NREVVEQLRAAGIRWKEGAGTQTTDHAAGSAHPGAAAASSKIAGRSFVLTGTLPTMSRE
FT                   EAREKIEAMGGKVAGSVSKKTDYVVAGADAGSKYDKALELGVALLDEAELIRLLQASQA
FT                   DNSSTHVDPERMV"
FT   gene            747163..748047
FT                   /locus_tag="Nmul_A0648"
FT   CDS_pept        747163..748047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locu