(data stored in ACNUC28527 zone)

EMBL: CP000110

ID   CP000110; SV 1; circular; genomic DNA; STD; PRO; 2510659 BP.
XX
AC   CP000110;
XX
PR   Project:PRJNA13643;
XX
DT   28-OCT-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Synechococcus sp. CC9605, complete genome.
XX
KW   .
XX
OS   Synechococcus sp. CC9605
OC   Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae; Synechococcus;
OC   unclassified Synechococcus.
XX
RN   [1]
RP   1-2510659
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Schmutz J., Martinez M., Larimer F.,
RA   Land M., Kyrpides N., Ivanova N., Richardson P.;
RT   "Complete sequence of Synechococcus sp. CC9605";
RL   Unpublished.
XX
RN   [2]
RP   1-2510659
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Schmutz J., Martinez M., Larimer F.,
RA   Land M., Ivanova N., Richardson P.;
RT   ;
RL   Submitted (27-JUL-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598,
RL   USA
XX
DR   MD5; 295b07e748032e4567e72e0f5682faea.
DR   BioSample; SAMN02598311.
DR   EnsemblGenomes-Gn; EBG00001067968.
DR   EnsemblGenomes-Gn; EBG00001067970.
DR   EnsemblGenomes-Gn; EBG00001067973.
DR   EnsemblGenomes-Gn; EBG00001067975.
DR   EnsemblGenomes-Gn; EBG00001067977.
DR   EnsemblGenomes-Gn; EBG00001067979.
DR   EnsemblGenomes-Gn; EBG00001067981.
DR   EnsemblGenomes-Gn; EBG00001067983.
DR   EnsemblGenomes-Gn; EBG00001067985.
DR   EnsemblGenomes-Gn; EBG00001067987.
DR   EnsemblGenomes-Gn; EBG00001067989.
DR   EnsemblGenomes-Gn; EBG00001067991.
DR   EnsemblGenomes-Gn; EBG00001067993.
DR   EnsemblGenomes-Gn; EBG00001067996.
DR   EnsemblGenomes-Gn; EBG00001067998.
DR   EnsemblGenomes-Gn; EBG00001068000.
DR   EnsemblGenomes-Gn; EBG00001068002.
DR   EnsemblGenomes-Gn; EBG00001068004.
DR   EnsemblGenomes-Gn; EBG00001068006.
DR   EnsemblGenomes-Gn; EBG00001068008.
DR   EnsemblGenomes-Gn; EBG00001068010.
DR   EnsemblGenomes-Gn; EBG00001068012.
DR   EnsemblGenomes-Gn; EBG00001068014.
DR   EnsemblGenomes-Gn; EBG00001068016.
DR   EnsemblGenomes-Gn; EBG00001068018.
DR   EnsemblGenomes-Gn; EBG00001068020.
DR   EnsemblGenomes-Gn; EBG00001068022.
DR   EnsemblGenomes-Gn; EBG00001068024.
DR   EnsemblGenomes-Gn; EBG00001068026.
DR   EnsemblGenomes-Gn; EBG00001068028.
DR   EnsemblGenomes-Gn; EBG00001068030.
DR   EnsemblGenomes-Gn; EBG00001068032.
DR   EnsemblGenomes-Gn; EBG00001068034.
DR   EnsemblGenomes-Gn; EBG00001068036.
DR   EnsemblGenomes-Gn; EBG00001068038.
DR   EnsemblGenomes-Gn; EBG00001068040.
DR   EnsemblGenomes-Gn; EBG00001068042.
DR   EnsemblGenomes-Gn; EBG00001068044.
DR   EnsemblGenomes-Gn; EBG00001068045.
DR   EnsemblGenomes-Gn; EBG00001068046.
DR   EnsemblGenomes-Gn; EBG00001068048.
DR   EnsemblGenomes-Gn; EBG00001068049.
DR   EnsemblGenomes-Gn; EBG00001068050.
DR   EnsemblGenomes-Gn; EBG00001068052.
DR   EnsemblGenomes-Gn; EBG00001068054.
DR   EnsemblGenomes-Gn; EBG00001068056.
DR   EnsemblGenomes-Gn; EBG00001068058.
DR   EnsemblGenomes-Gn; EBG00001068060.
DR   EnsemblGenomes-Gn; EBG00001068062.
DR   EnsemblGenomes-Gn; EBG00001068064.
DR   EnsemblGenomes-Gn; EBG00001068066.
DR   EnsemblGenomes-Gn; EBG00001068068.
DR   EnsemblGenomes-Gn; EBG00001068069.
DR   EnsemblGenomes-Gn; EBG00001068070.
DR   EnsemblGenomes-Gn; EBG00001068072.
DR   EnsemblGenomes-Gn; EBG00001068074.
DR   EnsemblGenomes-Gn; EBG00001068075.
DR   EnsemblGenomes-Gn; EBG00001068077.
DR   EnsemblGenomes-Gn; EBG00001068079.
DR   EnsemblGenomes-Gn; EBG00001068081.
DR   EnsemblGenomes-Gn; EBG00001068083.
DR   EnsemblGenomes-Gn; EBG00001068085.
DR   EnsemblGenomes-Gn; EBG00001068087.
DR   EnsemblGenomes-Gn; EBG00001068089.
DR   EnsemblGenomes-Gn; EBG00001068091.
DR   EnsemblGenomes-Gn; EBG00001068093.
DR   EnsemblGenomes-Gn; EBG00001068095.
DR   EnsemblGenomes-Gn; EBG00001068097.
DR   EnsemblGenomes-Gn; EBG00001068099.
DR   EnsemblGenomes-Gn; Syncc9605_R0001.
DR   EnsemblGenomes-Gn; Syncc9605_R0002.
DR   EnsemblGenomes-Gn; Syncc9605_R0004.
DR   EnsemblGenomes-Gn; Syncc9605_R0005.
DR   EnsemblGenomes-Gn; Syncc9605_R0006.
DR   EnsemblGenomes-Gn; Syncc9605_R0007.
DR   EnsemblGenomes-Gn; Syncc9605_R0008.
DR   EnsemblGenomes-Gn; Syncc9605_R0009.
DR   EnsemblGenomes-Gn; Syncc9605_R0010.
DR   EnsemblGenomes-Gn; Syncc9605_R0011.
DR   EnsemblGenomes-Gn; Syncc9605_R0012.
DR   EnsemblGenomes-Gn; Syncc9605_R0013.
DR   EnsemblGenomes-Gn; Syncc9605_R0014.
DR   EnsemblGenomes-Gn; Syncc9605_R0015.
DR   EnsemblGenomes-Gn; Syncc9605_R0016.
DR   EnsemblGenomes-Gn; Syncc9605_R0017.
DR   EnsemblGenomes-Gn; Syncc9605_R0018.
DR   EnsemblGenomes-Gn; Syncc9605_R0019.
DR   EnsemblGenomes-Gn; Syncc9605_R0020.
DR   EnsemblGenomes-Gn; Syncc9605_R0021.
DR   EnsemblGenomes-Gn; Syncc9605_R0022.
DR   EnsemblGenomes-Gn; Syncc9605_R0023.
DR   EnsemblGenomes-Gn; Syncc9605_R0024.
DR   EnsemblGenomes-Gn; Syncc9605_R0025.
DR   EnsemblGenomes-Gn; Syncc9605_R0026.
DR   EnsemblGenomes-Gn; Syncc9605_R0027.
DR   EnsemblGenomes-Gn; Syncc9605_R0029.
DR   EnsemblGenomes-Gn; Syncc9605_R0030.
DR   EnsemblGenomes-Gn; Syncc9605_R0031.
DR   EnsemblGenomes-Gn; Syncc9605_R0032.
DR   EnsemblGenomes-Gn; Syncc9605_R0033.
DR   EnsemblGenomes-Gn; Syncc9605_R0034.
DR   EnsemblGenomes-Gn; Syncc9605_R0035.
DR   EnsemblGenomes-Gn; Syncc9605_R0036.
DR   EnsemblGenomes-Gn; Syncc9605_R0037.
DR   EnsemblGenomes-Gn; Syncc9605_R0038.
DR   EnsemblGenomes-Gn; Syncc9605_R0039.
DR   EnsemblGenomes-Gn; Syncc9605_R0040.
DR   EnsemblGenomes-Gn; Syncc9605_R0041.
DR   EnsemblGenomes-Gn; Syncc9605_R0042.
DR   EnsemblGenomes-Gn; Syncc9605_R0043.
DR   EnsemblGenomes-Gn; Syncc9605_R0044.
DR   EnsemblGenomes-Gn; Syncc9605_R0045.
DR   EnsemblGenomes-Gn; Syncc9605_R0046.
DR   EnsemblGenomes-Gn; Syncc9605_R0047.
DR   EnsemblGenomes-Gn; Syncc9605_R0048.
DR   EnsemblGenomes-Gn; Syncc9605_R0049.
DR   EnsemblGenomes-Gn; Syncc9605_R0050.
DR   EnsemblGenomes-Gn; Syncc9605_R0051.
DR   EnsemblGenomes-Gn; Syncc9605_R0052.
DR   EnsemblGenomes-Gn; Syncc9605_R0053.
DR   EnsemblGenomes-Gn; Syncc9605_R0054.
DR   EnsemblGenomes-Tr; EBT00001670053.
DR   EnsemblGenomes-Tr; EBT00001670056.
DR   EnsemblGenomes-Tr; EBT00001670058.
DR   EnsemblGenomes-Tr; EBT00001670060.
DR   EnsemblGenomes-Tr; EBT00001670062.
DR   EnsemblGenomes-Tr; EBT00001670064.
DR   EnsemblGenomes-Tr; EBT00001670066.
DR   EnsemblGenomes-Tr; EBT00001670069.
DR   EnsemblGenomes-Tr; EBT00001670070.
DR   EnsemblGenomes-Tr; EBT00001670073.
DR   EnsemblGenomes-Tr; EBT00001670074.
DR   EnsemblGenomes-Tr; EBT00001670076.
DR   EnsemblGenomes-Tr; EBT00001670078.
DR   EnsemblGenomes-Tr; EBT00001670080.
DR   EnsemblGenomes-Tr; EBT00001670081.
DR   EnsemblGenomes-Tr; EBT00001670083.
DR   EnsemblGenomes-Tr; EBT00001670085.
DR   EnsemblGenomes-Tr; EBT00001670086.
DR   EnsemblGenomes-Tr; EBT00001670088.
DR   EnsemblGenomes-Tr; EBT00001670090.
DR   EnsemblGenomes-Tr; EBT00001670093.
DR   EnsemblGenomes-Tr; EBT00001670094.
DR   EnsemblGenomes-Tr; EBT00001670095.
DR   EnsemblGenomes-Tr; EBT00001670097.
DR   EnsemblGenomes-Tr; EBT00001670099.
DR   EnsemblGenomes-Tr; EBT00001670100.
DR   EnsemblGenomes-Tr; EBT00001670102.
DR   EnsemblGenomes-Tr; EBT00001670104.
DR   EnsemblGenomes-Tr; EBT00001670107.
DR   EnsemblGenomes-Tr; EBT00001670108.
DR   EnsemblGenomes-Tr; EBT00001670110.
DR   EnsemblGenomes-Tr; EBT00001670112.
DR   EnsemblGenomes-Tr; EBT00001670114.
DR   EnsemblGenomes-Tr; EBT00001670116.
DR   EnsemblGenomes-Tr; EBT00001670118.
DR   EnsemblGenomes-Tr; EBT00001670123.
DR   EnsemblGenomes-Tr; EBT00001670126.
DR   EnsemblGenomes-Tr; EBT00001670128.
DR   EnsemblGenomes-Tr; EBT00001670130.
DR   EnsemblGenomes-Tr; EBT00001670132.
DR   EnsemblGenomes-Tr; EBT00001670134.
DR   EnsemblGenomes-Tr; EBT00001670136.
DR   EnsemblGenomes-Tr; EBT00001670138.
DR   EnsemblGenomes-Tr; EBT00001670140.
DR   EnsemblGenomes-Tr; EBT00001670143.
DR   EnsemblGenomes-Tr; EBT00001670144.
DR   EnsemblGenomes-Tr; EBT00001670146.
DR   EnsemblGenomes-Tr; EBT00001670148.
DR   EnsemblGenomes-Tr; EBT00001670150.
DR   EnsemblGenomes-Tr; EBT00001670152.
DR   EnsemblGenomes-Tr; EBT00001670153.
DR   EnsemblGenomes-Tr; EBT00001670154.
DR   EnsemblGenomes-Tr; EBT00001670155.
DR   EnsemblGenomes-Tr; EBT00001670156.
DR   EnsemblGenomes-Tr; EBT00001670157.
DR   EnsemblGenomes-Tr; EBT00001670158.
DR   EnsemblGenomes-Tr; EBT00001670159.
DR   EnsemblGenomes-Tr; EBT00001670160.
DR   EnsemblGenomes-Tr; EBT00001670161.
DR   EnsemblGenomes-Tr; EBT00001670162.
DR   EnsemblGenomes-Tr; EBT00001670163.
DR   EnsemblGenomes-Tr; EBT00001670164.
DR   EnsemblGenomes-Tr; EBT00001670165.
DR   EnsemblGenomes-Tr; EBT00001670166.
DR   EnsemblGenomes-Tr; EBT00001670167.
DR   EnsemblGenomes-Tr; EBT00001670168.
DR   EnsemblGenomes-Tr; EBT00001670169.
DR   EnsemblGenomes-Tr; EBT00001670170.
DR   EnsemblGenomes-Tr; EBT00001670171.
DR   EnsemblGenomes-Tr; Syncc9605_R0001-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0002-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0004-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0005-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0006-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0007-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0008-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0009-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0010-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0011-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0012-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0013-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0014-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0015-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0016-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0017-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0018-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0019-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0020-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0021-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0022-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0023-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0024-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0025-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0026-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0027-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0029-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0030-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0031-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0032-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0033-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0034-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0035-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0036-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0037-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0038-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0039-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0040-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0041-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0042-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0043-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0044-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0045-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0046-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0047-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0048-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0049-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0050-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0051-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0052-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0053-1.
DR   EnsemblGenomes-Tr; Syncc9605_R0054-1.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC3390001; 22768379.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01702; Cyano-2.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01716; PhotoRC-I.
DR   RFAM; RF01752; psaA.
DR   RFAM; RF01753; psbNH.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000110.
DR   SILVA-SSU; CP000110.
DR   StrainInfo; 825423; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Brian Palenik
CC   (bpalenik@ucsd.edu)
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2510659
FT                   /organism="Synechococcus sp. CC9605"
FT                   /strain="CC9605"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:110662"
FT   gene            231..1388
FT                   /locus_tag="Syncc9605_0001"
FT   CDS_pept        231..1388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33783"
FT                   /db_xref="GOA:Q3ANP9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33783.1"
FT                   /translation="MKVVCSQSELNGALQLVSRAVATRPTHPVLANVLLTADAGSNRLS
FT                   LTGFDLSLGIQTSLAASVEISGAITLPARLLGEIVSRLSSDSPVTLAVDDSGEQVQLTS
FT                   LSGSYQMRGMSADDYPDLPMVESGMTLKLQPERLVQALKGTLFASSADEAKQLLTGVHL
FT                   KFNQRALEAAATDGHRLAVLNVEDALQDEAVTDAVDDDGFAVTLPSRSLREVERLMASW
FT                   RSDEPVSLFCDRGQVVFLAADQMVTSRTLEGTYPNYGQLIPDGFARTFGMDRRALIAAL
FT                   ERIAVLADQHNNVVKFSSQPEDGVVQISADAQDVGSGSESLPANLEGDAMQIAFNVRYL
FT                   LDGLKAMGSDRIVLHCNAPTTPAVLRSDDASEAFTYLVMPVQIRS"
FT   gene            1390..2145
FT                   /locus_tag="Syncc9605_0002"
FT   CDS_pept        1390..2145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33784"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33784.1"
FT                   /translation="MSLPDQLLLSDLLSHTVRCDLGLDHGPGVMAWMHPPVHRLLGWVS
FT                   RPSALRMSRDVWRLNQCCGLSDQQVFVRGEPAVTDQVTLERLPTLMDAALLDRDGERIG
FT                   SVVDLDFRPADGAILHYLIARSDPRLPGSSRWRLAPDRILDQQPGQIQTGLMGLDDLPM
FT                   ARASVRQDLLQRTQHWRDQLRSMGDRATDRLEGWLDDSPIDELRSESVRSTADDDVEPE
FT                   GVSGPEVWDEESWDETSSRRRREDEDPWV"
FT   gene            2186..4492
FT                   /locus_tag="Syncc9605_0003"
FT   CDS_pept        2186..4492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0003"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33785"
FT                   /db_xref="GOA:Q3ANP7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33785.1"
FT                   /translation="MVSSPAYDIAAALKQEGLKPSDWDEICRRLGREPNRAELGMFGVM
FT                   WSEHCCYRNSRPLLSGFPTEGPRILVGPGENAGVVDLGGGHRLAFKIESHNHPSAVEPF
FT                   QGAATGVGGILRDIFTMGARPIALLNALRFGPLEDPANVGLMEGVVAGIAHYGNCVGVP
FT                   TVGGEVAFDPSYSGNPLVNAMALGLMETEEIVKSGAIGVGNPVVYVGSTTGRDGMGGAS
FT                   FASAELSADSLDDRPAVQVGDPFLEKGLIEACLEAFASGDVVAAQDMGAAGLTCSCSEM
FT                   AAKGGLGVELDLDRVPARETGMTAYEFLLSESQERMLFVVKAGREDALMQRFRRWGLQA
FT                   ALVGKVLQEPIVRVLHHGAVAAEVPATALADDTPIEKHALLQEPPADLQALWGWTEQEL
FT                   PVLSDAAAALLQLLDDPTIASKQWVHRQYDQQVLANTVVSSGAADAAVVRLRPQQGNGS
FT                   MAASNRGVAATVDCPNRWVALDPERGAQAAVAEAARNLSCVGAEPLAVTDNLNFPSPET
FT                   PKGFWQLAMACRGISDACRTLNTPVTGGNVSLYNETKQDDGTMQPIHPTPVIGMVGGVD
FT                   DISRVTCLAWQQPGDAIFLIGVPPEDGADPSLGLAGSAYQQQTLGSLAGRPPKPDLAIE
FT                   AAVGSLVREAIAQGLLASAHDCSDGGLAVALAESCIASDLGISVTLSTGSARLERVLFA
FT                   EGGSRVIVSVNAASFPAWEQLIGSNPALCVTQLGSVTLEARLVIRSESAVQLDLEVERC
FT                   AAVFRDALPRRMHSE"
FT   gene            4554..6011
FT                   /locus_tag="Syncc9605_0004"
FT   CDS_pept        4554..6011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0004"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33786"
FT                   /db_xref="GOA:Q3ANP6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33786.1"
FT                   /translation="MCGIIGMLCVDSVNQQIYDNLLLLQHRGQDSAGIVTMDNHTFHVH
FT                   KQRGRVREAFRTRDMRKLLGNAGIGHVRYATRGAAASEEEVQPFYVNAPYGITFVHNGN
FT                   LTNTHQLEQDLFKIDRRHTNSTSDTEMLVNVLATEIQSQLTGRDLTPDQLFNAVASLHH
FT                   RVQGSYAAIALIAGHGMLAFRDPYGIRPLILGRRLSEQGREEWIVASESLVIENSGYEI
FT                   VRDVDPGEAVFIDVDSNLHQRQCADSPRLIPCAFEYVYLARPDSVMNGISVYESRLRMG
FT                   DRLAQTIAETLPAGDIDVVMPIPDSARPSAMQVAKRLGLDYREGFYKNRYVGRTFIMPG
FT                   QAERKKSVRQKLNALGTEFAGKNVLIVDDSIVRGTTSREIVQMARSAGANKVTFTSAAP
FT                   PVRYPNVYGINMPTRAELLAHGRTSDEISDVLGADHVVYQTVENLLESIVENTEIKDLE
FT                   MSCFDGHYVTGGIDEDYFQWLERNCSS"
FT   gene            complement(6019..8487)
FT                   /locus_tag="Syncc9605_0005"
FT   CDS_pept        complement(6019..8487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0005"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33787"
FT                   /db_xref="GOA:Q3ANP5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33787.1"
FT                   /translation="MAEERVQPIALHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRR
FT                   ILYAMQELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFSSRHPLLDGH
FT                   GNFGSVDDDPPAAMRYTETRLAPISHQAMLEEIGEDTVDFAPNFDGSQQEPTVLPAQLP
FT                   FLLLNGCSGIAVGMATSIPPHNLGEVVDGLVALIRKPELSDEKLLELIPGPDFPTGGEV
FT                   LISSGLRDTYLHGRGSIPMRGVAHTEEVQPGKGRHKRNAVVVTELPYQLSKAGWIEKLA
FT                   ESVNDGKIGGIADIRDESDREGMRVVVELRRDADPGKVLKDLQRRTALQSNFGAILLAL
FT                   VDGQPQQLSLRQLLQTFLDFRELTLIRRTSHALRKTEDRLEVVEGLITALNNLQAVIAM
FT                   IQEANDAASARASLMVRLDLSERQADAVLAMPLRRLTGLEQESLRQELDELRAKRQRLK
FT                   LLLDNRDQLLDAMVTELKGLKKRFSTPRRTRLVEGGDALMAERAASQRPNTELLRQQAL
FT                   AALPGDGRVLIQADGQVKIFTPQVLGRLHLNDPCPVGDAPSPARVILPIEPPPRLLAVS
FT                   AGGRIAQVRWEFAGQQPGPIDRFLPTGLDGDPIVSLLSLPSQNIDELSLGLLSSDGRFK
FT                   RLPVSEVVDLSGRATSVLKLKEGVELNNAVICRNQGTLVLISDIGRLLRLRINEESLPL
FT                   MGRLAQGPMTMRLLPGEQIVGAVCTEQAPLMLFSQRGMIGRIDCSGMRYNQRGDLGSMA
FT                   VQVDAESDRLVGVSAGPGLVGVRTSKDRHGRLNPDNITISKPGDKLMEKMSLQSGETIV
FT                   EVINAIQPNP"
FT   gene            complement(8533..9414)
FT                   /locus_tag="Syncc9605_0006"
FT   CDS_pept        complement(8533..9414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33788"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33788.1"
FT                   /translation="MLRRIGLRRTLAAALVVLGSWFGAPSANALIPYVYLPTEEELKGS
FT                   SIGIGRTAAQLLQLGQAKDAARLAALAVRLNPNDERFWSILAEAQLRNNNLQDASRSLA
FT                   RAKQLNPEKAGLWFAEAAIALRAERPDYAVPLITRGLQLDPDNAPAYFDLGNARIMQGE
FT                   LPLALKSFERATALKPEFWEALNNQALVLFEMGQRQEAVRRWRRVLKLENNAEPMLALA
FT                   AALHQRCEQSEAIQLAATALAKNPNYVLPLHQAEQLWGVRIRQATAQLLSEPQLTNSVE
FT                   RAQANATWKKNQ"
FT   sig_peptide     complement(9325..9414)
FT                   /locus_tag="Syncc9605_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 30"
FT   gene            complement(9434..10399)
FT                   /locus_tag="Syncc9605_0007"
FT   CDS_pept        complement(9434..10399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0007"
FT                   /product="4Fe-4S cluster binding"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33789"
FT                   /db_xref="GOA:Q3ANP3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33789.1"
FT                   /translation="MQGHVTDQQTRLSEALKRRAAEEGFNPVGIARIPGSPRLQLRTKA
FT                   LQRWLDHGHQADMAWMAAPRRRDPRLLLDGANSVLAVGLNYYVDAQPSPGSLKVARYGW
FT                   GRDYHRVVDQRLRRIGRWLSEQRPDCGWRACVDATPLLDKAWAEEAGLGWIGKHSNLIH
FT                   PERGSWMVIGHLLTTEPLNADPPARSLCGRCSACIDACPTHAIREPFVVDARRCLAFHT
FT                   IENREDDLPENIRAALGSWVAGCDICQDVCPWNHRSLPQSNDPDMQPRPWLLNLHKEEI
FT                   QTWDDSVWEQKLRGSALRRIKPWMWRRNAAAAQPDPTPTL"
FT   gene            10436..11083
FT                   /locus_tag="Syncc9605_0008"
FT   CDS_pept        10436..11083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33790"
FT                   /db_xref="GOA:Q3ANP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33790.1"
FT                   /translation="MTSTETGRLASLLRWLGLTLVVILVLQMLAVLVGVDWGADAPRPQ
FT                   VTGPLVALAPLGFAGLLICLIGSRLDHPRQQRTPLRLLIAVLSALLAFGMVIAVPMSLD
FT                   GGAGDVARQQNLEQGREALKDARAFRADAAQVTSLGEQLAQAGQLAADATEDDKLRAAQ
FT                   KMVDDQIAQMEAQLKTFEAGQARESQQRFIGGTISAVVLAIAFALLAFTAVL"
FT   gene            11134..11868
FT                   /locus_tag="Syncc9605_0009"
FT   CDS_pept        11134..11868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33791"
FT                   /db_xref="GOA:Q3ANP1"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33791.1"
FT                   /translation="MVQSNPRPDLPLSARLRQDLKNDLIAGLLVVIPLATTIWLSTIVS
FT                   RFVLAFLTSIPKQFNPFITLNPLLQDLINLALGLTVPLMGILLIGLMARNIVGRWLLEF
FT                   GEGTLSRIPLAGSVYKTLKQLLETFFRDNSSRFRRVVLVEYPREGLFSVGFVTGEVGPS
FT                   LKSDLKEPLLSVFIPTAPNPTTGWYTLVPAGSVRELEISVEEAFRTIISAGIVNPDDRE
FT                   APVNRSFSSLMAQLRASASPSS"
FT   gene            11872..12507
FT                   /locus_tag="Syncc9605_0010"
FT   CDS_pept        11872..12507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0010"
FT                   /product="NusB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33792"
FT                   /db_xref="GOA:Q3ANP0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33792.1"
FT                   /translation="MATRSLTRELALLVLGQVPEQRSASVADLALDSILDQALDTLTQH
FT                   WRESLDASAAELDQAQQSLLDSELQQGEPGTHDTVRTHLRASLSSAEQVLNGLSASLEL
FT                   PRLLLLGDQEQIRRGAMERVQKVLTQREGIDKRLDQVMEGWRLTRLPRIDRDILRLAVV
FT                   DLESLRTPAPVAFNEAVELANRYSDEQGRRMINGVLRRFHDAQSKASA"
FT   gene            12507..14045
FT                   /locus_tag="Syncc9605_0011"
FT   CDS_pept        12507..14045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0011"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33793"
FT                   /db_xref="GOA:Q3ANN9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33793.1"
FT                   /translation="MVFNWFERQAEESLKPEPTPTPAPTPEPTDAGTEAPVSAAPEPTP
FT                   APAATEEEDEALVWAREAYARLKAQQHAAASVVEVAPESTPAPSPEPAPTPPPTPTPTS
FT                   TPGPAPLPTPSLSPLPTPSPAPAPGLSLLEQAAAQRQQRQQDLDQRAVEAPPAPTPAPT
FT                   PAPVVDSEEPQLGDFDQDFTWSAEVLAAQGRRVDQVSLEEIDWLGRLRRGLEKTRQGFV
FT                   TSLLENLGDDPLTPEVLDDLETLLLRADAGVQATDQVLDALRQRMNEEVVDPAEGIRFL
FT                   KEQLRGLLDAPIQASGVPLLAPERDRLNIWLMVGVNGVGKTTTLGKLANLAVRSGYSAL
FT                   IAAADTFRAAAVQQVEVWGERSDVPVVSNPSSNADPAAVVFDAIGAARSRKSDLLLVDT
FT                   AGRLQTKHNLMEELQKVRKIIDRLAPEAKVESLLVLDASQGQNGLRQAMAFAQAAGLTG
FT                   VVITKLDGTARGGVALAVSSEAGLPIRFIGAGEGIRDLRPFNSFEFVEALLAGR"
FT   gene            14081..15493
FT                   /locus_tag="Syncc9605_0012"
FT   CDS_pept        14081..15493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0012"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33794"
FT                   /db_xref="GOA:Q3ANN8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33794.1"
FT                   /translation="MSSKPPGRHPSSAQRTGNPSPEAMASLRQLFDSLSSEQRRNQDLL
FT                   VSLGFALRSFTNLQRFLELVPVVASRLVGVEGALLVPFQSDGRLWRDQLQGSPAELSQD
FT                   LLQRLAAFEPGSAVGFGSDDQQLLALDRLVQRCLPKAALFATSVTARGRTRGRLYVYAR
FT                   NGALVWTEVHRRHVQLVADLAGVAIENDQMLQDARRHERVDRQLSIGAEIQAQLLPDRC
FT                   PVIEGVDLAARCRPAFQVGGDYYDFIPTRPELIGRRRERGRWALVMGDVMGKGVPAGLL
FT                   MTMLRGMLRAEVLSGLPPDRILHDLNQLAQEDLAQSHRFVTLFYSDLDPRTLRLRYANA
FT                   AHNPPLLWRAERRVIMRLDAAGLLIGLQPEAEFALGEVRLEPGDVLLYYTDGVTEAPGI
FT                   TGDRFDEARLIRALETACRSGQGAQGILDSLFERLDRFVGPDRQLEDDASLVVLKVPEA
FT                   VTLPIVQVRTIA"
FT   gene            15522..16940
FT                   /locus_tag="Syncc9605_0013"
FT   CDS_pept        15522..16940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0013"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33795"
FT                   /db_xref="GOA:Q3ANN7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33795.1"
FT                   /translation="MAGGVTGGAAGTWSDRFEQGLHPFIEAFNASIGFDLTLLQEDLDG
FT                   SIAHARMLASVGVITEAEAEQLVEGLETVRAEAASGSFQPGLADEDVHFAVERRLIALL
FT                   GPVGKKLHTGRSRNDQVGTDLRLWLRRRLDGLDQDLQRLQGALLTQADRHRRTMIPGYT
FT                   HLQRAQPLCLAHHLLAYVEMLERDRERLQDARKRVNICPLGAAALAGTPVPIDRQRTAK
FT                   ELGFSAVYANSLDAVSDRDFCVEFSAAASLVMVHLSRLAEEVIAWASEEFGFVRLSDRC
FT                   ATGSSLMPQKKNPDVPELVRGKTGRVFGHLQGLLTMIKGLPLAYNKDFQEDKEALFDAF
FT                   RTTRDCVEAMAILFEEGLDFRVERLNEAVEQDFSNATDVADYLVSRGVPFREAYQLVGA
FT                   VVRRCLEQGCLLRDLDLSAWKELHPAFEADLHDALAPRAVVAARRSEGGTGFERVDEQL
FT                   QRWLQRFNGTQPVG"
FT   gene            17067..17588
FT                   /locus_tag="Syncc9605_0014"
FT   CDS_pept        17067..17588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0014"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33796"
FT                   /db_xref="GOA:Q3ANN6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33796.1"
FT                   /translation="MSIFVGNLPFRAEQEDVIELFAQFGEVTNCALPLERDTGRKRGFA
FT                   FIEMADESTEEAAIEGLQGAELMGRPLRINKAEPRGSAPRRGGGGYGGGGGGGYGGGGG
FT                   GYRGGGGGGYGGGGAGDRPSGARGWEDRSYGARDSAGEGNAYDEGRSRRRRGSSSGGGD
FT                   EYSGYGGAEG"
FT   gene            complement(17602..18597)
FT                   /locus_tag="Syncc9605_0015"
FT   CDS_pept        complement(17602..18597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0015"
FT                   /product="uncharacterized protein family UPF0034"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33797"
FT                   /db_xref="GOA:Q3ANN5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33797.1"
FT                   /translation="MTASGSTAAYRFSVAPMLDCTDRHFRVLMRQISRRALLYSEMVVA
FT                   QALHHSKRRNKLLDFDPVEHPIALQVGGDDPALLAEAARLAQDWGYDEINLNVGCPSQK
FT                   VQAGNFGACLMAEPDLVARCVEAMVGAGGLPVTVKHRIGIDDLDSDVLLMNFVDRVALA
FT                   GASRFAIHARKAWLEGLDPKQNRTIPPLQHERVVALKQRRPDLVIELNGGLECPEDCLQ
FT                   ALEGCDGAMVGRAAYSHPLRWTSVDALIFGEESRQILASDIVDGLLPHAAAHLEQGGRL
FT                   WDLCRHLVQLVEGVRGARHWRRELGEKAQRPGADLKVLVQAGQQLKDAGL"
FT   gene            18638..19141
FT                   /locus_tag="Syncc9605_0016"
FT   CDS_pept        18638..19141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0016"
FT                   /product="Methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33798"
FT                   /db_xref="GOA:Q3ANN4"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33798.1"
FT                   /translation="MSLSAAVLSRRSMLLAAMAGVFGSLWRPQPVLAASKAGDPSWDLN
FT                   ADQWRERLSPQAYDVLRNEGTERPFTSPLNGEKRSGTYHCAGCDAALFSSEAKFDSGTG
FT                   WPSFWQPLDGAIATKVDFKLILPRTEYHCSRCGGHQGHVFNDGPRPTGKRYCNNGVALR
FT                   FQPA"
FT   sig_peptide     18638..18739
FT                   /locus_tag="Syncc9605_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.964 at
FT                   residue 34"
FT   gene            19113..20381
FT                   /locus_tag="Syncc9605_0017"
FT   CDS_pept        19113..20381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0017"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33799"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33799.1"
FT                   /translation="MSPSASSLLDLIVVGGGPAGYMAAITAAEQGVRKVLVLEGTPEPL
FT                   QKVRISGGGRCNVTHACWDPRELATHYPRGSRPLRGLFSRFACGDAIAWFDEHGLTLVE
FT                   EPDGRMFPQQNRSEAVIQCLQKAARASGVQLRTKAMVQQVRVHPEGGFVLEGRGLKPLH
FT                   GGCLMLATGGHPSGRNLAEALGHQVVPPVPSLFSLALQAPALTACSGIAIDDVALDLKL
FT                   GDQRFHQTGRVLITHRGLSGPATLRLSAFAARALHQNRYKGELKLDWSAGLGRSGLTER
FT                   FQQWRQEQARRTLSTAKPCKHLPRRLWQAFLTMAGVEPERRWADLPIKAERRLVELLCA
FT                   QRVPIQGRGPFGEEFVTAGGIALGDVNLATMESRRCPGLYLAGELLDVDGVTGGFNFQA
FT                   CWSGGWLAGHAIAAVITGSDQTR"
FT   gene            complement(20356..21003)
FT                   /locus_tag="Syncc9605_0018"
FT   CDS_pept        complement(20356..21003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0018"
FT                   /product="Type II secretory pathway component PulF-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33800"
FT                   /db_xref="GOA:Q3ANN2"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33800.1"
FT                   /translation="MTAFIASYAGPTGQPRTVTIKAANLAEAKKLLRRRGIRAEELRPV
FT                   SLGNTQDGKANGADAAGLRSIDLNRLFEKAPGVKEKAVFASKLAALVDAGVPILMSMEI
FT                   SSETAGNAIISDAILASRGMVQEGVLLSNALIRQKVLPDMALNMLAIGEETGEMDKMLS
FT                   KVADFYEDEVGAMVKALTSMLEPAMIVVVGGIVGSILLAMYLPMFTVFDQIQ"
FT   gene            complement(21023..22105)
FT                   /locus_tag="Syncc9605_0019"
FT   CDS_pept        complement(21023..22105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0019"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33801"
FT                   /db_xref="GOA:Q3ANN1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33801.1"
FT                   /translation="MDLMIEALMEQLVQGGGSDLHLATGQPPYGRFSGELRPMTDRPLA
FT                   EEECNKLIFSMLNNSQRKTLEQTWELDCAYGLKGVARFRVNVYRQKGSYAACLRALGST
FT                   IPSVELLNLPPVVLETSARPRGLVLVTGPTGSGKTTTLAALLDLINHTRSEHILTIEDP
FT                   IEFVYQSDKSLVHQRQLNEDTRSFANALRAALREDPNVILVGEMRDLEMIQLAVSAAET
FT                   GHLVFGALYTSSAAQTVDRMVDVFPPEQQTQIRVQLSGSLVAVFCQTLCRRQNPSEGQF
FT                   GRVMAQEILINTPGPGTANMIREGKTAQLYSQIQTGTEQGMQTLEKALANLVLNGDVSR
FT                   AEAMGKASKPGELQRLIGEI"
FT   gene            complement(22116..22526)
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0020"
FT   gene            complement(22622..23791)
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0021"
FT   gene            complement(23807..23965)
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0022"
FT   gene            24056..24733
FT                   /locus_tag="Syncc9605_0023"
FT   CDS_pept        24056..24733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0023"
FT                   /product="putative heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33802"
FT                   /db_xref="GOA:Q3ANN0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33802.1"
FT                   /translation="MSGDASTPEQDQNVVSGAVPATRESSPDAPEATSEQASAAVDPAD
FT                   RMQQLEQELSALKQEHDTLNSQYMRIAADFDNFRKRQSRDQDDMRKQLVCSTLTEILPV
FT                   VDNFERARQQLNPEGEEAQALHRSYQGLYKQLVEVLKQQGVARMDVVGQEFDPNLHEAV
FT                   LREESSEFAEDVVSEELQRGYHRDGRVLRHAMVKVSMGPGPSDPGSAPAEAAAAPDQTA
FT                   EEA"
FT   gene            24733..25869
FT                   /locus_tag="Syncc9605_0024"
FT   CDS_pept        24733..25869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0024"
FT                   /product="Heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33803"
FT                   /db_xref="GOA:Q3ANM9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33803.1"
FT                   /translation="MADFYDLLGVSRDVDPDSLKRAYRRMARQYHPDINKDPGAEDRFK
FT                   EIGRAYEVLSDPQTRARYDQFGEAGLGGAAGAPDMGDMGGFADLFETFFQGFGGPGGAG
FT                   AGRPRRQGPQQGDDLRYDLTIDFEQAVFGQEQEIKIPHLETCDTCGGSGAKAGSAPTTC
FT                   GTCGGAGQVRRATRTPFGSFTQVAECPNCGGTGQVISDPCGSCGGQGVKQVRKKLRINI
FT                   PAGVDTGTRLRVTGEGNAGPRGGPSGDLYVFLTVRNHPRLQRDGLNIFSEVKVSYLQAI
FT                   LGDTIEVETVDGSKELDIPAGTQPGTVLTLPNLGIPKLGNPVARGDQRVTVTVDLPKRI
FT                   SDLERELLEQLAGHHSARGKQHHHHNSGLFARLFGQKG"
FT   gene            25866..26093
FT                   /locus_tag="Syncc9605_0025"
FT   CDS_pept        25866..26093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33804"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33804.1"
FT                   /translation="MSRRSLDLRGTPCPVNFIRCKLTLEQMNSGDCLEVCLDRGEPEAM
FT                   VLPGLRDAGHRVECTDQTPDAVTIEVICGG"
FT   gene            26086..27000
FT                   /locus_tag="Syncc9605_0026"
FT   CDS_pept        26086..27000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0026"
FT                   /product="GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33805"
FT                   /db_xref="GOA:Q3ANM7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33805.1"
FT                   /translation="MADTARSVASGMVVALQANYLEVELDVAPDGCPGRLLCTRRTRLS
FT                   HRGEAVYVGDRVRVEAIDPGQGRAVVAEVEPRHSFLTRPPVANVSLVAVVLAVEQPSFD
FT                   PDQASRFLLTAERTGLEVILLLTKTDLLSAAALERLVTRLQGWGYDPLAFSSAAGTGID
FT                   ALRQRLAGAQLSVLCGPSGVGKSSLLNQLCPDLQLRTAAVSGRLQRGRHTTRHVELFPL
FT                   GPSARVADTPGFNRPDLPEDPQELGVLFPELRKQLDPWPCRFRDCLHRGEPGCGVSTDW
FT                   ERYSLYEAALIEQSSLSRPSRGG"
FT   gene            complement(26975..27316)
FT                   /locus_tag="Syncc9605_0027"
FT   CDS_pept        complement(26975..27316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33806"
FT                   /db_xref="GOA:Q3ANM6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33806.1"
FT                   /translation="MAGFGLPNFGQLTEAFKKAQEIQQNAQALQDELDGMEIEGKSSDG
FT                   RASVWLSGNQQPLRVRLDPALLQEGQQASETATLEALQAAYEQSTATMKGRMEELTGGL
FT                   NLNLPGMGG"
FT   gene            complement(27341..28243)
FT                   /locus_tag="Syncc9605_0028"
FT   CDS_pept        complement(27341..28243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0028"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33807"
FT                   /db_xref="GOA:Q3ANM5"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33807.1"
FT                   /translation="MTQCDARLPQGGVKLADYTTWRVGGAAEWLAEPASLDETQAWIEW
FT                   AAHQGMPCRVIGAGSNLLIHDDGLPGLSLCLRKLQGLQLDATTGTVEVLAGEPIPSLAR
FT                   RAARAGLHGLEWSIGIPGTAGGAAVMNAGAQGGCTAEWLESVRVVPLEGGNCFELQRHQ
FT                   LDFAYRHSRLQEDNLVVLSARFRLQPGHDPDELKRVTTANLSHRTTTQPYQQPSCGSVF
FT                   RNPEPLKAGRLIEEQGLKGTRIGGAEISTVHANFIVNTGDAQAKDIAQLIHLVQDRIEA
FT                   KHGIRLHTEVKRLGFASAA"
FT   gene            complement(28240..29649)
FT                   /locus_tag="Syncc9605_0029"
FT   CDS_pept        complement(28240..29649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0029"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33808"
FT                   /db_xref="GOA:Q3ANM4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33808.1"
FT                   /translation="MPRLLDRQTPVHFIGVGGIGMSALARILVDRGHSVSGSDPRDNAT
FT                   TQQLKTLGVKVFRQQDATCIDAVTGRTAADSPVVVISTAIPESNPELQRARQQGLEIWH
FT                   RSDLLAALIEQQPSIAVAGSHGKTTTSTLITTLLLEADQDPTAVIGGIVPSLGSNGHSG
FT                   QGKLLVAEADESDGSLVKFSPSLGVITNLELDHTDHYSCLDDLISTLQRFAGGCDRVLA
FT                   NHDCPILQEHFQPTAWWSNQSDESVDFAALPLSLDGDRCVARFYEAGQPVGDFTLPMAG
FT                   LHNLSNATGALAACRMEGLPFNQLVEGLAGLKAPGRRFDLRGTWKGRHIVDDYAHHPSE
FT                   VQATLEMARLMVRSGRSPLPSAPQRLLAVFQPHRYSRTRQFLDGFAKALQNCDLLLLAP
FT                   VYPAGEQPLQGISSNALADRVRKLKPDLEIAVAENLDQLTELVIQHSLENDLVLAMGAG
FT                   DVNGLWSRLTS"
FT   gene            29810..30835
FT                   /locus_tag="Syncc9605_0030"
FT   CDS_pept        29810..30835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0030"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33809"
FT                   /db_xref="GOA:Q3ANM3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33809.1"
FT                   /translation="MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPATSA
FT                   HLLTYDSILGRLDPSVDIKTTDSSMFVNGKEIKFFADRNPLNCPWKEWGVDLVIESTGV
FT                   FNTDEKASMHIQAGAKKVILTAPGKGDRVGTFVVGVNDDQYRHEDWDILSNASCTTNCL
FT                   APIVKVLDQNFGLDWGLMTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAV
FT                   ALVYPEVKGKLTGFAMRVPTPNVSAVDLTFGPSRAASVDDIKAAIKSASENGMKGIIKY
FT                   GDLPLVSTDYAGTNESTIFDADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKNW
FT                   K"
FT   gene            complement(30924..31910)
FT                   /locus_tag="Syncc9605_0031"
FT   CDS_pept        complement(30924..31910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0031"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33810"
FT                   /db_xref="GOA:Q3ANM2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33810.1"
FT                   /translation="MSQTLAELTEAELLRRLAHFAPPDQLSDDTAALAADARPLLVNTD
FT                   VLVDGIHFSDATTTAVDVGWRAVAANLSDLAASGAVDIDGITVALVAPSHTRWDWVDGV
FT                   YQGISAALEEYGGVLLGGDCSKGEQRLLSITALGRLGPLRLHRNAARPGDVLVTSGPHG
FT                   LSRLGLALLQDDPRVRDIALCSTLRDQAVTRHQRPTPRLKDVQQLLACKPKHLPWRAGG
FT                   TDSSDGLLSAVAGLCSSSGCGAVLRHDQLPTAEGWPEGAPWTDWCLAGGEDFELVLSLP
FT                   EAWADVWQRCVSESKRVGQINAEAGVIRWAHNHEPVDTRGFDHFGQS"
FT   gene            complement(31907..32983)
FT                   /locus_tag="Syncc9605_0032"
FT   CDS_pept        complement(31907..32983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0032"
FT                   /product="putative cyclophilin-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33811"
FT                   /db_xref="GOA:Q3ANM1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33811.1"
FT                   /translation="MVHQRLNAVLAVLISFALITIAAPAWAALPQGNAVKDPAAILRDA
FT                   LPFDQDDIRELQHRLELTSDDLRAKRWTALGKTVSRTESLLNTRRDTILNAVPEAKRGT
FT                   AEALFESVDQGLEDLKEKVKAIDKPGFIADRRRTLRYIGDVEALLVPDGFEREIPAEFD
FT                   ALPRLQGRATLSVSTTQGELTTVVDGYNAPLTAGAFVDLALKGFYDGLPFIRAEDFYVL
FT                   QSGDPEGPEIGYVDPKTKQERHVPLEIRVPGEDDTIYNETFEDVGLFMATPTLPFATLG
FT                   TLGWAHSDQALDDGSSQFFMFLYEAELTPAGLNLVDGRNAAFGYVVDGFDVLEELGVDD
FT                   RITAVKVVNGAEQLKAHA"
FT   sig_peptide     complement(32900..32983)
FT                   /locus_tag="Syncc9605_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            33049..33612
FT                   /locus_tag="Syncc9605_0033"
FT   CDS_pept        33049..33612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0033"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33812"
FT                   /db_xref="GOA:Q3ANM0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33812.1"
FT                   /translation="MISSNDFRTGTTIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKAVK
FT                   SGNVVEKTFRAGEMLPQAMLEKSSLQHTYMEGEDYVFMDMATYEETRLSADQIGESRKY
FT                   LKEGMEVNVVSWNDTPLEVELPNSVVLEIKETDPGVKGDTATGGTKPAILETGAQVMVP
FT                   LFLSVGEKIKVDTRNDSYLGRENG"
FT   gene            33609..34094
FT                   /locus_tag="Syncc9605_0034"
FT   CDS_pept        33609..34094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0034"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33813"
FT                   /db_xref="GOA:Q3ANL9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33813.1"
FT                   /translation="MSMQLDHEQLHRLLEALGESDIQEFRLEGDDFRLEIRRNLPAQAV
FT                   MAPVMPAPVAAAAAAPAPVASAEPAAAPPASTATRSDLLEVTAPMVGTFYRAPAPGEPA
FT                   FVEVGSRINVGQTVCILEAMKLMNELESEVGGEVVEILVDNGTPVEFGQVLMRVKPA"
FT   gene            complement(34096..35112)
FT                   /locus_tag="Syncc9605_0035"
FT   CDS_pept        complement(34096..35112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0035"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33814"
FT                   /db_xref="GOA:Q3ANL8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33814.1"
FT                   /translation="MGPHDSTNPRHELVIALGDPAGIGMEVVLKALASPTLPPALQPLL
FT                   VGCRRTLISTHARLQRQTSHPLADPAALRIDDHPLEAGVQPGQPTTGGADAGFRWLTRA
FT                   VELLQERGSRALVTAPIAKHLWHAAGHRYPGQTERLAELAGRQHSSMLFTAVSPTSGWR
FT                   LNTLLATTHIPLNQIPEALTPELVHHKLNVLEEFCRRFTSTPHLRIAGLNPHAGEAGQL
FT                   GHEEAEWLLPLLDQWRKEHPQVQLEGPVPPDTCWISAARAWQMPNQAGPDGILALYHDQ
FT                   GLIPVKLLAFDAAVNTTLELPFLRTSPDHGTAFDIAAQGIASPESTTAAIQAAWDLS"
FT   gene            complement(35256..36209)
FT                   /locus_tag="Syncc9605_0036"
FT   CDS_pept        complement(35256..36209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33815.1"
FT                   /translation="MLADLVKRSRPLSADSKLLVLGGGYSGRCLAGLARALGTPVLCTR
FT                   RSLDSAEADLLFDSNGQDQLDPASLEGITHLLSTIPPDRDGNDPVLLKLLPTLGNLPLR
FT                   WAGYLSTTGVYGDRQGGWVSEHDDPAPALDRSMRRLNCEQAWLRSGLPIQILRLPGIYG
FT                   PGRSVLNGLEQGRARLIDKPGQVFCRIHVEDIAGACWHLMHRAEQGVPASPGNGSIVNV
FT                   VDDLPAPTAELMRHAADLLGCALPPLKPFDQIVESMSPMAQSFWSENRRVSNHKLCQEL
FT                   GYALLHPNYRVGLQDCLNQDKLNSLDLGSPPRSANG"
FT   gene            complement(36413..36808)
FT                   /locus_tag="Syncc9605_0037"
FT   CDS_pept        complement(36413..36808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0037"
FT                   /product="HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33816"
FT                   /db_xref="GOA:Q3ANL6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33816.1"
FT                   /translation="MHSKDAVFLDELCPKLRVRRWRQSLHTFTGQSCIYCGKPSESIDH
FT                   IHPQAKGGSSVTENCVPACLSCNGRKSDSDVFDWYRRQRFYDPRRAMAIRAWMDGDLRL
FT                   AVRLLQWAQPEQPINEPHDFSIAAQAA"
FT   gene            36970..38574
FT                   /locus_tag="Syncc9605_0038"
FT   CDS_pept        36970..38574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0038"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33817"
FT                   /db_xref="GOA:Q3ANL5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33817.1"
FT                   /translation="MPSKPTMTCCLDLSPAGLVRVVSPFDAVTQSQLRRIKPRGRWIGP
FT                   GHGWDFPLAAAGALQQTLGRRFPVTAALQQWLDWCQHPLPPLPPHRTLVAAADLDEALQ
FT                   DGRRPLRHQRSGVRWLLARRGAVLADEMGLGKTLTALLAARALMRCAEVRLLVVAPVGL
FT                   HPHWRRESEALGVELELVSWARLPDTLPPAGTLLVVDEAHYAQSLQAQRTAALLRLARH
FT                   PRLRAIWMLTGTPMKNGRPSQLYPLLAAMDHPIARDQRQFEERYCQGHWREGRTGKRWQ
FT                   ASGASQLEELRRLSRPLILHRRKQQVVDLPPKQRRLHPVMLSEAELTGFDHRVELVLDD
FT                   YRRRARLGEVRRDAEHLALLTSMRQIAAEFKLPAAQQLVESLRRQGEAVVLFSGFVAPL
FT                   HLLQQTLGGELLTGRQRPAERQESVDRFQQGQNDCLLATFGTGALGFTLHRARHVVLLE
FT                   RPWTPGDLDQAEDRCHRLGMGDGLTCHWLQLGAADQLVDGLLASKAERIEVLLGPRRFS
FT                   LQRQSLSAMVGDCLQVL"
FT   gene            complement(38529..38867)
FT                   /locus_tag="Syncc9605_0039"
FT   CDS_pept        complement(38529..38867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33818"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33818.1"
FT                   /translation="MAGCQSKQSPTTTNTSTPLVSSCLGDFRMRDLELLVESCDEAIEQ
FT                   TPNQADLHRDRALVLTLRGDQAKACEDVEVALSLLKQSKQPVDPMLQHELQVRQSTCKQ
FT                   SPTMAESD"
FT   gene            complement(38911..39321)
FT                   /locus_tag="Syncc9605_0040"
FT   CDS_pept        complement(38911..39321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33819.1"
FT                   /translation="MGPIRSSLVLSAAALIGAFSSVTPALQAAEPTEDKGAKIYCYLRS
FT                   SGNNHKVSWNAAYAVIKRQGRSMFKTSPEHASVMITEAVVNDPGNFPDCGQFLGDLFGG
FT                   NTQPATAATLGKSSTISESTIESTDDTTRYSY"
FT   sig_peptide     complement(39235..39321)
FT                   /locus_tag="Syncc9605_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 29"
FT   gene            complement(39356..39886)
FT                   /locus_tag="Syncc9605_0041"
FT   CDS_pept        complement(39356..39886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33820"
FT                   /db_xref="GOA:Q3ANL2"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33820.1"
FT                   /translation="MTQSRQMPSLATLALYLLAGTAIGLLALFSGIPAAPLAGALLGAG
FT                   IVSMSGQLEPATWPQGTRTVLEIGIGTVIGTGLTRASLEQLQVLWKPAVLITLALVLTG
FT                   LVVGLWTSRLLGIDPIVALLGAAPGGISGMSLVGAEFGVGAAVAALHAVRLITVLLVLP
FT                   LVVRLIVPSTAGS"
FT   sig_peptide     complement(39770..39886)
FT                   /locus_tag="Syncc9605_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.737 at
FT                   residue 39"
FT   gene            40315..40533
FT                   /locus_tag="Syncc9605_0042"
FT   CDS_pept        40315..40533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33821"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33821.1"
FT                   /translation="MAITIPASNACASRTLHGMTIWTRSGFLEGGHQLEKLEFALALAE
FT                   AKGDQRRCSQLRDRIADLGGNAEEPGT"
FT   gene            40650..40865
FT                   /locus_tag="Syncc9605_0043"
FT   CDS_pept        40650..40865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33822"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33822.1"
FT                   /translation="MTLTTTKQSETAAQHRQDYETAAQALFASARQCAEDGRINEAGSL
FT                   ILQALGHERRAGSARPQVLQLVKSRS"
FT   gene            complement(40886..40957)
FT                   /gene="tRNA-Gly2"
FT                   /locus_tag="Syncc9605_R0001"
FT   tRNA            complement(40886..40957)
FT                   /gene="tRNA-Gly2"
FT                   /locus_tag="Syncc9605_R0001"
FT                   /product="tRNA-Gly"
FT   gene            complement(40990..42138)
FT                   /locus_tag="Syncc9605_0044"
FT   CDS_pept        complement(40990..42138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0044"
FT                   /product="soluble hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33823"
FT                   /db_xref="GOA:Q3ANK9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33823.1"
FT                   /translation="MQDKLTLMIPGPTPVPETVLKAMGRHPIGHRSGEFQAIVRRTTEQ
FT                   LKWLHQTTSDVLVITGSGTAAMEAGIINTLSRGEKVLCGDNGKFGERWVKVARAYGLDV
FT                   EVIKAEWGQPLDPEAFRSALEADSAKAIKAVILTHSETSTGVINDLESIARHVKTHGTA
FT                   LTLADCVTSLGATNVPMDAWGLDVVASGAQKGYMLPPGLSFVAMSARAWEAYERSDLPK
FT                   FYLDLGPYRKTAAKDSNPFTPAVNLYFGLEAALDMMQKEGLEAIFARHARHRAAAQAGM
FT                   KAMALPLFAAEGYGSPAITAVAPEGIDAEQLRKAVKEKFDILLAGGQDHLKGQVFRIGH
FT                   LGYVCDRDVLTAVAAIEATLQSLGLHKGSMGAGVAAASAALG"
FT   gene            42177..43283
FT                   /locus_tag="Syncc9605_0045"
FT   CDS_pept        42177..43283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0045"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33824"
FT                   /db_xref="GOA:Q3ANK8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33824.1"
FT                   /translation="MSGSIAPSSPGLTLPVWVAAAAKAALQVLLDEPFNAEQQLNQGSD
FT                   RPSLQVPVCSAAPLSDGQALGISRCDPGPGLDLTRDLEVWVRVAWIATPQPVLELQPGE
FT                   GVGRLGPEGDICLSGFARELLERNLLPLLPAGRGLMVQPILPRGRSLAQRTSNAAFGVV
FT                   DGLALIGTQAEVQRSAAPDQLQEVLAELEARAADPAFQGRLVLVIGENGLDLARQQGLG
FT                   PVLKVGNWVGPVLVAAAEAGVRDLLLLGYHGKLIKLAGGIFHTHHHLADGRLEVLVALG
FT                   LDAGLSTAELLQCRGAASVEEAFQALDPDQARALGQHLAAIVEQRSHSYLARYGAWSMR
FT                   IGAALFDRSRTLRWWGPEAEKRFFTLRD"
FT   sig_peptide     42177..42251
FT                   /locus_tag="Syncc9605_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.797) with cleavage site probability 0.538 at
FT                   residue 25"
FT   gene            43316..44902
FT                   /locus_tag="Syncc9605_0046"
FT   CDS_pept        43316..44902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0046"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33825"
FT                   /db_xref="GOA:Q3ANK7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33825.1"
FT                   /translation="MSQPSSDTQRQPAIVILDFGSQYSELIARRVRETEVFSVVLGYST
FT                   SAEELRRMAPKGIILSGGPSSVYAEHAPLCDPGIWDLGIPVLGVCYGMQLMVQQLGGVV
FT                   EAATGKAEYGKAPLEVDDPTDLLTNVDNGSTMWMSHGDSVKALPEGFVRLAHTANTPEA
FT                   AVAHLQRKLYGVQFHPEVVHSTCGMALIRNFVYHVCGCDPDWTTAAFIDEAVALVREQV
FT                   GDKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIH
FT                   VEYINARQRFIGKLEGITDPEEKRKIIGTEFIRVFEEESKRLGPFDYLAQGTLYPDVIE
FT                   SAGTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRSLGLPEE
FT                   IVRRHPFPGPGLAIRILGEVTDEKLDCLRDADLIVRQEIKEAGLYHDIWQAFAVLLPVR
FT                   SVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVLDI
FT                   TSKPPGTIEWE"
FT   gene            44957..45847
FT                   /locus_tag="Syncc9605_0047"
FT   CDS_pept        44957..45847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33826"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33826.1"
FT                   /translation="MSCRKAVESCFPSDQFSASAYRASSADLESFSDEELIKHYDSYGK
FT                   KENRVSTSISSKRDFLSLLQGKKNLLEIGVFDNPTLDFIADSEESVVIHYADFLSRDEL
FT                   IARASDVGRNPQNVPEIKWILSDGYDQIDVLYDAVVSHHCVEHQPDLIAHLLKITSILS
FT                   PGGWYFFSVPHKYRCFDFFISESTIVDVIAAYYLKYEKPSFKSILEHRVFTSHTYQDGV
FT                   NPFDSLQPSMRKRIESAFDEFSSNEYVDVHCWQFTPESMRKILSQLAAFDFIPNINELK
FT                   VYPNFDEFYVAISFE"
FT   gene            46205..46816
FT                   /locus_tag="Syncc9605_0048"
FT   CDS_pept        46205..46816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33827"
FT                   /db_xref="GOA:Q3ANK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33827.1"
FT                   /translation="MTATQQQDFQLQRRLQQDSIQLRGRTIYLNPFLYWRRFDSNTDRW
FT                   LREPGQLTEDQITANRSRFYPELDWGQLDDHATAVHDGAVEMFLKSLELISTFHPELGS
FT                   GQMLEVERKMTITKKRAFERWVDKAMRRRQRDESREHRRFERSRFWRAWREWILLDTTQ
FT                   KALVPVVMLMVLSGVMGWSLAADRSACPTLALPSGQTGVR"
FT   gene            46826..47209
FT                   /locus_tag="Syncc9605_0049"
FT   CDS_pept        46826..47209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33828.1"
FT                   /translation="MAADSNSDNPLDQLRLSLMQDVLPVGLAVLERARKGGPGKVVEVF
FT                   TAGSEDPIADLRQEGEPVARDVREQLDAVSPGLGNPVMPVSVSVDEPTVVQQDGPDDLL
FT                   PTLRRIEERLEELRRRLPAQQQE"
FT   gene            47206..48993
FT                   /locus_tag="Syncc9605_0050"
FT   CDS_pept        47206..48993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0050"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33829"
FT                   /db_xref="GOA:Q3ANK3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33829.1"
FT                   /translation="MTRSAQQRQTGLRQQPLVLLLLVLLFCSAMVSRLVWMQLLEGSRF
FT                   RELADENRIRLVPRSPIRGRLLDRKGRVLATSKLTYSLYLEPRLVSDDDWPGLRDRLAR
FT                   LLNLKPDLLDQRRQKGLDRDGYRTTLALDLKPEQVLRFREQALGLRGAQVDVDILRSYP
FT                   NGTLAAHALGYTQPITENEFEILAEKGYKIRDRIGRTGVEAAYEGHLRGKWGGQMLEVN
FT                   AMGEVQRNLGDRPSQAGKDLVLTLDLDLQRVAEQALADKPGGAVVALEAATGAVLALAS
FT                   RPSFDPNFFSKLITTQKEYDALFSNPKKPLLSRAMNPYDPGSTWKPVTAMAGMESGKFP
FT                   PDTKLHTKACITYGGHCFPDHNGKGFGTIGYVDALRHSSNTFFYQVGVGVGSLALKQAA
FT                   DQLGFQQKTGIEIGWEESVGLVGDEPWADRGRGWAEPGTVPWIPEDMASASIGQSVVQI
FT                   TPLQLARAYAVFANGGWLVTPHLAAGDIDWMSPEHRTKVAIQPSTLQTIREGLRKVVEA
FT                   GTGAGLNGPGIRPAAGKTGTAEDSTGGPDHAWFGCYAPYPDGKIVVVAFAQNTPGGGSV
FT                   HALPMAKKVLTEWERTWQR"
FT   sig_peptide     47206..47301
FT                   /locus_tag="Syncc9605_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.792) with cleavage site probability 0.312 at
FT                   residue 32"
FT   gene            complement(48990..50135)
FT                   /locus_tag="Syncc9605_0051"
FT   CDS_pept        complement(48990..50135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0051"
FT                   /product="SqdX"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33830"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33830.1"
FT                   /translation="MKVAFFTETFLPKVDGIVTRLTKTVKHLVDAGDEVVVFCPEGCPE
FT                   EYMGARLIGVPAMPLPLYPELKLALPRPAVSDAIDAFQPDLIHVVNPAVLGLGGIWLAK
FT                   NKGIPLVASYHTHLPKYLEHYGLGMLEPLLWEMLKAAHNQALLNLCTSTAMVKELSDKG
FT                   IQHTDLWQRGVDTELFRPELRSAKLRQRLLGGRDDRGALLLYVGRLSAEKQIERIRPVL
FT                   EGLPDARLALVGDGPHRQQLEKHFEGTATTFVGYLAGQDLAGAYASGDAFLFPSSTETL
FT                   GLVLLEAMAAGCPVVGANRGGIPDIITDGVNGCLYEPDGADGGAASLIEATRRLLGNDL
FT                   ERQALRSAARAEAERWGWAGATEQLRTYYRTVLSAPQLTAA"
FT   gene            complement(50149..51345)
FT                   /locus_tag="Syncc9605_0052"
FT   CDS_pept        complement(50149..51345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0052"
FT                   /product="sulfolipid (UDP-sulfoquinovose) biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33831"
FT                   /db_xref="GOA:Q3ANK1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33831.1"
FT                   /translation="MKVLVLGGDGFCGWPCAVNLADQGHDVLIVDNLSRRKIDIDLEVE
FT                   SLTPIVSIGERLKAWEETGGKPMRFVHMDIAHEYQRLLDLLHEERPDSVVHFAEQRAAP
FT                   YSMKSSATKRYTVDNNVNGTHNLLAAIVESGQDIHVVHLGTMGVYGYGSHRGATIPEGY
FT                   LKVEVPQPDGSRFEEEILHPASPGSVYHMTKTLDQLLFLYYNKNDKVRITDLHQGIVWG
FT                   TNTDATDRDPRLTNRFDYDGDYGTVLNRFLMQAAIGYPLTVHGTGGQTRAFIHIRDSVR
FT                   CVQLALENPPEQGERVKIFNQMTESHQVGELAKKVAALTGAQVNNLPNPRNEAVENDLI
FT                   VDNRCFIELGLNPTTLDDGLLKEVLEIATRYADRCDRNRILCTSAWTNTQAQAIGTAS"
FT   gene            complement(51420..51593)
FT                   /locus_tag="Syncc9605_0053"
FT   CDS_pept        complement(51420..51593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0053"
FT                   /product="high light-inducible protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33832"
FT                   /db_xref="GOA:Q3ANK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33832.1"
FT                   /translation="MSVTTEDGGRLNAFAKEPRMEVMDVNTSQSRNRSSMMMLVSGGLI
FT                   VAAMVAVTVAIS"
FT   gene            complement(51686..52504)
FT                   /locus_tag="Syncc9605_0054"
FT   CDS_pept        complement(51686..52504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0054"
FT                   /product="thiamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33833"
FT                   /db_xref="GOA:Q3ANJ9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33833.1"
FT                   /translation="MDSPSPNSDPLTIGGRQFNSRLFTGTGKYPSMTSMQQSIERSGCD
FT                   MVTVAVRRVQTVAAGHEGLMEAIDWQRIWMLPNTAGCTNAEEAVRVARLGRELAKLAGQ
FT                   EDNTFVKLEVIPDARHLLPDPIGTLNAAEQLVKEGFTVLPYINADPLLAKRLEEVGCAT
FT                   VMPLGSPIGSGQGLNNAANIGLIIENAGVPVVVDAGIGVPSEAAQALEMGADAVLVNSA
FT                   IALAGDPAAMASAMSQAVMAGRTAHLSGRLPRRDQASASSPTTGLVQSPQ"
FT   gene            52556..53101
FT                   /locus_tag="Syncc9605_0055"
FT   CDS_pept        52556..53101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33834"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33834.1"
FT                   /translation="MPFLLAMDLPAGSQVSFQTNPQLPLDPIQLAVPMEIDQGSVESFD
FT                   PVARAAELAISLPRQWCGTFEPFDGNPTVEVTLDITQMTAMGQMVDLRGTMTLGSVTTP
FT                   VQGNVHAKSDQLDLIPLADPLIAGVEPGGVFLGLQMFSPTSWQTPRLINVADPSTGVGG
FT                   RLAMTPSCKEEPPVQPLW"
FT   gene            complement(53140..53658)
FT                   /locus_tag="Syncc9605_0056"
FT   CDS_pept        complement(53140..53658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33835"
FT                   /db_xref="GOA:Q3ANJ7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33835.1"
FT                   /translation="MNLLPQTYLLGLVGLLAIVAVVVGRQFLLVRRDEARLIELEKSDT
FT                   ASSRQASDLYELGSVQLRKRLYPQAAATLKQALKRLSGEPDEARALIENALGFALAAQK
FT                   DYSGATKHYKLALKAKADYPVALNNLAFAQEKLLKDAEAISLYEKTLQLEPDNISAKKG
FT                   LKKLKRRNS"
FT   gene            complement(53670..54017)
FT                   /locus_tag="Syncc9605_0057"
FT   CDS_pept        complement(53670..54017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0057"
FT                   /product="ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33836"
FT                   /db_xref="GOA:Q3ANJ6"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33836.1"
FT                   /translation="MARVKRGNVARKRRNKILRLARGFRGGNGTLFRTANQRVMKALCN
FT                   AYRDRRRRKRDFRRLWIARINAAARLNGVSYSRLMGGLKKADVRLNRKMLAQLAVVDPG
FT                   SFTNVVAAAKS"
FT   gene            complement(54074..54271)
FT                   /locus_tag="Syncc9605_0058"
FT   CDS_pept        complement(54074..54271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0058"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33837"
FT                   /db_xref="GOA:Q3ANJ5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33837.1"
FT                   /translation="MPKLKTRKAAAKRFKATGTGKFLRRRAFRNHLLDHKTPKQKRHLA
FT                   TKAVVDRTDEERVTLMMPYA"
FT   gene            54329..55888
FT                   /locus_tag="Syncc9605_0059"
FT   CDS_pept        54329..55888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0059"
FT                   /product="possible amidase enhancer"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33838"
FT                   /db_xref="GOA:Q3ANJ4"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33838.1"
FT                   /translation="MIRLLTLTLLLCMGLGCRTREEVDALQPTETEPAVVEQVQRATHP
FT                   SVADPPPVEGPEPVLWVALGDHLGAAQTAAALNLRAFAGSLSLRDATGEQGSGSGFVIS
FT                   WRSVPLDRPLPLARRIAGPYASFESADRVASRWRDLGVSAEVAHPKEWEVWAPEGSPVP
FT                   EGLAVRDWQGSFTSTVEPVLQTPEGGRNLQGPLLIEASDGLLWAGGRFEGPFRLQRDAY
FT                   RSWTLVEQVPLERYLEGVVPHEIGAGSPMAALQAQTVLARTWALANSHRFSIDGYHLCS
FT                   DTQCQVYSDPRHAGSAVREAIAATEGKLLSLNNQPISAVYHATNGGMMAAGPEAWAMQP
FT                   SIYLRAKPDGDEGWRNRHPLPQQQRKVVEALLADRSGAYGQRHPRFRWTRTLSGPALRQ
FT                   ALGAAADPLVSPLQLKVMERGASGRVLALQISGSSDAAPVILKLDAIRRTLRTLPSTLF
FT                   VLEAQEVERWLVRGGGFGHGAGLSQAGAIDLAWRGWPVERILSHYYPGTVYGPLSTPTQ
FT                   SP"
FT   sig_peptide     54329..54388
FT                   /locus_tag="Syncc9605_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.759) with cleavage site probability 0.500 at
FT                   residue 20"
FT   gene            55913..57232
FT                   /locus_tag="Syncc9605_0060"
FT   CDS_pept        55913..57232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0060"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33839"
FT                   /db_xref="GOA:Q3ANJ3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33839.1"
FT                   /translation="MSSNATSGDHRRVKSAAFLFACGCAGAAPHWLDSARSLWPAISLA
FT                   LMLGGYGLRSVMRGQLTRGSSESGPAVDPAKLPSLDVVVAARDEEAVVPRLVERLTSLR
FT                   YPSGQLTTWVIDDGSLDRTSELLDDLASQHPGLNVIHRQRNAGGGKSGALNTALNRLKG
FT                   EWLLVLDADAQLQDDLLERLVPYALDGGWSAVQLRKAVIDADRNWLTRSQAMEMALDAV
FT                   IQSGRLANGGVAELRGNGQLIKRSVLEASGGFNEDTVTDDLDLSFRLLTHGALVGLLWD
FT                   PPVQEEAVPGLQALWKQRQRWAEGGLQRFFDYWPVLTSAQLSLRQRLDLTAFFLLQYAL
FT                   PVVSFADLSTALITRSLPVYWPLSVVAFSVSGLAYWRGCRDGSEGPAIPSASLANLLVA
FT                   IAYLGHWFVVIPWVTLRMSLLPKRLVWAKTSHGQDQPIQV"
FT   sig_peptide     55913..55996
FT                   /locus_tag="Syncc9605_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.626) with cleavage site probability 0.610 at
FT                   residue 28"
FT   gene            57232..58479
FT                   /locus_tag="Syncc9605_0061"
FT   CDS_pept        57232..58479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33840"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33840.1"
FT                   /translation="MVPPFSLFDQAEDRFEDLAWGQVLVTPFELGAWALLEPMGEQNHA
FT                   PQLCWIRPDLLGCVWMAGSGEGNAGMSVFLSLLGAEGGRWSEPQRISRDQERSEQNPLL
FT                   FVSDGCLHLIHSAQLVRDPEDRAAVDASSSFSMQWTAILRHQRLALDGLDPSDLETWSA
FT                   EAWSMPVDLFDDPAFCRNPPYPLENGHWLLPIYRSLEAGGAFGHDHSEMVRLDPSGQCL
FT                   DRPFGIPDSTGRVHGSVVASRGGEQLLQFFRSRLADQIYRSVSSDGGHTWSAPEPTQLP
FT                   NNNSSIQACWLASGRLAMIFNRFGFAPDPGASEEPLKWGEARWPRTRWPLSIAISDDDG
FT                   LQWPWIRDIDTGFGFCGPMNWDLNGQLAYPTLIEGQPGELHVAYSWAGRQAIRYVTLRE
FT                   QEVIGYDPDATPFGSF"
FT   gene            complement(58482..60326)
FT                   /locus_tag="Syncc9605_0062"
FT   CDS_pept        complement(58482..60326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0062"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33841"
FT                   /db_xref="GOA:Q3ANJ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33841.1"
FT                   /translation="MSSAYQPLHHKYRPQRFDQLVGQEAIAATLGHALTSNRIAPAYLF
FT                   SGPRGTGKTSSARILARSLNCLNSEGPTPEPCGTCELCTTIAAGTALDVIEIDAASNTG
FT                   VDNIRELIERSRFAPVQARWKVYVVDECHMLSTAAFNALLKTLEEPPPQVVFVLATTDP
FT                   QRVLPTILSRCQRFDFRRIPLDALNTHLSWIAEQEAIEIKPEAIHVVAQRSQGGLRDAE
FT                   SLLDQLSLLPPPIEAAAVWDLLGAVPEQELLELVGAMSSAEPVQLLEATRNLLDRGRDP
FT                   GAVLQGLAGMLRDLVLMAAAPDRLELTSVSPQFREQLPALAKAIGRARLLQWQAQLRGT
FT                   EQQLRQSMQPRLWLEVLLLGLLAEPLAAQSAAAAPAPRQPATTQPAAAASPPTTPVALP
FT                   APTPSTAAPAIEASTPSPKPAPAPSPELPSVATPTPAASTNLPELWQQILGSLELPSTR
FT                   MLLSQQAQLVRLDANRAVVQVAGNWMGMVQSRASLLEQAVAKALGGSRQLVLEANNSAM
FT                   PPPLATAPAAVEPPAPTPAPTPAPTAAPLQAPPATQSPPPAVAPELPRTQSEPIEPKPT
FT                   PPTAESNPQPSPPSGLDRQARNLADFFNGQVLDVDEIS"
FT   gene            complement(60350..60988)
FT                   /locus_tag="Syncc9605_0063"
FT   CDS_pept        complement(60350..60988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33842"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33842.1"
FT                   /translation="MAAADHLEVPRQHGLFNHHGIDLGDGTVAHYLEGREILRSPLEEF
FT                   SQGQPFRVINYVESSPQGVTLRRAMGRLGEQDYNLLFNNCEHFATWCKTGRHRSGQVDS
FT                   LLDRARHWSGLMPSALMRGLELLVKRGLLDDDARAMARRGVEMLERLRLSLLHKLEGLL
FT                   ERAGEGTDRRLLLTGQSLADELAAVEDLKQRIDALLQQHPALPGSESSE"
FT   gene            complement(60993..62342)
FT                   /locus_tag="Syncc9605_0064"
FT   CDS_pept        complement(60993..62342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0064"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33843"
FT                   /db_xref="GOA:Q3ANI9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33843.1"
FT                   /translation="MAKFDAHLKCSFCGKSQDQVRKLIAGPGVYICDECIDLCNEILDE
FT                   ELVDGQGNSRHSHEPSRKAMPAARKSSKPAPTLASIPRPQDIKSFLDQQVVGQDAAKKV
FT                   MSVAVYNHYKRLAWQGDGQGETEETATRLHKSNILLIGPTGCGKTLLAQTLAEMLDVPF
FT                   AVADATTLTEAGYVGEDVENILLRLLQKAEMDVDQAQRGIIYIDEIDKIARKSENPSIT
FT                   RDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLEDVV
FT                   QKRMGRNAIGFMPSDGRGRSRANRDLQAAQVLRHLEPDDLVRYGLIPEFIGRMPVSAVL
FT                   EPLDESALQSILTEPRDALVKQFRTLLSMDNVQLQFADDAIEAIAQEAHRRKTGARALR
FT                   GIVEELMLDLMYDLPSQTSVKEFTVTRAMVEEHTGGKVLPLPGAEQQKTA"
FT   gene            complement(62433..63107)
FT                   /locus_tag="Syncc9605_0065"
FT   CDS_pept        complement(62433..63107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0065"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33844"
FT                   /db_xref="GOA:Q3ANI8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33844.1"
FT                   /translation="MIDARSHHPIQNRWRAAMPVSAPGPLPTVVEQSGRGDRAFDIYSR
FT                   LLRERIIFLGTGVDDAVADALVAQMLFLEAEDPEKDIQIYINSPGGSVTAGLAIYDTMQ
FT                   QVAPDVVTICYGLAASMGAFLLSGGTKGKRLALPNARIMIHQPLGGAQGQAVDIEIQAK
FT                   EILYLKETLNGLMAEHTGQPLDKISEDTDRDYFLSPAEAVEYGLIDRVVDSSGDGGIIT
FT                   ES"
FT   gene            complement(63151..64560)
FT                   /locus_tag="Syncc9605_0066"
FT   CDS_pept        complement(63151..64560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0066"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33845"
FT                   /db_xref="GOA:Q3ANI7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33845.1"
FT                   /translation="MSAAALKVTTEARPSSRLAVTVTVPGERCKTSYEDAITSLSRSIN
FT                   LPGFRKGKVPRTVLVQQLGGVRIKATALEKLIDNAWRDAIQQESLEPISQPDLSSGFDG
FT                   LLESFEPGKELTFTLEADVAPTPKLKTTKGLKAEFETVAYDASRVDAMIEDSRKQMATV
FT                   VPVEGRAAQNGDIAVLGFKGTYTDDGSEIEGGSADSMDVDLENGRMIPGFIEGVIGMKV
FT                   GETKTVDCQFPDDYPKEDARGRKASFEIELKDLKTRELPELDDEFAKQASEQETLADLR
FT                   KDLEQRLKDDAERRQTSNRRDALVAALVEQLEVELPEALIQQESRNLLEQTAAQFAQQG
FT                   MDVKSLFTPDLVRNLMQNSRPEAEERLRRSFALTALAEAEDIKLDDKAVDAKIKEVKKE
FT                   LSADAKIDPERLRQAVMDDLIQDRLMGWLEENSTITEKAPAADDSKAEAKKKPAAKKAE
FT                   AKSKSKADAKD"
FT   gene            64718..65740
FT                   /locus_tag="Syncc9605_0067"
FT   CDS_pept        64718..65740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0067"
FT                   /product="Aspartate-semialdehyde dehydrogenase, USG-1
FT                   related"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33846"
FT                   /db_xref="GOA:Q3ANI6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33846.1"
FT                   /translation="MSSTLPNRPLNVAVLGASGAVGQELLLLLEERRFPVGELKLLASA
FT                   RSAGQTQTWNGRTLTVEEVSAQSFEGVDLVLASAGGSVSKQWREAITAAGAVMVDNSSA
FT                   FRMEEGVPLVVPEVNPDAAFVHRGVIANPNCTTILLTLALAPLAAMRVMRRVVVSTYQS
FT                   ASGAGARAMEELKNLSQTVLDGGTPKGEVLPYSLAFNLFLHNSPLQANSYCEEEMKMVN
FT                   ETRKIMGLPDLRFTATCVRVPVLRAHSEAVNIEFESPFPVDEARELLAAAPGVELIDDS
FT                   AANRFPMPTDVTGRDPVAIGRIRQDISNANALELWLCGDQIRKGAALNAVQIAELLIQK
FT                   "
FT   gene            65740..66648
FT                   /locus_tag="Syncc9605_0068"
FT   CDS_pept        65740..66648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0068"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33847"
FT                   /db_xref="GOA:Q3ANI5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33847.1"
FT                   /translation="MTQAATLSPTPFGRVVTAMVTPFDASGAVDLSVAANLARHLVEQG
FT                   SDGLLVCGTTGESPTLSWDEQLQLLQAVRDAVGSDAKVLAGTGSNSTAEAVEATKEAAA
FT                   AGADGALVVVPYYNKPPQEGLEAHFRAIAEAAPELPLMLYNIPGRTGCSIAPATVARLM
FT                   DCPNVVSFKAASGTTEEVTALRLACGPQLAIYSGDDGLTLPMLAVGAVGVVSVGSHVAG
FT                   PEIRAMIEAYLNGDGASALALHDALIPLFKALFATTNPIPVKAALELNGWSVGAPRPPL
FT                   CSLSDDMKRSLSNAMAALRQT"
FT   gene            66701..68740
FT                   /locus_tag="Syncc9605_0069"
FT   CDS_pept        66701..68740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33848"
FT                   /db_xref="GOA:Q3ANI4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33848.1"
FT                   /translation="MANNARSSKGQEPCLRVIPLGGLHEIGKNTCVFEYGDDLMLVDAG
FT                   LAFPSDGMHGVNVVLPDTSFLRENQKRIRGMIVTHGHEDHIGGIAHHLKHFNIPVIYGP
FT                   RLALSMLTGKMDEAGVRDRTTLQTVAPRDVVKVGQHFSVEFIRNTHSMADSFSLAISTP
FT                   VGTVIFTGDFKFDHTPVDGENFDMARLAHHGDKGVLCLFSDSTNSEVPGFCPPERSVFP
FT                   NLDRHIANAEGRVIVTTFASSIHRVSMILELALKNGRKVGLLGRSMLNVIAKARELGYM
FT                   RAPDELFVPIKQINDVPDRETLLLMTGSQGEPLAALSRISRGEHPQVKVKTTDTIIFSA
FT                   SPIPGNTISVVNTIDKLMMLGAKVVYGKGEGIHVSGHGFQEDQKLMLALTRPKFFVPVH
FT                   GEHRMLVQHSRTGHAMGVPVDNTLIIDNGDVVELTPDSIRKGNAVKAGIELLDQSRNGI
FT                   VDARVLKERQQLAEDGVVTILAAISTDGAMVAPPRVNLRGVVTTADARKMSLWVEREIK
FT                   WVLENRWKQLCRNTGGKAPEVDWMGVQREVEVGLGRRMRRELQVEPLILCLVQPAPGGT
FT                   PVYKGRADAEPDDRPAPRGRGGRGGGSPYGRRNGGGGGTPAPVRNNQGNGRSGSATPAP
FT                   VRAAAATAVVEKVAPQPVAEKAAPASPEPEMPAGRTRRRRSAAS"
FT   gene            complement(68726..69415)
FT                   /locus_tag="Syncc9605_0070"
FT   CDS_pept        complement(68726..69415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33849.1"
FT                   /translation="MGSTRKRTRRARSKPGLGLAGGGVVAPRSHPAAWAPATGASRHLL
FT                   RTGVQGDVDATITALAEQGLQRCQSEDIASEAGTTPATNGAITDLLRDPFLSTDPDQAR
FT                   PAPADLVTAMPWLSNDAEPRAMPTADPFPPLTPIPAPVQSPEPTVSPEANPQAEMQQEP
FT                   EPTTEEPPLDAIKPTPQPQKPEAAKLLEHSWLRVQLQPEIKSPTDSVEPMGLINRIKGV
FT                   FARSAGR"
FT   sig_peptide     complement(69314..69415)
FT                   /locus_tag="Syncc9605_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.787) with cleavage site probability 0.587 at
FT                   residue 34"
FT   gene            complement(69541..71346)
FT                   /locus_tag="Syncc9605_0071"
FT   CDS_pept        complement(69541..71346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0071"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33850"
FT                   /db_xref="GOA:Q3ANI2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33850.1"
FT                   /translation="MALLVQKFGGTSVGSVERIRAVADRIGRCREEGHDVVVVVSAMGH
FT                   TTDELTGLANAITSAPTQREMDMLLASGEQVSIALLAMALNAQGVSATSMTGPQVGIAT
FT                   ESTHGRARILGIRTDRIRNRLAAGQVVVVAGFQGTSTSSDGLNEITTLGRGGSDTSAVA
FT                   LAAALGADACEIYTDVPGVLSTDPRKVSDAQLMETISCDEMLELASLGASVLHPRAVEI
FT                   ARNYGVNLVVRSSWSDAPGTRITSRSARPISSSGLELGSPVDGMEEVDGQAVLALSQIP
FT                   DQPGIAARLFETLSEAGINVDLIIQATHEGSSNDITFTVSEADLELARPVCQKVLDQLG
FT                   GDLASEGGLTKLSISGAGIMGRPGIAAGLFKCLCQQGINLRLIATSEVKVSCVIDSGAG
FT                   SKAVQAVQEAFALEDSQIRINPTDNGSGEPEVRGVALDRDQVQLSVRHVPDRPGTAAAL
FT                   CSALADNSISLDAIVQSERQHSDGSRDITFILRKDDRARADVALAPLLAQWPGAALEDG
FT                   EAIARVSAVGAGMPATPGTAGRMFRALADAGINIGLIATSEIRTSCVVAEDAGVQALQV
FT                   VHAGFGLGGEERHTAQGTASPHDPD"
FT   gene            complement(71394..72359)
FT                   /locus_tag="Syncc9605_0072"
FT   CDS_pept        complement(71394..72359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0072"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33851"
FT                   /db_xref="GOA:Q3ANI1"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33851.1"
FT                   /translation="MPIHLLWGDDAAARDRAINALIGQVVDPSWSSLNLSRLDGADAGQ
FT                   ALQALEEARTPPFATGERLVLLQRSPFCNGCPSELADRFEAALELIPDSSHLVLVNPAK
FT                   PDGRLRTTKALQKRIKSGIDQEQSFPLPAAWDGNGQRQLVRRTAEALALKVEPDAIDAL
FT                   VEAIGTDSARLESELRKLSLQDTSISAARVQELVGGRSTNALAVGDALLEGNPGEAIAR
FT                   WDALIEAGEPALRIVATLTGQIRGWLWVSLLEQQGERDVAVIAKAAGIGNPKRIYVMRK
FT                   KLQGRPTKRFLSLLGRLLEVEARLKRGAQPGDAFRDGLLG"
FT   gene            72378..73016
FT                   /locus_tag="Syncc9605_0073"
FT   CDS_pept        72378..73016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0073"
FT                   /product="putative precorrin-8X methylmutase CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33852"
FT                   /db_xref="GOA:Q3ANI0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33852.1"
FT                   /translation="MAQDHPIFTESIRRIRAALGDTGLPPLQQQVLERLVHSSGDLSLG
FT                   TLLRFSEGACEQGLAALKQGAPILTDTAMAAAAVAPMAQRTLGTAVHTVLEWAPEAVPA
FT                   GSTRTAAGMQRAWRALAEASPAPVVLIGSAPTALEVLLQQVAAGAPAPSLVIGMPVGFV
FT                   GVSESKKHLAASGLVQIRLESSRGGAGLVAAAVNALLRAAAAPAHPPSS"
FT   gene            complement(72964..73968)
FT                   /locus_tag="Syncc9605_0074"
FT   CDS_pept        complement(72964..73968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0074"
FT                   /product="possible MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33853"
FT                   /db_xref="GOA:Q3ANH9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33853.1"
FT                   /translation="MGETHPTSLGWTSWHDRLHRRLLMQPQLLPKGSSLLLAVSGGQDS
FT                   MALLALLQDLAPLHGWGLNLWHGDHGWHDNSSRIAAELSSWCKQRQLSLQVDQAAPGEV
FT                   PSEAKARQWRYERLAQRGNQAGADVVTGHTASDRAETMLLQLARGSDLAGLAALPSVRP
FT                   LSPEGPRLRRPLLHLQRRDTLQICRDLALPIWEDPSNQSPEFARNRIRQEVLPVLEELH
FT                   PGCSQRISDLAERVSQVRDSQTELSQMALELLQTAAGLDRRGLGALSSATRRLLLAQWL
FT                   QQQGVPAPPASQLNELSRRLESGAPSGAADLAGGWQLSWRGGELVLQQREAEH"
FT   gene            74004..74762
FT                   /locus_tag="Syncc9605_0075"
FT   CDS_pept        74004..74762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33854"
FT                   /db_xref="GOA:Q3ANH8"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33854.1"
FT                   /translation="MTRLQQLPVSLQRSLEQRSALKVIAGLMNFDAASVERVARAAGRG
FT                   GADLIDVACDPALVRLAIEASGGVPVCVSSVEPEQFPAVVEAGALMVEIGNYDAFYPQG
FT                   RIFDAAEVLELTRRTRQLLPNVVLSVTVPHVLPMDEQEQLAIDLVAAGADLIQTEGGTS
FT                   AKPFSAGHLGLIEKAAPTLAAAHSISRAVDVPVLCASGLSAVTLPMAIAAGAAGVGVGS
FT                   AVNCLQDELAMVAVVRGLRDALGSAVATRV"
FT   gene            74734..75063
FT                   /locus_tag="Syncc9605_0076"
FT   CDS_pept        74734..75063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33855"
FT                   /db_xref="GOA:Q3ANH7"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33855.1"
FT                   /translation="MAALSRPASEPESPLSGALFPSWCEECSARSREQQLSCENRHLTS
FT                   SSMQFINTLTVLALVVASFALIVAVPVLYASSEDSGRSNRLILLGSAVWVALVLLNWGV
FT                   SFFVV"
FT   gene            75127..75609
FT                   /locus_tag="Syncc9605_0077"
FT   CDS_pept        75127..75609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0077"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33856"
FT                   /db_xref="GOA:Q3ANH6"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33856.1"
FT                   /translation="MATFEGRFSDAAGLRVGIVVARFNDLVTAKLLSGCLDCLKRHGVD
FT                   VSETSSQLDVAWVPGSFELPIVAQQMARCGQYQVLITLGAVIRGDTPHFDVVVAEASKG
FT                   VAAVARDTSVPVIFGVLTTDTMQQALERAGIKSNLGWSYGLEALEMGSLMRALPSA"
FT   gene            complement(75614..78325)
FT                   /locus_tag="Syncc9605_0078"
FT   CDS_pept        complement(75614..78325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0078"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33857"
FT                   /db_xref="GOA:Q3ANH5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33857.1"
FT                   /translation="MPRSASQPPDDALQGNLFGAPEPAAPSATATASEPETASHDLSDD
FT                   ELGADAAARPRTRQATASEGSSEAPAANDSEPSRDEPAWGHHSQLDPLQLTPMLRHYVE
FT                   LKAAHPERVLLYRLGDFFECFFEDAIELSRVLELTLTGKEGGKAIGRVPMAGIPHHAAE
FT                   RYCAELIKQGYSVALCDQLETTPTKGALLKRDITRVLTPGTVLEEGMLSARRNNWLAAV
FT                   VVEPAQGKQPLRWGLASADVSTGEVQVMQREDSSALHQQLAQQEASELLWAAALDTERP
FT                   AWCPERLRLTPMASTPFSPVEAERTLQQHYGLSSLDGLGLPEHPLALQALGGLLGYLQD
FT                   TQPLEEDSRIPLEVPAIVHRGDALVLDAQTRRNLELTATQRDNQLQGSLLWAIDRTLTA
FT                   MGGRCLRRWLEAPLMDRQAIQQRQDLVSSLVGERSLRLAIRQLLRPMGDLERLAGRAGA
FT                   GHAGARDLVAIADGLERLPQLTARLKSAISTGPEWLQQLLSPDPALAELARTIRHKLVE
FT                   APPLSLSEGDLIHDGVDPLLDGLRNQLDDQDAWLSHQEQQERQRCGISTLKLQHHRTFG
FT                   YFLAVSKAKATAVPEHWIRRQTLANEERFITPDLKEREGRIFQLRARACQREYELFCQL
FT                   REQVGAMAAPIRQAARAVAALDALTGLGDVAASGGYCAPTITDGRGLQLEDSRHPVVEQ
FT                   RLVETAFTPNDVQLGEGTDLVVLTGPNASGKSCYLRQIGLIQLMAQIGSWVPARSATVG
FT                   IADRIFTRVGAVDDLAAGQSTFMVEMAETANILHHASDRSLVLLDEIGRGTATFDGLSI
FT                   AWAVSEHLAGDLGSRTVFATHYHELNNLAAERDNVANFQVLVEETGEDLVFLHQVQAGG
FT                   ASRSYGIEAARLAGVPKPVVQRARQVLDQLTA"
FT   gene            complement(78378..78833)
FT                   /locus_tag="Syncc9605_0079"
FT   CDS_pept        complement(78378..78833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33858"
FT                   /db_xref="GOA:Q3ANH4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33858.1"
FT                   /translation="MTPIRLVHHAPGAPGLRWLGLGPDLRPSRALLKLQRLFDRHAFWA
FT                   RGRSFSQLRRLLAGSDAVVSLWRGKRLVGFGRATSDGFSRAVLWDIVVAGDLQGHGLGR
FT                   RVIEELLHTPPVVGVERVYLMTTKSAGFYRQLGFQDANPQQLMVLRR"
FT   gene            78836..80944
FT                   /locus_tag="Syncc9605_0080"
FT   CDS_pept        78836..80944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0080"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33859"
FT                   /db_xref="GOA:Q3ANH3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33859.1"
FT                   /translation="MGEPQHFILLPGDNRQPPSGTATMPAYDLTAPYSPKGDQPTAIEQ
FT                   LVKGVNGGERYQTLLGATGTGKTFTMANVIAKTGRPALVLAHNKTLAAQLCNELREFFP
FT                   ENAVEYFISYYDYYQPEAYVPVSDTYIAKTASINEEIDMLRHSATRSLFERRDVIVVAS
FT                   ISCIYGLGIPSEYLKAAVKFEVGETLNIRGQLRELVNNQYSRNDTEIARGRFRMKGDVL
FT                   EIGPAYEDRLVRIELFGDEVEAIRYVDPTTGEILQSMDAVNIYPAKHFVTPKDRLDSAI
FT                   SAIRSELRERLDVLNGEGKLLEAQRLEQRTKYDLEMLGQVGYCNGVENYARHLAGREEG
FT                   TPPECLIDYFPDDWLLIVDESHVTCSQLQAMYNGDQARKKVLIEHGFRLPSAADNRPLK
FT                   GEEFWDKAKQTVFVSATPGNWEMEVSGGEVAEQVIRPTGVLDPVVEVRPTTGQVDDLLG
FT                   EIRDRAAKNQRVLVTTLTKRMAEDLTDYLAENDVRVRYLHSEIHSIERIEIIQDLRLGE
FT                   YDVLVGVNLLREGLDLPEVSLVAILDADKEGFLRAERSLIQTIGRAARHVEGVALLYAD
FT                   NMTESMAKAISETERRRAIQQAYNEKHGVVPTAAGKKASNSILSFLELSRKLKQDGPDA
FT                   DLVEVVGKAAQALENDPDAGLALEALPELIDQLEAKMKEAAKKLDFEEAANLRDRVKQL
FT                   RQKMAGSR"
FT   gene            81036..81107
FT                   /gene="tRNA-Gly3"
FT                   /locus_tag="Syncc9605_R0002"
FT   tRNA            81036..81107
FT                   /gene="tRNA-Gly3"
FT                   /locus_tag="Syncc9605_R0002"
FT                   /product="tRNA-Gly"
FT   gene            81186..83990
FT                   /locus_tag="Syncc9605_0081"
FT   CDS_pept        81186..83990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0081"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33860"
FT                   /db_xref="GOA:Q3ANH2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33860.1"
FT                   /translation="MLKLLLGDPNARKLKRYQPIVSDIQLLEEEIAPLSDDELRGRTAA
FT                   FQERLANAGSLANQRPILDEILPEAFAVVREAGKRVLGMRHFDVQLIGGMVLHEGQIAE
FT                   MKTGEGKTLVATLPSYLNALTGRGVHVVTVNDYLARRDAEWMGQVHRFLGLSVGLIQQD
FT                   MRPEERRRNYNCDITYATNSELGFDYLRDNMAADISEVVQREFQYCVIDEVDSILIDEA
FT                   RTPLIISGQVERPQEKYQQAAEVANALARAAELSKDGIDPEGDYEVDEKQRSCTLTDEG
FT                   FAKAEQMLGVADLFNPQDPWAHYITNALKAKELFVKDVNYIVRDGEAVIVDEFTGRVMP
FT                   GRRWSDGQHQAIEAKEALAIQSETQTLASITYQNFFLLYPRLAGMTGTAKTEEVEFEKT
FT                   YKLETTIVPTNRVRARQDWADQVYKTEAAKWRAVANETAEIHKNGRPVLVGTTSVEKSE
FT                   LLSSLLAEQEIPHNLLNAKPENVERESEIVAQAGRAGAVTIATNMAGRGTDIILGGNSD
FT                   YMARLKLREVLLGRLVKPEEDHTPPVPLQRSAPGGFSDAAAPSLPRSGESLYPCPLTDD
FT                   TDQALGQLARDLVKAWGDRALTVIELEERIATAAEKAPTEAPQIQALREAIARVKGEYD
FT                   AVVKQEESRVREAGGLHVIGTERHESRRVDNQLRGRAGRQGDPGSTRFFLSLGDNLLRI
FT                   FGGDRVAGLMNAFRVEEDMPIESGMLTRSLEGAQKKVETYYYDIRKQVFEYDEVMNNQR
FT                   RAVYSERRRVLDGRALKKQVIGYGERTMGEIVEAYVNPDLPPEEWDLDQLVGKVKEFIY
FT                   LLEDLTPDQVQGLGMEELKAFLQEQLRNAYDLKEGQIEQQRPGLMREAERFFILQQIDT
FT                   LWREHLQAMDALRESVGLRGYGQKDPLIEYKNEGYDMFLEMMTNMRRNVIYSMFMFQPQ
FT                   APKN"
FT   gene            complement(84327..85073)
FT                   /locus_tag="Syncc9605_0082"
FT   CDS_pept        complement(84327..85073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0082"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33861"
FT                   /db_xref="GOA:Q3ANH1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33861.1"
FT                   /translation="MFDHIRADLAIIRERDPAARGWLEILFCYPGFQAISLHRISHRLW
FT                   SCQLPLKLAARCLSQIGRALTGIEIHPGARIGHSVFIDHGMGVVIGETAEIGHRCLLYQ
FT                   GVTLGGTGKEHGKRHPTLAENVVVGAGAKVLGAITIGTNTRIGAGSVVVRDVESDCTVV
FT                   GIPGRVIHQSGVRINPLAHSALPDAEANVIRNLMERIDQLENTVMNLKRCLQEVAAGRQ
FT                   LLEECSGEAQNLKDREILEFLGDSTR"
FT   gene            complement(85084..86085)
FT                   /locus_tag="Syncc9605_0083"
FT   CDS_pept        complement(85084..86085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0083"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33862"
FT                   /db_xref="GOA:Q3ANH0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33862.1"
FT                   /translation="MRFHIQQESDIPASTQLYNQICFAIAARHYPPGHRLPSTRQLAMQ
FT                   TGLHRNTISKVYRQLETDGVVEAMAGSGIYVRDQQKPREIKTPPHIRNRGVTDLDREVR
FT                   KCVDGLLNAGCTLQQTRELLTREIDWRLRCGARVLVSTPREDIGASMLIAEELEPCLDV
FT                   PVEVVPLEELESVLENSSNGTVVTSRYFLQPVEELAKKHSVRAVAVDLNDFRQELAMLK
FT                   ELRPGSCVGLVSISPGILRAAEVILHSMRGNELLLMTATPDVGSRLLALLRASSHVLCD
FT                   RPSLPLVEQSLRQNRSQLMRMPQVHCAESYLSTDTIDLLRKEIGLQTPAAAS"
FT   gene            86105..86932
FT                   /locus_tag="Syncc9605_0084"
FT   CDS_pept        86105..86932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0084"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33863"
FT                   /db_xref="GOA:Q3ANG9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33863.1"
FT                   /translation="MRPPYGANCLVTIRGVSYAVMESSGLGRSDWVEVLNGPVRLRCWW
FT                   AEPVIAANDIESKPFINRAYIVLPEVFGVNGWVRSVADRLAAHGHPALVIPLFARTAPD
FT                   LELSYEPSDLAQGRRHKDATTTEQILGDVAAAVSWLGVRYPQAAVHVVGFCFGGHAAFL
FT                   AATLPGVKHAFDFYGAGVSRMRPGGGEPSLALLPEIKARLTCVFGTADPLIPLEDREAI
FT                   RVALSKADPACQRLRFVEYAGADHGFMCEARSNFHPQASAQGWSLLLGDDPAV"
FT   gene            complement(86929..87582)
FT                   /locus_tag="Syncc9605_0085"
FT   CDS_pept        complement(86929..87582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0085"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33864"
FT                   /db_xref="GOA:Q3ANG8"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33864.1"
FT                   /translation="MPPRPRFDRRAPVRELPNINDRINYPQLRVVDSDGAQLGVISREE
FT                   ALDVARDRELDLVLVSEKADPPVCRIMDYGKFKFEQEKKAKEAKKKSHQTEVKEVKMRY
FT                   KIDQHDYDVRIGQAQRFLKAGDKVKCTVIFRGREIQHTALAETLLRRMAKDLEEKAEIQ
FT                   QAPKREGRNMIMFLTPRKTPLVKKEEKEQAANKAVRTIPAPPRPTAAKVASPQG"
FT   gene            complement(87640..88539)
FT                   /locus_tag="Syncc9605_0086"
FT   CDS_pept        complement(87640..88539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0086"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33865"
FT                   /db_xref="GOA:Q3ANG7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33865.1"
FT                   /translation="MNSSNPLVITLLGPTASGKTALALDIAERLDLPVFNVDSRQLYRE
FT                   MDIGTAKPTAEQQARIPHHLLDLRTPDQPITLQEFQAIATPCINAALEQRDVALLVGGS
FT                   GLYLKALTSGLQPPAVAPQPQLRQQLTALGQQICHPLLQAADPKAAAKIAPADAVRTQR
FT                   ALEVLYGSGQPMSRQATAAPPPWRVLELGLNPANLRQRIQQRTEQLYRDGLVDETQRLS
FT                   ERYGADLPLLQTIGYSEALQMIGGSLTTTEAVRITSQRTRQFAKRQRTWFRRQHNPHWL
FT                   PDQATLTDAMTLIEQHLR"
FT   sig_peptide     complement(88468..88539)
FT                   /locus_tag="Syncc9605_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.813) with cleavage site probability 0.678 at
FT                   residue 24"
FT   gene            88692..90659
FT                   /locus_tag="Syncc9605_0087"
FT   CDS_pept        88692..90659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0087"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33866"
FT                   /db_xref="GOA:Q3ANG6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33866.1"
FT                   /translation="MSDASKVQNAYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLV
FT                   YEVVDNSVDEALAGHCDRIVVVLGEDGSASVSDNGRGIPTDVHPRTGKSALETVLTVLH
FT                   AGGKFGAGGYKVSGGLHGVGVSVVNALSEWVQVTVRRQGQVHRQRFERGAAIGVLASES
FT                   QPAAESGETGTTVCFKPDLEIFTGGIVFDYATLSARLRELAYLNGGVRIVFRDERESAR
FT                   DGEGNPHEETYFYEGGIKEYVAYMNKEKDALHPDIIYVNSEKDGVQVEAALQWCSDAYS
FT                   DSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKESDSNLAGENIREGLTAV
FT                   LSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGEALSQFLEFNPSVIGLILEKAIQAFNA
FT                   AEAARRARELVRRKSVLESSTLPGKLADCSSRDPGESEIYIVEGDSAGGSAKQGRDRRF
FT                   QAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDA
FT                   DVDGAHIRTLLLTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEGDLQKTLEG
FT                   FGEKANYTIQRFKGLGEMMPKQLWETTMDPTTRTMKRVEIEDALEADRIFTILMGDKVA
FT                   PRREFIETHSAELDMAALDI"
FT   gene            90659..90994
FT                   /locus_tag="Syncc9605_0088"
FT   CDS_pept        90659..90994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33867"
FT                   /db_xref="GOA:Q3ANG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33867.1"
FT                   /translation="MTAVRTGTVSTSSVLRWSWLLGVALMAPAALPAGGADRRQPQPRR
FT                   RAASGPLHTAADQPLRLSPLAVAPRLSTLEAGSSLRLLRHWSNADGQDWLHVQTLSGDQ
FT                   RRGWLRA"
FT   sig_peptide     90659..90766
FT                   /locus_tag="Syncc9605_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.930 at
FT                   residue 36"
FT   gene            90975..91355
FT                   /locus_tag="Syncc9605_0089"
FT   CDS_pept        90975..91355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0089"
FT                   /product="integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33868"
FT                   /db_xref="GOA:Q3ANG4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33868.1"
FT                   /translation="MAGSAPEAVLVGLGAIPGAWLRLKVVNHFQPMVPKKHWGTFLVNV
FT                   VACFALGLVLALNETCTASTGIALLMGVGFFGSLSTFSTFAVELLNELRAGQLLTALVL
FT                   AVASIGVGLLACAVGYGIGTHA"
FT   gene            91348..91746
FT                   /locus_tag="Syncc9605_0090"
FT   CDS_pept        91348..91746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0090"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33869"
FT                   /db_xref="GOA:Q3ANG3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33869.1"
FT                   /translation="MPEAKPGLQLELLELLLVGAGAVPGALLRWQLALYLGDQNLLVNV
FT                   LGAALLGFLSGLPAAPRRQLLLGIGFCGSVTTFSSWMLAAVKHLSAGDWAAALGLIGLT
FT                   LGLGLGAAALGFNLGRRLKPPEPPQSPT"
FT   gene            complement(91712..92236)
FT                   /locus_tag="Syncc9605_0091"
FT   CDS_pept        complement(91712..92236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0091"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33870"
FT                   /db_xref="GOA:Q3ANG2"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33870.1"
FT                   /translation="MYGRYSRLTSALHPCFTMAISVSAVSVTTPDGSSKSLGDYAGKVL
FT                   LIVNVASRCGFTKQYAGLQALNEAYAAKGLAVLGFPCNDFGAQEPGSLDEIKSFCSTTY
FT                   GADFELFEKVHAKGSTTEPYTTLNQMEPSGDVEWNFEKFLVGKNGTVIARFKSGVTPED
FT                   LKSAIEAALAA"
FT   sig_peptide     complement(92156..92236)
FT                   /locus_tag="Syncc9605_0091"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.718) with cleavage site probability 0.508 at
FT                   residue 27"
FT   gene            92258..93718
FT                   /locus_tag="Syncc9605_0092"
FT   CDS_pept        92258..93718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0092"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33871"
FT                   /db_xref="GOA:Q3ANG1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33871.1"
FT                   /translation="MTEASGLSSAGVSVEPDLLAEAVSHELAAILQAGNYDAVKLLLEP
FT                   VQPVDIAEAIGNLPANLQAIAFRLLSKDEAISVYEYLDTATQQSLLSLLRSGEMREVVE
FT                   EMSPDDRARLFEELPAKVVRQLLTELSPDERKVTAELLGYRAETAGRLMTTEYIAFKEN
FT                   QTAGVALEIVRRRARDTETIYSLYVTDAERRLTGILSLRDLVTADPQARIGDVMTEEVL
FT                   SVSTDTDQEKVARTIQRYDFLAVPVVDLEQRLVGIVTVDDVIDVIEQEATRDLYAAGAV
FT                   QAGDDDDYFSSNLFTVARRRVVWLAVLVLASFFTSEVIAANEDVLQRVVLLAAFIPLLG
FT                   GTGGNVGAQSSTVVIRGLSTQSISSLGPLRAIGREAMAGALLGVLMMLLVVPFAWWRGE
FT                   SALVGLSVGMSLLAITTLAATAGAAFPLLFDRMGLDPALMSTPFITTCTDVAGTLIYLK
FT                   TAGWLLVHLPQLVQATGISTHFFAFAVF"
FT   gene            93773..94780
FT                   /locus_tag="Syncc9605_0093"
FT   CDS_pept        93773..94780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0093"
FT                   /product="type II alternative RNA polymerase sigma factor,
FT                   sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33872"
FT                   /db_xref="GOA:Q3ANG0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33872.1"
FT                   /translation="MAPAATAASKPKTSVKTAKAVTADVDLVRSYLRDIGRVPLLTHEQ
FT                   EITLGRQVQELMDLESLESELKSKAGEKPSRDQLAKASGLSSIQLKRKLQHGRRAKERM
FT                   VAANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPTRGYKFSTYAYWWIRQG
FT                   ITRAIAEKSRTIRLPIHITEMLNKLKKGQRELSQELGRTPTVTELAEFVELPEDDVKDL
FT                   MCRARQPVSLEMKVGDGDDTELLELLSGDGDLPSDQVEEDCLKGDLRSLLGQLPHLQEQ
FT                   VLRMRYGMDGEDPMSLTGIGRILGMSRDRVRNLERDGLAGLRRVSDQVEAYVAC"
FT   gene            complement(94783..95685)
FT                   /locus_tag="Syncc9605_0094"
FT   CDS_pept        complement(94783..95685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33873"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33873.1"
FT                   /translation="MSPSHNLWSWNERSIGWSLMGDPNAEVAVLLIHGFGANTNHWRFN
FT                   QPVLAELLPTYAIDLLGFGRSDQPRARLKDESVSADAVHYGFDLWGQQVADFCRQVIDR
FT                   PVRLVGNSIGGVVALRAAQLLGERCRGVVLIDCAQRLMDDKQLATQPAWMAWIRPLLKT
FT                   MVRQRWLSTALFRNAARPGVIRSVLKQAYPSGANIDDDLVNLLFQPTQREGAAEAFRGF
FT                   INLFDDYLAPQLMEELKLPVDLIWGELDPWEPIAEAERWAQTLNCVQSLSVVQNAGHCP
FT                   HDEAPDKVNPVLQRLINKN"
FT   gene            95750..96703
FT                   /locus_tag="Syncc9605_0095"
FT   CDS_pept        95750..96703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0095"
FT                   /product="MoxR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33874"
FT                   /db_xref="GOA:Q3ANF8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33874.1"
FT                   /translation="MARRTCQVGAVLRVTPLPAPELLPLLEAVGRVLLGKEHQVRLAFN
FT                   CLLVGGHLLIEDRPGMGKSTLAEALGRVFALAFKRVSFTSDLLPADLTGLNVFNPAEAS
FT                   FRFQPGPLFTQVLLADEINRASPRTQSALLEAMAAGRVSVDGVSNSLPEPFFVIATQNS
FT                   LDQVGTSPLPEAQLDRFLMRLSLGFPDRASERALLCAGFDPTFDSSLPRLAPEALQLLQ
FT                   HCCSAQHCSELLIDYVLDLVEVSRQRHLGLSPRASQGLLAAARAWSLLDGRDHVVIDDV
FT                   QAVLPAVVEHRLDAGCPARHGAPHSEALVQAVPTLR"
FT   gene            96630..97235
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0096"
FT   gene            97192..97647
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0097"
FT   gene            97925..98527
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0098"
FT   gene            98442..99632
FT                   /locus_tag="Syncc9605_0099"
FT   CDS_pept        98442..99632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0099"
FT                   /product="mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33875"
FT                   /db_xref="GOA:Q3ANF7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33875.1"
FT                   /translation="MPRSPHPSARTIHASGGNSAPGLLNNSVELSACLLSWWQAHGRRD
FT                   PVQKPWMFKPAGTWPEAVHQLDPYGIWIAEVMLQQTQLAVALPYWMRWMEAFPTVETLA
FT                   AASLDEVRLQWQGLGYYSRVRRLHEAAQRLVGRPWPRSLEEWMALPGIGRTTAGSILSS
FT                   AFNLRLPILDGNVKRVLARLTAHARPPARDDALFWCWSEALLDPVRARDTNQALMDLGA
FT                   TLCTPRQPACHRCPWHSQCAAYASGDPCRWPVTNAPKPLPFQVIGVGVVLNAAGEVLID
FT                   QRLEEGLLGGMWEFPGGKQEQGETIETCIARELKEELGIAVTVGAELITVDHAYSHKKL
FT                   RFVVHLCDWMSGEPQPLASQQVRWVRPDDLVDYAFPAANARIIEALLGSLESSAHP"
FT   gene            99654..100610
FT                   /locus_tag="Syncc9605_0100"
FT   CDS_pept        99654..100610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0100"
FT                   /product="putative fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33876"
FT                   /db_xref="GOA:Q3ANF6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33876.1"
FT                   /translation="MALGSVVVCLGEALIDRLGPPGGDPAVDHPLDDRLGGAPANVACG
FT                   LARLGTPVAFAGRLGQDAIGEAFSSLFAKRGVDTTLLQRDAKCPSRIVLVRRSLDGERQ
FT                   FQGFAGDEGAGFADQALEPVALPEVQWLLIGTLPLASTASAAALFSAARQARSQGTALA
FT                   LDVNWRPTFWDATADAEAGPSSAAKDAIQPLLEQAALIKLAREEALWFFNTDDPGSIQQ
FT                   SLSQRPDVVVTDGASPVLWQLGDESGQQAAFQPPSVVDTTGAGDAFTAGLLHRWAAAPQ
FT                   ERVRFAAACGALVCGGAGGIDPQPTQAQVEAFLGGVS"
FT   gene            complement(100577..101068)
FT                   /locus_tag="Syncc9605_0101"
FT   CDS_pept        complement(100577..101068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0101"
FT                   /product="Protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33877"
FT                   /db_xref="GOA:Q3ANF5"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33877.1"
FT                   /translation="MDICRDAEASGSLETDSTGLVWALETLETTQALGRSLARELPRGA
FT                   ILLLSGPLGAGKTSLVQGLAEGLGITEPITSPTFALAQHYPQGSPQLVHLDLYRLEQPT
FT                   SADELFLQEEEEARAAGALMAVEWPERLGLDLAEAWLLELHHQDEGRLAQLTPPRKAST
FT                   "
FT   gene            101099..102529
FT                   /locus_tag="Syncc9605_0102"
FT   CDS_pept        101099..102529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0102"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33878"
FT                   /db_xref="GOA:Q3ANF4"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33878.1"
FT                   /translation="MVAAPTSPAELKLGVDCVIADINLADFGRKELDIAETEMPGLMAL
FT                   REKYGSEKPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAIAA
FT                   KGIPVFAVKGETLEEYWDYTHSILEWGDGGSPNMILDDGGDATGLVMLGSKAEQDITVL
FT                   DNPGNEEETFLFASIKKKLAQDPTFYSRTKAQIQGVTEETTTGVARLYKMQKSGELPFP
FT                   AINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVIGYGDVGKGSAQSLRGL
FT                   GATVCIAEVDPICALQAAMEGYRVVRLEDVVEDMDIFVTATGNYQVIRNEHLVKMKDEA
FT                   IVCNIGHFDNEIDVASLKEYEWENIKPQVDHITLPSGNRIILLAEGRLVNLGCATGHPS
FT                   FVMSNSFTNQVLAQIELFTKGDEYAKEVYVLPKHLDEMVARLHLGRIGANLTELSKDQA
FT                   DYINVPVEGPYKPDHYRY"
FT   gene            102601..103260
FT                   /locus_tag="Syncc9605_0103"
FT   CDS_pept        102601..103260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0103"
FT                   /product="putative alkaline phosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33879"
FT                   /db_xref="GOA:Q3ANF3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33879.1"
FT                   /translation="MGLSDLITQLPELIGQAVEANQWLGYTAIFAAMFLENLFPPIPSE
FT                   LIMPLGGFYVQQGQLDLVPVVLAGLLGTVLGALPWYGIGRLINEERIEAWLQRHGRWIG
FT                   ISADELARSRRWFSRYGTALVFWGRLVPGIRTLISVPAGIEMMPMAPFLVWTTAGSLIW
FT                   TALLTVAGMVLGEGYSNVEIWIDPVSKAVKVLLVVAVLAGTIWLGLRIWRRRQSSD"
FT   gene            complement(103294..103671)
FT                   /locus_tag="Syncc9605_0104"
FT   CDS_pept        complement(103294..103671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0104"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33880"
FT                   /db_xref="GOA:Q3ANF2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33880.1"
FT                   /translation="MGVNSVTLVGRAGRDPEVRYFESGSMVANLTMAVNRRSRDDEPDW
FT                   FNLEIWGKQAQVAADYVKKGSLLGIIGSFKLDRWTDRASGEERSKPVVRVDRLELLGSK
FT                   RDNQEAAGSFGGHASDEEIPF"
FT   gene            103814..104866
FT                   /locus_tag="Syncc9605_0105"
FT   CDS_pept        103814..104866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0105"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33881"
FT                   /db_xref="GOA:Q3ANF1"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33881.1"
FT                   /translation="MFFRRFQLSRDIGIDLGTANTLIYVSGRGIVLQEPSVVALDLERG
FT                   TTMAVGDEAKLMLGRTPGNIRAVRPLRDGVIADFDAAEQMLKTFITKGNEGRGIMAPRL
FT                   VVGIPSGVTGVERRAVREAGMAGAREVHLIDEPVAAAIGAGLPVTEPVGTMIVDIGGGT
FT                   TEVAVLSLGGTVLSESVRVAGDEISDSIGVYLKKVHNMVVGERTAEEIKIRIGSAFPDD
FT                   EFDQQSMDVRGLHLLSGLPRTINLKAGDLREAIAEPLNVIVEAVKRTLERTPPELAADI
FT                   VDRGIMLAGGGALVRGISDLISHETGIFVHIAEDPLLCVVNGCGQVLEDWKRLQRVVDT
FT                   PEFVRSAAGA"
FT   gene            104871..105617
FT                   /locus_tag="Syncc9605_0106"
FT   CDS_pept        104871..105617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0106"
FT                   /product="putative rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33882"
FT                   /db_xref="GOA:Q3ANF0"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33882.1"
FT                   /translation="MAPTLRPGKSRWRGLGQLTPWLLLVVGLLLVRLSKGAGFSDAYAL
FT                   LSRPFWPGPAQREWVTAAADLEERSRLQLLEDDNRRLRGLLELQQQGAADGEVSAAVIS
FT                   RSSRGWWQQLQLGKGSLQGIGQGDAVLGPGGLVGRIASVTPATARVKLLTAPGHEIGVW
FT                   LPRSRRHGLLVGRGSSRLSLRFIDKDPDVRPGDLVATSPASTLLPPNVPVGVVQSVDEQ
FT                   TVPAPTAVVQLIAAPEAIDWVQVQTR"
FT   gene            105619..106143
FT                   /locus_tag="Syncc9605_0107"
FT   CDS_pept        105619..106143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33883"
FT                   /db_xref="GOA:Q3ANE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33883.1"
FT                   /translation="MRTTDMPRLHRQPICVASALVVPLLALASPRWLAIDGVGPAWAVL
FT                   WLLPWALVDGPVSGALAGLALGLVLDGLNLAGLSQVPALLLLGWWWGRLGRRAAPIQRS
FT                   LNLGLLAWLGSLGLGLSLILQLWWRQGGALDPLTQSWGLQTLWCQALITGLLAPLLVSL
FT                   QLLLWRRRVPS"
FT   sig_peptide     105619..105705
FT                   /locus_tag="Syncc9605_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.966 at
FT                   residue 29"
FT   gene            106140..107447
FT                   /locus_tag="Syncc9605_0108"
FT   CDS_pept        106140..107447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0108"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33884"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33884.1"
FT                   /translation="MRLNRRDLLLGAAAFGLAACAPRNQKSRAIELWTLQLAPKFNPYF
FT                   ADVLGAWSRFHPGAPVRWTDLPWGSVERKLLAAVFARTAPDVVNLNPPFAANLASKGGL
FT                   ADLTPLLPAEAAGRYLPSVWQACHDPDAGQIAVPWYLTVRLSLVNRALLDQAGIAAPPS
FT                   HWDQVPAFARRIRERTGRYGLFLTTVPDDSAELLETLVQMGVTLLDSRRRAAFDSPAGL
FT                   RAFRFWSDLYREGLLPREVVSQGQRRAIELFQSGDLALAATGAEFLRSIQTNAPGVAAV
FT                   TEPHPPLIGADGTANVALMTLAVPRQSQRVQEAVDLALFLTNAYQQARFAAEARVLPSS
FT                   IEALVRVRRELEQQVPATDAERQIRQARLLSASTLDRARVLVPAMPGIKRLQKILYTQM
FT                   QRAMLAQVSPEQALAAAASEWNRYARSRWPEVAGNS"
FT   sig_peptide     106140..106217
FT                   /locus_tag="Syncc9605_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.635 at
FT                   residue 26"
FT   gene            107540..108301
FT                   /locus_tag="Syncc9605_0109"
FT   CDS_pept        107540..108301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0109"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33885"
FT                   /db_xref="GOA:Q3ANE7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33885.1"
FT                   /translation="MTGDLPSQPKATILVVDDEAAVRRVLVMRLQLSGYRVICAEDGEE
FT                   ALEMYHNESPDLVVLDVMLPKLDGFAVCRRLRAESCVPIIFLSAVEAISERVAGLDLGA
FT                   DDYLPKPFSPKELEARISTILRRVGRGNAVIESRELPTGQGVLRLGDLVVDTNRRQVTR
FT                   GSERINLTYTEFSLLELLFRDPGHVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGK
FT                   LEPDPRNPELILTVRGIGYASQRMGEAFAAG"
FT   gene            108346..109854
FT                   /locus_tag="Syncc9605_0110"
FT   CDS_pept        108346..109854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0110"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33886"
FT                   /db_xref="GOA:Q3ANE6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33886.1"
FT                   /translation="MSELRDTRLEKARTLEELGQGPYALTFSPSHRMAELQVTHADLPK
FT                   GEERDVSVSVAGRVMTRRVMGKLAFFTLADETGSIQLFLEKAGLEAQQEGWFKQITSLV
FT                   DSGDWLGVSGTLRRTDRGELSVKVSDWRMLTKALQPLPDKWHGLADVEKRYRQRYLDLV
FT                   VSPDSRETFRRRARLVSGIRRWLDQRDFLEIETPVLQSEPGGADARPFETHHNALDLPL
FT                   TLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAYSDYVGMMEL
FT                   TEQMVSAVCEEVCGTTTITYQGTEIDLAPPWRRATMHELVQDATGLDFNGFSSREEAAA
FT                   AMTAKGLHAPELADSVGRLLNEAFEQAVETTLIQPTFVTDYPVEISPLARPHRSKPGLV
FT                   ERFELFIVGREHANAFSELTDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVMALEVGMP
FT                   PTGGLGIGIDRLVMLLTDCPSIRDVIAFPLLRPESRKGEPPSVE"
FT   gene            109882..110145
FT                   /locus_tag="Syncc9605_0111"
FT   CDS_pept        109882..110145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33887"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33887.1"
FT                   /translation="MSGERVGFRFKHADAVVKRNPQGRSRRGWVMEPVEQTTSRGTKMP
FT                   AYRIRWRDSERPEIVLQHMLIADPDPTPPPEGVSLEPPAPKA"
FT   gene            complement(110147..110626)
FT                   /locus_tag="Syncc9605_0112"
FT   CDS_pept        complement(110147..110626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33888"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33888.1"
FT                   /translation="MSSWLEQLERELDARLSAFLRNNPVQDQLFSEQHLKDRAGALQRQ
FT                   RQQLQGEAKQQRQQLLRLAEDVRAWRSRVDRAKAAGAADLAGRAEQHLTSLMNQGRSLW
FT                   VDLEDLGRRFNEVERQLKELQQQQEKPSTSTLEKDWALFEAEQELEQLRRDSGLG"
FT   gene            complement(110623..110856)
FT                   /locus_tag="Syncc9605_0113"
FT   CDS_pept        complement(110623..110856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33889"
FT                   /db_xref="InterPro:IPR030810"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33889.1"
FT                   /translation="MKSDERRQAIKQQREQLIQDLEAVYMAAFDRLGELEGEVGEVKAA
FT                   QLTQMILNSKTAAIEPLEKEIEKPVITTPGEA"
FT   gene            complement(110890..111843)
FT                   /locus_tag="Syncc9605_0114"
FT   CDS_pept        complement(110890..111843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33890"
FT                   /db_xref="GOA:Q3ANE2"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33890.1"
FT                   /translation="MSISLINLHPSPADLQQLVQDGLKRSPRQLPAWLLYDAEGSRLFA
FT                   EICKQPEYTLTNREIALLELHADAIAAATGPGMVVEFGIGNARKVDPLLTALGSSVFAA
FT                   LDISLSALKEALSGLAARHPNTAMVGICCDHTRLEQLPQHPALNGQRRIGFFPGSSLGN
FT                   FTPEEAVDFLRNARQLLAGGPLLLGLDQPREQSLMEAAYDDAAGFSAAFALNLLQRLNR
FT                   ELQGDADPAQFRYRARWQEQQQRIEMALVSTQDQTVHLAGETWVFKKDDAWITEHSVKY
FT                   SSGTAADLANQAGWRIESSWEDPHQQMALHLLLPAD"
FT   gene            complement(111840..113000)
FT                   /locus_tag="Syncc9605_0115"
FT   CDS_pept        complement(111840..113000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33891"
FT                   /db_xref="GOA:Q3ANE1"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33891.1"
FT                   /translation="MVALVLLDTLLAVRRRSEALIAYLEPEDLMLQGMADASPPKWHLG
FT                   HTTWFFDTFVLQPHAAGHQACDPLWSYQFNSYYEAVGARHPRPQRGLLSRPAIADVLAW
FT                   RQRVDAGLETLLQDPPEGVKALVELGLQHEQQHQELLLMDLLDGFQRQPLEPVYGPEAE
FT                   LKLQVAPEQWLPCTGGLAEIGHQGDGFHFDNETPRHRVWLEPFELSSTLVSNAAYAAFI
FT                   ADGGYQRPELWMSEGWALVQQHQWQAPRYWREEHTEFSLAGRRRRDPQAPVRHLSWFEA
FT                   DAFARWSGGRLPTEAEWEHALGLHGSAMKHAHRVLWQWTASAYSPYPGFRPVEGAIGEY
FT                   NGKFMSSQMVLRGSSWLTPKKHERDSYRNFFPPASRWMASGIRLAR"
FT   gene            113069..114709
FT                   /locus_tag="Syncc9605_0116"
FT   CDS_pept        113069..114709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0116"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33892"
FT                   /db_xref="GOA:Q3ANE0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33892.1"
FT                   /translation="MSGPGTVLVERYRLEERLSGPDPLRGSLWRAVDVMAGDLPVAMRQ
FT                   LQLPAAKARFKEVWPQLQSLLHPQLPRCRELLEVDGDLWLLRDWQDGVSYDDLLRQKRF
FT                   GPAEVLTLLRQLLPVLELLHGGGLVHGDVNPGHLMSCRCDGLPVLLDGGRLQRQGAPEE
FT                   AEGWGDLHDLGHTALMLLSGSASHEEGWPEGLELDSGFRQVLERLLSDQPEHSFGQASE
FT                   VLQALESVVLPASEPVPDLTVAPRARRARDREQGAEGRLWPVVGVLALSALVGSAIGWF
FT                   LFPRSSTPATAPRTTPDRATQQPAVSFPQEELDQHQQLFSRLRALQVDRGWFLQLVDAS
FT                   QLSSESLENRSIRRVWAGMAEQWLPRIEQLAPTIRRRLGRLSDGDWQPPREALLKQGVH
FT                   PRVVEHLVSAGAQDLLLVTMRGRKPADPFLQLWIAAAIQSLDDVEIVRLKARPLEPTNT
FT                   SLPIPAGGARLVLVEAPAGDAVALGINGTTLMQMMVFGANGQVVKERGPLRVTRIAAEA
FT                   GSPLQVLVTNEGVSSSLFTLSCRADPLDQ"
FT   gene            complement(114703..115203)
FT                   /locus_tag="Syncc9605_0117"
FT   CDS_pept        complement(114703..115203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0117"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33893"
FT                   /db_xref="GOA:Q3AND9"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AND9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33893.1"
FT                   /translation="MAKGGAKKAAAAAARAAANRMLADNRQARHQYEILETLETGIELV
FT                   GTEVKSIRNGKANLRDGFCLIRNGELQLHNVHISPHTHAGNYFNHDPLRTRKLLAHRRE
FT                   IDKFRGLVDQKGLTLIPLSLQLKGSWIKLTIGLGKGRKLHDKRAAEKEKQSKKDVKAAM
FT                   ERY"
FT   gene            115254..116300
FT                   /locus_tag="Syncc9605_0118"
FT   CDS_pept        115254..116300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0118"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33894"
FT                   /db_xref="GOA:Q3AND8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AND8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33894.1"
FT                   /translation="MAIVSSSSGRKPPRRPEALMDPQQAPEEVVSRPEDKLRPQRLDDY
FT                   IGQSELKQVLGIAVQAALGRGDALDHVLLYGPPGLGKTTMAMVLAEEMGVHCKVTSAPA
FT                   LERPRDIVGLLVNLQPRDLLFIDEIHRLSRVAEELLYPAMEDRRLDLTVGKGSTARTRS
FT                   LDLPPFTLVGATTRAGSLSSPLRDRFGLIQRLEFYGQGDLEAIVERTAGLIGVTLTPQA
FT                   RSSIAASCRGTPRIANRLLRRVRDVASVRGGGGGAINQALVGEALSLHRVDHRGLDASD
FT                   RRLLQLLIDHHGGGPVGLETLAAALGDDPVTLETVVEPFLMQQGLLMRTPRGRMVTDAA
FT                   RSHLAEAA"
FT   gene            116297..117061
FT                   /locus_tag="Syncc9605_0119"
FT   CDS_pept        116297..117061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33895"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33895.1"
FT                   /translation="MNRFLVLLMSLVLALPVQALDLQGLYEQALTASRQGDFVEALPLW
FT                   DSYLEQVPEDAAALSNRGNVRLALGDLSGAIEDQSASIVLAPEESDPHLNRGTAEEALQ
FT                   DWSAAADDYLWILERDPQDASALYNLANVRGSQGDWPEARELYGQAALARPGFAMARSS
FT                   EALAAWQTGDLDWAEAELRKLIRRYPLFADARAALSGLLWRQGSSGEAESHWAAAAGLD
FT                   QRYRQADWLQQVRRWPPQPTEDLMAFLALEAS"
FT   sig_peptide     116297..116356
FT                   /locus_tag="Syncc9605_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            117063..118244
FT                   /locus_tag="Syncc9605_0120"
FT   CDS_pept        117063..118244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0120"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33896"
FT                   /db_xref="GOA:Q3AND6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33896.1"
FT                   /translation="MTQAASLSDRLSREMPELLELRRHLHAHPELSGEEHQTAALVAGE
FT                   LRQLGWRVREGVGRTGLVAELGPGHGPTVGLRVDMDALPVEERTGLSYASTRQGLMHAC
FT                   GHDLHTCTGLGVARLLAQEPHLGARVRLLFQPAEELAQGAVWMRDAGAVEGLDALYGVH
FT                   VVPNLPVGTVGIRRGCLTAAAGELEILVQGEGGHGARPHQSVDAVWLAARVITELQQTI
FT                   ARRLDALQPVVISFGKVEGGRAFNVIADQVRLLGTVRCLDLQQHAQLPAWIDETVQGIC
FT                   ASGGGTALVNYRCIAPPVHNDPQLTTLLERCAVECLGRDKVLPVEQPSLGAEDFAELLR
FT                   DVPGMMVRLGVAGPEGCAPLHNGAFALEEDALGVGIAVLTATVLAWITENTSA"
FT   gene            118241..118468
FT                   /locus_tag="Syncc9605_0121"
FT   CDS_pept        118241..118468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33897"
FT                   /db_xref="GOA:Q3AND5"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33897.1"
FT                   /translation="MNQRRAVIWVSLGAPLLILLALLATNQRQGKDRVQVLPAILVGSG
FT                   LIISSALGRQRRRARLLADLQRARTPGSNP"
FT   sig_peptide     118241..118333
FT                   /locus_tag="Syncc9605_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.353 at
FT                   residue 31"
FT   gene            118465..119079
FT                   /locus_tag="Syncc9605_0122"
FT   CDS_pept        118465..119079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33898"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33898.1"
FT                   /translation="MSENDPHRPDLEAVRQAIASGDPVKAMPAITQLRHCSDAEAVPLL
FT                   VLGTEQKPFLVRSLSCSGLGYKRTEQGWTVLSALITADEDPNVRAEAANALASYGVDRA
FT                   WPLLRSAFEADAAWLVRCSILSALAEQPGIDLGWLLELATMAIADADAIVRVSGAEILS
FT                   RIVREGGADPSAVQARGLLQSLQQDSDHRVVAAVLNGLQAS"
FT   gene            119212..120666
FT                   /locus_tag="Syncc9605_0123"
FT   CDS_pept        119212..120666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0123"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33899"
FT                   /db_xref="GOA:Q3AND3"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AND3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33899.1"
FT                   /translation="MIHGQTSTPGLSVAPQIMRASWVESRKGQANVSQMHYARQGVVTE
FT                   EMAHVAKRENLPESLVMEEVARGRMIIPANINHTNLEPMAIGIASKCKVNANIGASPNA
FT                   SDAAEEVKKLKLAVKYGADTVMDLSTGGVNLDEVRTAIIGASPVPIGTVPVYQALESVH
FT                   GSIEKLDEDDFLHIIEKHCQQGVDYQTIHAGLLIEHLPKVKGRITGIVSRGGGILAQWM
FT                   LYHHRQNPLYTRFDDICEIFKRYDCTFSLGDSLRPGCQHDASDAAQLAELHTLGELTRR
FT                   AWKHDVQVMVEGPGHVPLDQIEFNVKKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIG
FT                   AAMAGWHGTAMLCYVTPKEHLGLPNADDVREGLIAYKIAAHAADIARHRPGARDRDDEL
FT                   SRARYNFDWNKQFELSLDPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDED
FT                   LEGLEKVLEANTGAAELTPVKLDKAD"
FT   gene            complement(120807..122816)
FT                   /locus_tag="Syncc9605_0124"
FT   CDS_pept        complement(120807..122816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0124"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33900"
FT                   /db_xref="GOA:Q3AND2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33900.1"
FT                   /translation="MVAAPASLDTLCINSIRMLAVDAINKSNSGHPGLPMGCAPMGYAL
FT                   WDKFLNHNPKNPKWFNRDRFVLSAGHGCMLLYALLHLTGYDSVSIEDIKQFRQWGSKTP
FT                   GHPETFETPGVEVTTGPLGAGISNAVGLAIAESHLAAKFNKADATVVDHYTYVIMGDGC
FT                   NQEGVSSEAASLAGHLKLGKLIALYDDNSITIDGRTDVSFTEDVLKRYEAYGWHVQHVA
FT                   EGNTDVDAIANAIEAAKAVTDKPSIIKVTTTIGYGSPNKADTAGVHGAALGEEEAALTR
FT                   QQLGWDYAPFEIPQDAYDQFRQAIDRGASLEAEWNQTLATYRTKYPTEAAEFERMLRGE
FT                   LPEGWDKELPTYTPEDGGLATRKHSQICLGALGPNLPELIGGSADLTHSNYTDIKGETG
FT                   SYQASSPEKRYLHFGVREHAMAAILNGIAYHNSGLIPYGGTFLVFADYMRGSMRLSALS
FT                   ELGVIYVLTHDSIGVGEDGPTHQPIETIPSLRAMPNMLVFRPGDGNETSGAYKVAIQNR
FT                   KRPSSLCLSRQGMANQANSSIDKVALGGYVLEDCAGTPDLILIGTGTELDLCVQAAKQL
FT                   TAEGKKVRVVSMPCVELFDEQTDAYKEEVLPNAARKRMVVEAAESFGWHRFIGLDGDSV
FT                   TMNRFGASAPGGTCLKEFGFTVENVVAKAKALLG"
FT   gene            complement(122871..124118)
FT                   /locus_tag="Syncc9605_0125"
FT   CDS_pept        complement(122871..124118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0125"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33901"
FT                   /db_xref="GOA:Q3AND1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33901.1"
FT                   /translation="MVDGLHRVVITGLGAVTPIGNTVQDYWNGLTSGSNGVDAITLFDA
FT                   SAHACRFAAEVKDFDPSGFIEPKEAKRWDRFCKFGVVAAKQAVAHAGLEINEANADRIG
FT                   TIIGSGVGGLLTMETQAHVLEGKGPGRVSPFTVPMMIPNMATGLAAIALGTKGPSSAVA
FT                   TACAAGSNAVGDAFRLLQLGKADAMVCGGAESAITPLGVAGFASAKALSFRNDDPATAS
FT                   RPFDKERDGFVIGEGAGVLVLEKLEHAQARGATILGEVVGYGMTCDAHHITSPTPGGVG
FT                   GAEAMRLALADGGIDPYEIDYVNAHGTSTPANDKNETSAIKAALGERALQIPVSSTKSM
FT                   TGHLLGGSGGIEAVACVLALQHGVVPPTINHTTPDPDCDLDVVPNEARDQTLGTVLSNS
FT                   FGFGGHNVCLAFKRAS"
FT   gene            complement(124127..124393)
FT                   /locus_tag="Syncc9605_0126"
FT   CDS_pept        complement(124127..124393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0126"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33902"
FT                   /db_xref="GOA:Q3AND0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AND0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33902.1"
FT                   /translation="MQRPVATAMSQEAILEKVRSIVAEQLSVDSGEVKPESNFQNDLGA
FT                   DSLDTVELVMALEEAFDIEIPDEAAEGITTVGDAVKYIEDKQA"
FT   gene            124486..124761
FT                   /locus_tag="Syncc9605_0127"
FT   CDS_pept        124486..124761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0127"
FT                   /product="photosystem I iron-sulfur center subunit VII
FT                   (PsaC)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33903"
FT                   /db_xref="GOA:Q3ANC9"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33903.1"
FT                   /translation="MPQAFVCIGHMSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCK
FT                   AGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGDETTRSMGLAY"
FT   gene            124816..126705
FT                   /locus_tag="Syncc9605_0128"
FT   CDS_pept        124816..126705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0128"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33904"
FT                   /db_xref="GOA:Q3ANC8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33904.1"
FT                   /translation="MCGIVALVGSREAAPQLLEGLRQLEYRGYDSAGIATVAAQGQLTC
FT                   LRAKGKLLNLTACFEAEGAPGQCGIGHTRWATHGKPEERNAHPHRSSDGAVAVVQNGII
FT                   ENHRALREQLEASGVVFQSETDTEVIPHLLAAELQQLQAAGGTPGGGLLLQALQQVLPK
FT                   LQGAYALAVIWDQAPGALVVARKAAPLLIGLGEGEFLCASDTPALAGFTRTILPMEDGE
FT                   VASLSPLGVELYDAAGARQQRMPTQLSGVDHVADKREFRHFMLKEIHEQPETAALWVAR
FT                   HLPQGLPPEQPVALPMDDAFYAGIERIQILACGTSRHAAMVGAYLLEQFAGLPASVHYA
FT                   SEFRYAPPPLAPHTLTIGVTQSGETADTLAALAMEAARRRAHGDPAFAPRQLGVTNRPE
FT                   SSLSRQVPHILDIGAGIEVGVAATKTFLGQLLAFYGLAMAFAARRGSRPTAEINALAEE
FT                   LRGLPQQLRQLVDMHDQSSEALAHRFADTQDVIFLGRGINYPIALEGALKLKEISYIHA
FT                   EGYPAGEMKHGPIALLDSRVPVVSIAVPGVVFEKVISNAQEAKARDAQLIGVAPQGPDT
FT                   DLFDELLPVPSVSEWISPLLTVVPMQLLSYHIAAHRGLDVDQPRNLAKSVTVE"
FT   gene            complement(126709..128169)
FT                   /locus_tag="Syncc9605_0129"
FT   CDS_pept        complement(126709..128169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0129"
FT                   /product="Mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33905"
FT                   /db_xref="GOA:Q3ANC7"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33905.1"
FT                   /translation="MAATPLIPVILCGGTGTRLWPLSRASYPKQYWPLSGDGEATLLQQ
FT                   TQQRLTGLEALAAPLLICNEDHRFIVAEQMRQIGVEPNAILLEPMGRNTAPAVTVAALQ
FT                   ATANGEDPLLLVLAADHLIRDGAQFRQAINAGRKPAEVGRLVTFGIVPTAPETGYGYIE
FT                   ASEPFSLGEPAHVPIKRFVEKPDQATAEQFLATGRFTWNSGMFLFRASAMLAELERLAP
FT                   EVVSCCRAALEQDTADLEFHRLEREAFAKCPNVAIDVAVMEKTELGSVLPLDAGWSDVG
FT                   SWSALWDTSEQKDSQGNVLQGHVIAEDSHDCYLRSEHRLVVGLGVENLVVVETDDAVLI
FT                   ADRSKAQEIKTVVKQLEAEGSPEGKAHRKIYRPWGHYTGVVEDSRWQVKRISVKPGASL
FT                   SLQMHHHRAEHWVVVKGTALVERDGEEQLVGENQSTYIPMGCKHRLSNPGRIPVELIEI
FT                   QSGTYLGEDDIVRFQDRYGRSDMSISAS"
FT   gene            complement(128246..128779)
FT                   /locus_tag="Syncc9605_0130"
FT   CDS_pept        complement(128246..128779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0130"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33906"
FT                   /db_xref="GOA:Q3ANC6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ANC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33906.1"
FT                   /translation="MAESNDWLSVGKIVAVQGLLGELRVNPASDFPERFTVPGPRWLRS
FT                   RQGGEPSEIQLKKGRQLPGKSLFVVRFEGVDNRSAAETLVGMELLVPADDRPELAEGEF
FT                   HLLDLVGLKARLTADGPAIGTVSDLISGGNDLLEITTSDGRKLLIPFVEAIVPEVKLKA
FT                   GWLLLTPPPGLLEL"
FT   gene            128880..129020
FT                   /locus_tag="Syncc9605_0131"
FT   CDS_pept        128880..129020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33907"
FT                   /db_xref="GOA:Q3ANC5"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33907.1"
FT                   /translation="MADVTSIYNGYTGFVQRISGDRAAVLFEGGNWDKLVTLRLKDLQP
FT                   A"
FT   gene            129025..129852
FT                   /locus_tag="Syncc9605_0132"
FT   CDS_pept        129025..129852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0132"
FT                   /product="possible potassium channel, VIC family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33908"
FT                   /db_xref="GOA:Q3ANC4"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33908.1"
FT                   /translation="MGAERSLRQRLRATVLEANTPAGKTYNAVIFGAILLSVLALLLEP
FT                   DPLSNSALRQTDVLWIDLVQNVCLGVFAADFVLHLALVEKPGRYLFSFTGLIDASAVLF
FT                   FFVPQVRSELLLWMFKFGRILRVFKLLKFIDEARVLGQALRGSARTIGVFLFFVVLLQV
FT                   VLGYSIFVIESARPDSQFQTVASGVYWAIVTMTTVGYGDVVPQTELGRLLASVVMLLGF
FT                   GIIAIPTGILTVSGVRHHQQRSSELVCSSCGRQGHRRDALHCDFCGASLPSRV"
FT   gene            complement(129900..130004)
FT                   /locus_tag="Syncc9605_0133"
FT   CDS_pept        complement(129900..130004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33909.1"
FT                   /translation="MDQGYATEECSRQHGDPKRFRCQVSIQGRDLAEA"
FT   gene            130260..131585
FT                   /locus_tag="Syncc9605_0134"
FT   CDS_pept        130260..131585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33910"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33910.1"
FT                   /translation="MVQFKELSKQLIELAEAAGESLPEFEGREFSALAEFEQPLVEASI
FT                   RLRSVGSNELSLQLLDAAVVFGVRSGLVDDNRAWALAGLGRRTEAMGLWNELLDHPDEG
FT                   RRTQAQANLRLLAGELSKQLIELAEAAGESLPEFEGREFSALAEFEQPLVEASIRLRSV
FT                   GSNELSLQLLDAAVVFGVRSGLVDDNRAWALAGLGRRTEAMGLWNELLDHPDEGRRTQA
FT                   QANLRLLAGELSKQLIELAEAAGESLPEFEGREFSALAEFEQPLVEASIRLRSVGSNEL
FT                   SLQLLDAAVVFGVRSGLVDDNRAWALAGLGRLPEAVGLWRELQASPEQDCAAMARERLQ
FT                   SYASEADRIVVTNNAQVLVDEGHIDQAKTVLLQAMMDAPEWDASWTTMLIHILKTHYGY
FT                   KDNADLLERELKENHLSLEVFDLYLDLVEQRLKDVVVASSSS"
FT   gene            complement(132091..132972)
FT                   /locus_tag="Syncc9605_0135"
FT   CDS_pept        complement(132091..132972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33911"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33911.1"
FT                   /translation="MEFDVEAALKDGLKALEDEIATVKHEQSLLAKEKSQLQQMVEDLT
FT                   QQVSAKATELESEKNERAAEAERLKVLEEKYGERAKENEEAQQMVEDLRQQVSAKATEL
FT                   ESEKNERAAEAERLKVLEEKYGERAKENEEAQQMVEDLRQQVSAKATELESEKNERAAE
FT                   AERLKVLEEKYGERAKEKEEAQQVVEDLRQQVLAKAAELESEKKQRAAEAERLKVLEGK
FT                   YDAQTKEKEEEQQMVEDLTQQNELSLLQLHEVQEELERNFYQLRGKDELLQRHQAQQLR
FT                   AKQLISKLLNQS"
FT   gene            133070..134215
FT                   /locus_tag="Syncc9605_0136"
FT   CDS_pept        133070..134215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33912"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33912.1"
FT                   /translation="MNFSQVNPEAINEVFRSIVIKRKTNNYVRTYRSIARWTSSVIKKS
FT                   SASGKKSVGSGLDNQDVDNTYAKAFAIIKELIQLRYENLELLERHLIETAHEINASLKD
FT                   SNVDFLILCAVILGAKEHIRILPTLTEIACSGEDEKSFHKEIQLLIAIAIEVEKWNNKA
FT                   KVNNNQEAKEKTNDSTNDIQLYFKAKQIDPLYPRLVADQRYLRDQLRVLINQRLFQTGL
FT                   CPALESEMSTTNIHLPGSNNLFTDYKYNNRQTVNQSLILWNSYIKEMDIRRIFISYPKS
FT                   GRTWLRMILSEIVETNKLVATKTNELKFTHLLANPWFSTTNPDKFVLPSYKKDLSVFLH
FT                   RDPRDVVVSQYHQTHKRDIPHKESLSDHNPKNLLSAILLEL"
FT   gene            134341..134712
FT                   /locus_tag="Syncc9605_0137"
FT   CDS_pept        134341..134712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33913"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33913.1"
FT                   /translation="MSLYPKTTMSDLCNFLVLGATKSIIYESIDNNKFSDLLKAELAPD
FT                   AKKGRASGKLYENHNLSDINARKFRKGKVGGWAEEVDPRDHEKLTNMTKKYYLNLLEIC
FT                   PNSMRKQLFLPEDISKIIG"
FT   gene            complement(135126..135437)
FT                   /locus_tag="Syncc9605_0138"
FT   CDS_pept        complement(135126..135437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33914.1"
FT                   /translation="MPMPFRVSPHITSGKGMSCCGGCSWLAGTIGSDGYKGELFAKGFG
FT                   EVIQVKSAGEMPLHSIQTAAKAPPMAMATAVLTLQGRFRVAAASKEGISPTNEGNSPH"
FT   gene            complement(135673..136521)
FT                   /locus_tag="Syncc9605_0139"
FT   CDS_pept        complement(135673..136521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0139"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33915"
FT                   /db_xref="GOA:Q3ANB7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33915.1"
FT                   /translation="MAHQIQLGDITFANDRPFALLGGVNVLEDLDFALRCAGHYKNVCG
FT                   RLNIPLVFKASYDKANRSSIHSFRGPGLNEGLQILQAVKDTHGIPVITDVHSPEEAAAA
FT                   AKVADIIQLPAFLARQTDLVRAMAETGAMINVKKPQFLSPEQMRNIVDKFRECGNENLL
FT                   LCERGTNFGYDNLVVDMLGFGVMKRTCDDLPLIFDVTHALQCRDPGGAASGGRRSQVVD
FT                   LARSGMAVGLAGLFLEAHPDPARARCDGPSALPLDQLEPFLTQVKAIDDLVKAMPDLQI
FT                   N"
FT   gene            136719..137429
FT                   /locus_tag="Syncc9605_0140"
FT   CDS_pept        136719..137429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33916"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33916.1"
FT                   /translation="MSSISQPIPIFIGYDPRERAATNVLIDSLYQNSSVPLAITPLVTP
FT                   QLEAQGLFRRERDPKQSTAFSFTRFLVPYLMGYEGWALFMDCDMLCRADIKALWDQRDD
FT                   AYGAMCVQHEHVPGETVKFLGEVQSPYPKKNWSSLMLLNCSRCTKLTPDYVNTATGLEL
FT                   HRFHWLEGDHEIGAIQGGWNHLVDVQAPPESEQAAPMLHWTLGGPWFREQRTMGGPLAA
FT                   EWFSARDDAMKLWD"
FT   gene            137429..138148
FT                   /locus_tag="Syncc9605_0141"
FT   CDS_pept        137429..138148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0141"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33917"
FT                   /db_xref="GOA:Q3ANB5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33917.1"
FT                   /translation="MAIRKCVVAVPARLQSSRLPNKVLADIGGKPMIQRVLERCSEAQG
FT                   VEAVVLCTDSTELQTLAEGWGFPVLMTSESCNSGSERIASVAHPLMALGWGDADPVAEE
FT                   TAVINVQGDQPFIEPAVIDAMAEEFRSQDPVPAVVTPVYGLKPESVHNPNVVKTLLAHD
FT                   GRALYFSRSAIPHVRDIAEADWHQHTTYWGHVGMYGFRGDVLAAWDQLPASPLPPSGSR
FT                   APRCRWTPPNSWSRPGR"
FT   gene            complement(138531..140147)
FT                   /locus_tag="Syncc9605_0142"
FT   CDS_pept        complement(138531..140147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33918"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33918.1"
FT                   /translation="MNSKNTLNLISTKKAIFKKEYLESQMRLVSAIMTSEQQKIINKLI
FT                   STFLIDLIYKSVFKRTGEINILALTTHDPFLKIICDILEQHYSGCALRVRSYEHSHKKS
FT                   DNDLKYKINQLQIDEGISCDLCSSYVALSEDFVHSFCQGFLYDLPTYKDGSGILHISIL
FT                   SLLLRISKRVDIDYIKISSACDKALKDIQTEVSHGNDNLTFVRFQAPGSIRFETLAISD
FT                   SNKLYLPSIVPPYMVRRSEQVAIVYKNKSNSNWSELPFNCKNVRYSVSEKDISSEMLYA
FT                   YLNRGGGGNMVMSAVISGAGCRHSYAEDYKGFTEGVPVCWGVLRNSKKIIDDAINRDQH
FT                   FVYIDHAYFNRGHGNSYRISINSFECNMLRLCPSSRSKQLNVSLDPWNTRGEKIIVCPP
FT                   TDYFSEAHSVHGWLDKTINEIKLYTDRKIVVRKKPKLDEKPIPLAEQLQEAHALVTHSS
FT                   NVAIEAVCLGTPVFVSKTSAAAPIGLTDLSMIENPIYPDRSLWINNLSYCQFTLSEIES
FT                   GNFLHIINEYYGYNLASDAIN"
FT   gene            complement(140144..142693)
FT                   /locus_tag="Syncc9605_0143"
FT   CDS_pept        complement(140144..142693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0143"
FT                   /product="Glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33919"
FT                   /db_xref="GOA:Q3ANB3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33919.1"
FT                   /translation="MMSYSAPRKIFWVVPSLNLNQASVRLRCLHIARGLEKNFGYENYF
FT                   LTDIKKAKNQIEPESFLFIIKMPGLNIIDLLVKGKALNCKVIIDITDTVCDIHYKNNDF
FT                   GINSWILNSLIDLTDAIFVPTAKMRDHLIKHAENSKLSIWRNKVYIIPDIAESMQDSLS
FT                   LCEYKSETLKDKTAISIAENIKSSLGHTEGKTQIKRVLWFGNAYSPTSNMGISSLIPHL
FT                   PAIKTLQNKQNFDLVICTNSNADLRTLKSFGIRYNLVEWTLPEIFKQLSLASMSLITTG
FT                   DDERCMGKSNNRVLFSLINNCPVAVIKHPNNSEFELSVDRSLKSAIQKYLFSKNSKKER
FT                   TKALNENKTILNRYTIIEITKVYNLVLQNIWLSSLASQEHYPTIPNEKDVVSIICDNLS
FT                   VGNIKIIISLLNSFIPSYRVNYIHFTPLTENHINHYSSNQIIPHLLKLDDIEKARNFLK
FT                   NNVSLVISDELNANISKKLFDWTNAINRFSSIATNSSTVSIIKQSSLKEFLIKYYTRSE
FT                   STKHNNLSRVPENIPGRYQPLDISSSNTDLLFVCGIEAKNWILDGIAKEIGSRSQNSWS
FT                   IFYCDKVPKHLPKAKNYFFMHQALLKKFVKLRLVDLSQGSNINCWYTHPRDEDKKSIDQ
FT                   FLDIFSKVNKIVFACSKNYDLWISRGLNPIRGCVVLGGFDSARFTAHDRKLSNTIGVCS
FT                   SFYERKNPELLFNLVSKMRDKKFILLGKNWESYARYEALVGLGNVQYVTAKYEDYPDYY
FT                   KKFKIFLSTSKLEGGPIPLMEAMACNCFPVVSETGFAKDIISHGSNGFLFETSSTANTV
FT                   SELIEKAYIMDDIDVSSTVSEYSWDNFSENIYRVVGI"
FT   gene            complement(142965..143828)
FT                   /locus_tag="Syncc9605_0144"
FT   CDS_pept        complement(142965..143828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0144"
FT                   /product="putative sugar nucleotide epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33920"
FT                   /db_xref="GOA:Q3ANB2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33920.1"
FT                   /translation="MIEIFQQHKFDIVYHLAAETGTGQSFDEPSRYVDVNVRGTTNLFE
FT                   ALRASGHTSGKIILSGSRAIYGEGLYINSLGEPKKAKSRSSECMKRGDFKVYGECGTLL
FT                   QAKATPENFFPKPDSVYASTKLMQELLLKNLCSNMDWNILRFQNVYGPGQSLNNPYTGV
FT                   LSIFCSQIKDGKTLEIYEDGEIFRDFIYIDDVVRSLVAAINASSGEIINIGSGISTSII
FT                   DIVNILCRLAEEKGFHPEYKITGKFRDGDIRFAQADITKAFQSLNSWEPKIPLEVGLRN
FT                   LVDWSL"
FT   gene            complement(144154..145191)
FT                   /locus_tag="Syncc9605_0145"
FT   CDS_pept        complement(144154..145191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33921.1"
FT                   /translation="MNISILCETVEATQVISFLFDQSSIKESEQIKFSLHQWSELKTLS
FT                   RIEAYAEIFNCNYLILSRWYDFNSFKGILDEAKRLNKNVFLHLDDYLYDVPKSIGKGKW
FT                   EHYHNKDRMKALHDVTKSVKGLIVSTSRLCSEIQKILPNISIYTCPFYKVFEAPQLNDN
FT                   DYIKSPYPTIGYMGTKSHIKDLDIIVPKIEKLMNNHRNLKFESFGLQPPKTLVKKFPDR
FT                   CTAITRVSNYQEFKTVLKSRGWWVGLAPLIENNFNYCKANTKLLEHIQAKIPIIASKFG
FT                   PYEDIPCLSPIHSNIKEESWMENISRVLYSRSLRSKLYQAQLDYCKQYSNPFHLVEFYK
FT                   KLNTV"
FT   gene            complement(145188..146327)
FT                   /locus_tag="Syncc9605_0146"
FT   CDS_pept        complement(145188..146327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33922.1"
FT                   /translation="MSGSYFAGYIVNLLQDVNILRSLIYIAADNLNLKPTILITQGFTK
FT                   RDSQAAWMKELHSMKSEINCILFNIESQYETWKLLNQFEGGFLISASESDLPAHEETHE
FT                   IFKLAPAKISTVTLQHGFECVGFLMNKNHQQKWGNSVGFAAEYLCGWVPARLQRNLRPL
FT                   HRSKYINLGPTAWIKKTNKRNLQPKITKNMSEPIGIVCENLHSIRYGKKHNVNQFMEQF
FT                   FGLAEYLKAKGKKVALRPHPGGQYTIKNKIKLPENVILENRPSYAIRWSDYSYGISAPS
FT                   SVLFDMLSNNVPALVWQDPCQSIDINQVSFLPIAQSTEEMIAFSNSPIYTAPSQFSQQL
FT                   KYILRDNDQIAEDYTSFLDYLIRFSPDTRDATKKYEVIE"
FT   gene            complement(146324..147859)
FT                   /locus_tag="Syncc9605_0147"
FT   CDS_pept        complement(146324..147859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33923.1"
FT                   /translation="MKALIIYPNKEWMNSGGARIRYKRLEPFIKAKNVELVYKPINKVS
FT                   VKLLKEVNIAIIVKVYGLDSLRIISFCKSCGIGVGIDLFDDYFSDETLNLLHDKYNWIK
FT                   IASIMCDFVICSTEKMKEIAAKFVPKKSIHLVKDTCESNILSEETEELISQKVNSWKAS
FT                   GHLNILWFGIGDNPYFEVGIKNLANYSNSLFQFRKSFGSITFTILTNERALTQENLSFI
FT                   SNLPIEANVELWSPQLEAKLLREAHVTIIPVSHQQFSIAKSSNRCITALSYGCQVLSNG
FT                   YNLYSDFTDLIYRSTGELIHHYKHDTLKLNNDSLPGFIDKCNANYNPEAQADNTVRFFK
FT                   KTLTVKHTVEQVQITAIHFNLDKQKLSADFPVDQFPIANAMRLSRSGFCNFGIEQYNNE
FT                   YYIQFTDNCHAHIQTKWKEHLEKVHLSNITVLQLNIKKIKNLAPNIAKDVDRILKYRYR
FT                   EERLVSPRNHIRQRILFLFISKSLSSLLQEAFNCKYTYLTDLMTRYQVSGGRP"
FT   gene            complement(147856..149841)
FT                   /locus_tag="Syncc9605_0148"
FT   CDS_pept        complement(147856..149841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33924"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33924.1"
FT                   /translation="MQFLKELHELERDKRYKEYCSLAEKILKEEKNNISPTNSLHIRKR
FT                   RDYYLAKLIQRENQNFEIKTILDSLSNENLEILKKCCPGFADEKDGKENKKQIEKLITR
FT                   NTLISTSITKNKNLKVKLEPAGKSLKTSGYYFYQALLTPDLKLKQLKSQSEGEFQGLET
FT                   VVVSLDNEFMPIFIIDANSDHNEINDLEIIYFPSLIPGGYHYSELVDAYNEFGIIESLN
FT                   KYTNKLRDTPNKCKIDYLLMKTGHQDIGIGYANEDFRKWIKEVHGIKILKEYDPNCQGT
FT                   TLAIPQKAYPTISTIVNGIVKVIDSDMDVDSVDILITNEYDSNPLYKLQASFPKRQTES
FT                   LKETNDSYPYLISKKASENPQYKDIEGPICICPGENKVPYSAHPVLPYDILKEEDINPA
FT                   NKALIILVNTDKPENITEEMILSIHHQSQVRTKKIVFKSNSNNINKLRKRMVKILKEWQ
FT                   IIIDFDIITDVKQLASIIDNKSHILFINENIVLQDSNVISILQSNLNKYNAFSSGCILS
FT                   YLSSSKKGELYENISCGMYPTFNSFSQSGRLALVAKNLTSFLYSSEINVLSNHYDFCLY
FT                   NSETILAEIRRNEVVSDLNQFLVQLSCKAVLAGKNNVCSTRLSVQYINYPTINSTITID
FT                   RSLTEDIISNFIRIEKQVTNIKELTP"
FT   gene            complement(151016..151741)
FT                   /locus_tag="Syncc9605_0149"
FT   CDS_pept        complement(151016..151741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0149"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33925"
FT                   /db_xref="GOA:Q3ANA7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33925.1"
FT                   /translation="MDPSRAAELTDLIQRLDAEIPIEPELLILVDQAMTHVSSGRDRNL
FT                   ERLEFLGDAVLRLAATEFIDRHHADLTVGACSNLRAQLVSDRWLADVGEALGIEEHLLL
FT                   GRHAQGDRSARSRLRADATEALIGALYTALGNLKAIHRWLTPHWSATTQAVLATPHQFG
FT                   GKTTLQEWSQGQGLGLPRYATEECSRQHGDPERFRCQVSIQGRNLAEAKGRSRKEAEQN
FT                   AATAALQALEGSDAPQKSQ"
FT   gene            complement(151785..152114)
FT                   /gene="rnpB"
FT                   /locus_tag="Syncc9605_R0003"
FT   misc_RNA        complement(151785..152114)
FT                   /gene="rnpB"
FT                   /locus_tag="Syncc9605_R0003"
FT                   /product="RNA component of RNaseP"
FT                   /note="prediction based on Data from Rfam and Infernal"
FT   gene            152198..152271
FT                   /gene="tRNA-Arg2"
FT                   /locus_tag="Syncc9605_R0004"
FT   tRNA            152198..152271
FT                   /gene="tRNA-Arg2"
FT                   /locus_tag="Syncc9605_R0004"
FT                   /product="tRNA-Arg"
FT   gene            152308..152691
FT                   /locus_tag="Syncc9605_0150"
FT   CDS_pept        152308..152691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33926.1"
FT                   /translation="MGWADRLPPLGLLQPGVGAMTQLHDLRLRLLVQQESERIAESQPT
FT                   DIDLSVVQARCLCWLALLAEAHEDQASDAERRGDTEQAMGWFADSMRLRDVIGVVTSIE
FT                   IPLPDTAAEGGSQPEEDRGPQAA"
FT   gene            152729..153193
FT                   /locus_tag="Syncc9605_0151"
FT   CDS_pept        152729..153193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33927.1"
FT                   /translation="MPEEPCQCPDCQRFYREHDRLIRESPTLRQQQELNWAALQSFRTL
FT                   SGRVLEDLQKQHGSRQIPDAAAAKPAAGAPVPEESGDALQQAIADLENINAHLFSIEAL
FT                   MERVFDVRVPEEIEQKFRELAGELAPDPLNVDRLRLNRLLHQTPDLPDRS"
FT   gene            complement(153255..155777)
FT                   /locus_tag="Syncc9605_0152"
FT   CDS_pept        complement(153255..155777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0152"
FT                   /product="Glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33928"
FT                   /db_xref="GOA:Q3ANA4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33928.1"
FT                   /translation="MTTSQPFDLRLPTPGCYNDPERAGLDAKSVFDGMTEHLFFTLGKL
FT                   APTASRHDLYMALSYAVRDRLMMRYLATTEAMRAHPQKSVAYLSAEFLIGPQLNSNLLN
FT                   LGIQKEAEEALKNFGIDSLQQILDVEEEPGLGNGGLGRLAACYMESLASLKIPATGYGI
FT                   RYEFGIFDQLIRDGWQVEITDKWLKGGWPWELPQPDEACFVGFGGRTESYIDDKGNYRS
FT                   RWIPAEHAIGIPHDVPVLGYRVNICDRLRLWRADATESFDFYAFNIGDYYGAVEEKVGS
FT                   ETLSKVLYPNDGTDEGRRLRLKQQHFFVSCSLQDMLRSLDNRGLAVEDFPNYWTVQLND
FT                   THPAIAVAELMRLLIDDRHLEWDRAWDITSRSVAYTNHTLLPEALEKWDLDLFGSLLPR
FT                   HLELIYEINRRFLQQVRLRYPGNDAIQRKLSIIDEEGSKAVRMAHLATIGAHHVNGVAA
FT                   LHSDLVKTDLLPEFAALWPEKFTNVTNGVTPRRWVALANPEMSALLDEHVGPDWISNME
FT                   SLRKLEERQNDQGFLELWGNTKLSVKRKLAAYIHRNTGVLVDPSSLFDVQVKRIHEYKR
FT                   QHLNALQVITQYLRIKNGQTDGMAPRTVIFGGKAAPGYYMAKLIIRFINGIADTINADP
FT                   DMDGLLRVVFLPDYNVKLGEQVYPASDLSEQISTAGKEASGTGNMKFAMNGALTIGTLD
FT                   GANVEIRELVGAQNFFLFGKTVEEITTLKQSGYRPSEVVAALPELQEALRLIEMGHFSN
FT                   GDGELFRPLLDNLTGNDPFYVMADYADYLRAQEAVSHAWSDRMHWNRMSLLNTARTGFF
FT                   SSDRSISEYCNNIWAVDPLNVEITCDVR"
FT   gene            155990..157366
FT                   /locus_tag="Syncc9605_0153"
FT   CDS_pept        155990..157366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0153"
FT                   /product="putative Na+/H+ antiporter, CPA2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33929"
FT                   /db_xref="GOA:Q3ANA3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33929.1"
FT                   /translation="MLLPTLLSEISSHDFEVAETLIGVLRFVLIFIAARTLAEILVRFE
FT                   LPTILGELLAGVIIGASGLHLLVPPETQVQLSGAFSNVLGGLAHVPPEEIGLIYNESFG
FT                   SLRSVSNLGLYSLLFLTGLESELDELMAVGAQAFSVAVVGVVLPFALGTFGLMALFHVD
FT                   PIQAIFAGASMTATSIGITASVFGELGYLRTREGQIVIGAAVLDDILGIVILAVVVSLA
FT                   AGGSLEIAPIVQLVVAAVLFVVVALVLSRKAAPAFDWMIDQLKAPGAKLVGSYLLLGAS
FT                   CFIATAIGLEAALGAFAAGLIASTSRHRHEIQAAVMPIVGLFATVFFVLVGAGMDLSVI
FT                   NPSDPEARSALVIAGFMFIVAIIGKVVAGWAVFGKQKTNHLVVGLGMLPRGEVGLIFLG
FT                   LGTAAKLLSPGLEAAILLMVIGTTFLAPVLLRLVLKGKPPEDGDQVPEELAADPLAGAS
FT                   "
FT   gene            complement(157369..157719)
FT                   /locus_tag="Syncc9605_0154"
FT   CDS_pept        complement(157369..157719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33930"
FT                   /db_xref="GOA:Q3ANA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33930.1"
FT                   /translation="MLSSTEAAWMLNYEVMGGPLADPSVWRGALLWAIALYVPLSAPLS
FT                   TLESSLEESGLPESVRQPALVISSLLLALATGVVTQLGFSWALGPGWASSLGVVAVGWS
FT                   VLLILANAGKTD"
FT   gene            157740..158660
FT                   /locus_tag="Syncc9605_0155"
FT   CDS_pept        157740..158660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33931"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33931.1"
FT                   /translation="MDRVTWSYLGHAVYTVQQHPEHESADRPALLLVHGFGASTDHWRH
FT                   NIPVLAETHAVHAIDLLGFGRSAKPAGLNYGGALWRDQLVAYVRERIGRPTVIAGNSLG
FT                   GFAALAAGAALGSDCAGVVLLNAAGPFSDEQKPPQGWGAIARQSIGTALLKSPVLQRLL
FT                   FENLRRPATIRRTLNQVYVDKTNVDDWLVESIRRPSLDPGAFGVFRTVFDIPRGQPLDE
FT                   LFAELTAPLLLLWGIRDPWINAPGRRSTFQRHAPEATTEVVLEAGHCPHDEVPDQVNAA
FT                   LLQWLEGLKSAAAPTNPDLLAKGVN"
FT   gene            158678..159532
FT                   /locus_tag="Syncc9605_0156"
FT   CDS_pept        158678..159532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33932"
FT                   /db_xref="GOA:Q3ANA0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ANA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33932.1"
FT                   /translation="MPMTLTQQSAPYAHWDFLHPSSGDRLRIIPERGGLVSGWVCGGRE
FT                   ILYFDKDRYADPSKSIRGGIPVLFPICGNLPGDVLSVDGVDYPLKQHGFARDLPWQLQL
FT                   LDDQSGVRLSLSSTDATLKAYPFPFRLEMELRPVASALEISTTVHNCGAAAMPFSFGLH
FT                   PYFNVSDLAQTRLMGLAERCLNHLEMAEAATADQLRRLPEGVDFLCRPAGPVTLIDDAT
FT                   GVKLELQHQSPLDLSVVWTEPPRPMVCLEPWTGPRQALVSGDRKLVLEPGAKQTLACRY
FT                   SVS"
FT   gene            complement(159517..160668)
FT                   /locus_tag="Syncc9605_0157"
FT   CDS_pept        complement(159517..160668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0157"
FT                   /product="putative glycolate oxidase subunit GlcE"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33933"
FT                   /db_xref="GOA:Q3AN99"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33933.1"
FT                   /translation="MSHSPASRSALIDLVHQWHQSGTPWSPSGLGTRLDWGPTLGPCHE
FT                   VLSCRQLNRVIDHAVDDLTITVEAGLPLQDLQDLLAQQGQWLPIDWPRAGAPGSIGGLV
FT                   ARGLAGGLRHRHLGVRDQIIGIGLLRADGTEAHAGGRVVKNVAGYDLMRLLCGSWGSLA
FT                   LITELTLRLQPLRPARSSLIVNGELAAQEAFRSELLRSSLTPERCDWINNGDGAWRLRL
FT                   VVSSVSEQAVEEQFNSLETLARNQQLNAERQPCADALTTPLDASPSAQLVRLVLPPAQM
FT                   QRLLRDEAMKALKTWYWELAAGAGCGDGWCAVATADHQLEALRRSVIRLGGEMTLLKRA
FT                   AGSTVPAWLDRPSRPLIEAVKRQFDPKLQLSRGRLPGVNQETL"
FT   gene            160683..162029
FT                   /locus_tag="Syncc9605_0158"
FT   CDS_pept        160683..162029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33934"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33934.1"
FT                   /translation="MKVVVIDDDPTGSQTVHSCPLLLRWDVDTLRQGLRHASPLLFLLA
FT                   DTRALTPMAAAERNRGIAAALDQALQREGLARDQVLLVSRGDSTLRGHGVLEPEVLQAA
FT                   FGPFDATFHVPAFLEGGRTTVNGVHLLHGEPVHTTPFAQDRLFGFNSSDLAHWLQEKSD
FT                   GAIAAASVQRISGRELDAGCGAGLPLLIDRLRSLQGNASVVVDAERQEQLTALAAAVRG
FT                   LQGQKHFLFRSAASMVKALADPGPPPLDPEGLAGLRLPAVDGTPLPGLVMVGSHVPLAD
FT                   QQLELLLAEPGCHGVELPVPRIARVLEGPTPDLLLADLERVWLQQLRALLDQGLTPVLF
FT                   TSRGELRCASENEGRRLSCALAELMGRLAAALAPDLGYLISKGGITTQTLLARGLALES
FT                   VQLEGQLLPGLSLVRPSAGSCSGLPILTFPGNLGGAGTLLDAWQRMQAG"
FT   gene            complement(161928..163304)
FT                   /locus_tag="Syncc9605_0159"
FT   CDS_pept        complement(161928..163304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0159"
FT                   /product="putative glycolate oxidase subunit (Fe-S)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33935"
FT                   /db_xref="GOA:Q3AN97"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33935.1"
FT                   /translation="MGIESGSSSPTQLPGLPAGAADPCVHCGFCLPTCASYRVLASEMD
FT                   SPRGRIHALRAIEAGELDFGATVASHFDTCLGCYACVSACPSGVRYDQLIEATRPKLNQ
FT                   ANQRSSWQTSFRKLLLQVLPYPKRMRALLQPLRAYAGTPLQQLARRSGLTRLFGPEIEA
FT                   MEQLLPPLVPESFTDQLPQINPASGDRRGRVALLLGCVQRCFDPSVSSATVKVLQANGF
FT                   EVVIPPDQGCCGAVSHHQGELELTRQLARDLVSSMNAIQGELDAVLVAASGCGHTMKAY
FT                   GELLNGEVAFRALVLDVQEFLADRGLLETFRAQLQPLPGGVAMHDACHMIHGQGIQAQP
FT                   RQLLRAIPGIQLREATEAGVCCGSAGIYNLVQPEEAAELGRIKADDLSGTGAEWVASAN
FT                   IGCTLQLRRHLGDRAQVQHPMELLAASAGLHPLPGVQQRAGTTEIAGEREDRQSAAGSR
FT                   "
FT   gene            complement(163572..164294)
FT                   /locus_tag="Syncc9605_0160"
FT   CDS_pept        complement(163572..164294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33936.1"
FT                   /translation="MIINHSKKFIFFANRKTASTSTAITLSSSCNKKDVITPLGRDERI
FT                   RRELGYQGPINFIPWWNIPKYLAIEAKSKAFKQSANRELKTIGLHTHIEAKTALERKYI
FT                   SASNFDSYFSFCFIRNPWDHAISKFFELKKSEHFQSLDLDTFIHGGRLENFATSCRSTH
FT                   SSQGKMLVKKLYKYEHLQETIQNLFKELDLTGNPQLPRAKSTLRTDKRHYRDMLSPGQA
FT                   KTIEDIFAQEIEWGQYQF"
FT   sig_peptide     complement(164196..164294)
FT                   /locus_tag="Syncc9605_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.896) with cleavage site probability 0.794 at
FT                   residue 33"
FT   gene            complement(164316..165740)
FT                   /locus_tag="Syncc9605_0161"
FT   CDS_pept        complement(164316..165740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0161"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33937"
FT                   /db_xref="GOA:Q3AN95"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33937.1"
FT                   /translation="MAQFEKLTAPSQGTPIRFENGQPVVADNPIIPFIRGDGTGVDIWP
FT                   ATQKVLDAAVAKAYGGSKSIEWFKVYAGDEACDLYGTYQYLPEDTLEAIRAYGVAIKGP
FT                   LTTPVGGGIRSLNVALRQIFDLYSCVRPCRYYEGTPSPHKRPQDLDVIVYRENTEDIYM
FT                   GVEWEADDAVGQALRKHLNEVVIPANGKLGKRQIPEGSGIGIKPVSKAGSQRHIRKAIQ
FT                   HALRLQGDKRHVTLVHKGNIMKFTEGAFRDWGYELATTEFRDVCITERESWILCNLEKD
FT                   PNLSVQANARMIEPGYDSLTPEKKAEIDAEVQAVIDAIGSSHGGGKWKEMVLVDDRIAD
FT                   SIFQQIQTRPQEYSILATLNLNGDYISDAAAAMVGGLGMAPGANIGENAAIFEATHGTA
FT                   PKHAGLDRINPGSVILSGVMMLEFLGWQEAADLVTTGLSAAIADKQVTYDLARLMEPQV
FT                   DPVSCSGFAEAVIARF"
FT   gene            165823..166773
FT                   /locus_tag="Syncc9605_0162"
FT   CDS_pept        165823..166773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0162"
FT                   /product="putative glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33938"
FT                   /db_xref="GOA:Q3AN94"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33938.1"
FT                   /translation="MASEQVWVVAACFNEAEVISAFIERVLALPEVDHLLLIDDGSSDA
FT                   TVAVIRAWQQSHANPAVTLLELTRNFGKEAAMLAGLDYANGRCAAAVLIDSDLQHPPER
FT                   IPAMVQAWRNGAEVVTAVRDDRDAEGLVKVATASWFYRVFNRLVDSIQLQEGAGDFRLL
FT                   SAPVVEAVTQLREATRFSKGLMPWTGYRSEEIAYSRVARVGGTTSWSSLKLWRYALDGI
FT                   FSFTVKPLKVWGVIGVLISFLSFVYAALIVLRTLVFGIDLPGYASLIVAVLFLGGIQLI
FT                   GIGVLGEYIGRIYIDVKQRPHYFVRAVHQGSKLLR"
FT   gene            complement(166756..167943)
FT                   /locus_tag="Syncc9605_0163"
FT   CDS_pept        complement(166756..167943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33939"
FT                   /db_xref="GOA:Q3AN93"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33939.1"
FT                   /translation="MLRYGLVGGTAAAVHIGVLLLLGQWMSLSLANPIAFLAASVAGYL
FT                   GHALLTFREETGGRQFARRWLLLQYVVNISVCALLPLLQAPTLVLVFTPTLLNALIWSR
FT                   AARFSAQARQHQQGHPPLLHADDLGLAEGVDAAILDLAQSRRLQGASLLVNGPSATAAM
FT                   QAWHDLADPPPLSLHVCLTEGYRLPNCPEIPTGFGTLLLASLLPWQRRRIAPQLHTVLL
FT                   QQISRYRQLTGLQHIRLDGHQHIHLVPLVLDAVLDLASDESITWVRTTREPLPEGLPLR
FT                   LWWRSLQSVGLLKWLVLQLLSGLAIPRLRRAGLQTNRRFAGVLFSGSMFGTAFRRCWET
FT                   AYSSITEERAAQPVVLIHPALPNAASGMDQAAFQQSVAFFSSTNRQKEWSSAQQL"
FT   gene            complement(167961..168716)
FT                   /locus_tag="Syncc9605_0164"
FT   CDS_pept        complement(167961..168716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0164"
FT                   /product="Methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33940"
FT                   /db_xref="GOA:Q3AN92"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33940.1"
FT                   /translation="MTQPLHLALLGAMPEEIGSDLSHLKDLSCSDHGDLRIHRGSWGDE
FT                   VRLSLAWSGWGKVSAARAATRLLASDPSIDLLLFTGVAGAADPALSQWDVVLADAVVQH
FT                   DMDARPLFPRFTLPALNQDRLQPQPPWFDWAKTALIEAHNEGDLKGFARPSSGLIATGD
FT                   RFIGDPAVLQALRDALPDLQAVEMEGAAVAQVAEQEGVPWLVLRVISDGADETAAQSFE
FT                   DFVKRYEQQAWRLIEALLQRCNDAPRRCA"
FT   gene            168821..169237
FT                   /locus_tag="Syncc9605_0165"
FT   CDS_pept        168821..169237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33941"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33941.1"
FT                   /translation="MARMRALASTITLVRLQFPAAQANLSPWRDDPQTRQWTETESLDL
FT                   SFHFPGWSPRLECRSLLMQLRISTDRGDDQLRLLGVLMRGMTYDGERWRLATVGEWLPE
FT                   GPHLPQQQQVKQLQQICRELFELFDRNASSEPAA"
FT   sig_peptide     168821..168892
FT                   /locus_tag="Syncc9605_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.919 at
FT                   residue 24"
FT   gene            169313..170026
FT                   /locus_tag="Syncc9605_0166"
FT   CDS_pept        169313..170026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0166"
FT                   /product="Heme oxygenase (decyclizing)"
FT                   /EC_number="1.14.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33942"
FT                   /db_xref="GOA:Q3AN90"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33942.1"
FT                   /translation="MSVALAAQLREGTKKSHTMAENTGFVSCFLKGVVDKASYRKLVAD
FT                   LYFVYSAMEDEISKLTDHPVVAPVAMAQLNRREALEQDLTYYFGDSWQDNIQPSPSAAA
FT                   YVERIHAVAKDSPELLVGHHYTRYLGDLSGGQILKNIAQKAMNMDGDDGLRFYVFDDIA
FT                   DEKAFKTTYRFAMDTLPIDQAMADRIVEEANHAFHLNMNMFKELEGNLVAAIGKVLFGF
FT                   LTRRQRAGSTEAVAA"
FT   gene            170043..171080
FT                   /locus_tag="Syncc9605_0167"
FT   CDS_pept        170043..171080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33943"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33943.1"
FT                   /translation="MAPALVRFLVPGTGSRFRCGGLSVEQQTARLVANLCPTELVTYRE
FT                   RSPDHPYLDDCLRNEPPDAQVLWVVSWGFDVPGLIRRLSGRRVVYHAHSSQYGFRLPPG
FT                   VPVLAVSRNTLGYWGHQAPRNPLFLVPNALDQVWLDRGDRLTGQRRPIDVLVQARKSSP
FT                   YVLHQLVPALRQAGLVVEVQTGWVDDLVDLFNRSTVYLYDSAEYWRGRGVTEGFGLPPL
FT                   EALACGCVVFSSLNHALADYGDPGHTLHQIGCGRLLFDVGRIQAAAASPQPWRPSRDRL
FT                   EALLRECSEAALLERWHDAFAQLDALKAVSGPPLSTPPTWQLRLQQLFARLQRVVNRLP
FT                   GWPCR"
FT   gene            171147..172985
FT                   /locus_tag="Syncc9605_0168"
FT   CDS_pept        171147..172985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0168"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33944"
FT                   /db_xref="GOA:Q3AN88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33944.1"
FT                   /translation="MSRQFPRFSLQSQTWKDISALLGKLPARRKRLVGFVLLASFFQGI
FT                   LDLLLIAFLARFVGLFSGAKLADRLPGIWVFGGGILDQTGWLLALLIASFWLTSFVRFS
FT                   VSLMQSLLSAEIWNDLVNQVYKNVLCQRYEFFIENRTANLSEKFNRILNSVSTKVVIPL
FT                   IAIAGNALSVTSLLIGVVFVLGYQALAIFALMLMAYAVASVVITPYMRLATKQRVRYGR
FT                   RINLLLMESLRSIRDVHLYSADKYFVTRFSSDGVIAKRYDRLTRLLPDVPRFVIEPAGI
FT                   SILFLIGLAPAVLSGDSSDVRNAIPDLFAIMFTLLKISGPLQNTFRSLNRLRGGLPEIK
FT                   DALDLLDLKPERLLLASPGVPTPEGLMPRRLIQLKDASFSYRRSDKLILDSINISIPIG
FT                   SRFALVGRTGSGKTTIAHLLLGLLQPSSGELMLDGIPVSPQDLPAWQANCALVPQDIRL
FT                   FDGSIRDNVAFGLDNDSIDDEDIWSALKTAQFDDVVAQMPYGLYTMIGENGVKLSGGQR
FT                   QRLALARAFYRGAKVLVLDEATSALDNRTEHDVLQALDLVGRRCTTIVIAHRLSTVKKC
FT                   DRIIEIENGRIHAQGDFFSLCEKSETFRDMYRIENT"
FT   gene            172985..175240
FT                   /locus_tag="Syncc9605_0169"
FT   CDS_pept        172985..175240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0169"
FT                   /product="Glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33945"
FT                   /db_xref="GOA:Q3AN87"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33945.1"
FT                   /translation="MPDIVLLSTADWDHPLWTNKQHTALSLYRAGHRVLYIESLGLRPP
FT                   RADRQDRQRIVKRLRRMFSPPRQVEPGLWIWSPMVIPGGTRGVLMRINRMLFSGALAWV
FT                   LRSLRFRSPLLWTYNPLTGRYLNLRRRATASTSSMFSAAVYHCVDRIHAQPGMPATLIA
FT                   DSERQLCRTVNVVFTTSPDLQASLMRLNACTFHYGNVADQAHFAAALDAPYAPEPLAGI
FT                   PKPRLMFVGAIDAYKLDLPMLTSLARRRSEWSFVLLGPVGEADPDTSITALEALPNVYV
FT                   MGLQPYADLPAWLAHADVALLPLQENTYTQHMFPMKFFEYLAAGTPVVATRIPALRPYA
FT                   AGALLCPPDAEAFDAAIATALAGDGPPIRQRLALAAEHTYESRTRKMLADLQREGLLEA
FT                   ASSGRSMLRAQARTWPLQRLLMPALFRSVRLRNRCGRSEAGRQLLGWIDGHHPIEPQVL
FT                   DAQIPRLIQKGLYAEALALMERSWLELGRTDHLHQLLFRRGARPKALEAQIALFETLGS
FT                   STRLPLSYRTYCRVVSAYRAAEAKDPQLMRASLAALDVVATGLENDPNTHLCRQGNRFN
FT                   RAKLLISCYATALRLQLTLADRPGAARLGRRALQFCARLDLTMIETDTSFRLTRNLMRV
FT                   LAINALEAWASADVALYWQARQALQAVHDHAHRQEHDDREVQEDHRAFAVQVMERVALM
FT                   DPALADVAARRRATEDLMLLLFRAKIVNEAWRTERLPGVLPCFEGFLEPHPATSSTP"
FT   gene            175237..176391
FT                   /locus_tag="Syncc9605_0170"
FT   CDS_pept        175237..176391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0170"
FT                   /product="putative glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33946"
FT                   /db_xref="GOA:Q3AN86"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33946.1"
FT                   /translation="MTRRVVLYIDSLKTGGAERVTLLLARWLVEAGWQATVLTRHGASR
FT                   DFYPLPAGVQRSVEPGDPIWLRRFGPFGFPLRMLRLRAWLQRHQPDLVVGMTTLPAIKL
FT                   LLAVRGMACPCIVSERNFPPLKRPSWPWRLLRRLTYPWAQLHLVQTEATGRWLAQHLKA
FT                   RPQLCLPNPVAWPLPRFAPDPDPIAWLVRRNVGADQQVLLAVGTKSHQKGFDRLVAMFG
FT                   LLAQRHPAAHLVILGLDQGPYHGVDQQAQLRRLLPQASHRLHFPGRVGNVQDWYERADM
FT                   FLLPSRYEGFPNVLLEAMASGCCCVSSDCPQGPAELIRDGVDGRLLANDATPETWADLV
FT                   SELLEDSDQRLRLGDAALAVRQRFSEERLRRCFMHGVLQLVGDD"
FT   gene            176384..177643
FT                   /locus_tag="Syncc9605_0171"
FT   CDS_pept        176384..177643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0171"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33947"
FT                   /db_xref="GOA:Q3AN85"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33947.1"
FT                   /translation="MTESVLAEGRDDLWLVLPHLGAGGAQKVALIAARHFAAQGLKVKL
FT                   VTLIPGHPVAHTLPDGIPWLELGAPTHRSWWARAGRFALAQLDKLIRLFFQLQLRWFEG
FT                   WFQTCIHPEGLGLAMRLFHVGTEATAGLRLRQLRREFRRQRPHRVLALLTRTNITCCCA
FT                   AWDLPIHLVVSERNDPSLQLLPEVWQRLRPLAYRRADVVTANTAGVLSALDSMGAWERL
FT                   ALLPNPLPGASKAAARVDQSRASGFISVARLVPQKGLDVLVAALPKLSGSAAAWPVNLV
FT                   GDGPEREALQQQAKDLGVSSRLRFLGFRSDPDQFLAEAAVFVLPSRFEGMPNALLEAMA
FT                   AGLAVIVTDASPGPLEVVEPGISGLVVPSDDPAALAEAMQALVSDPDRCRRMGAAAKAR
FT                   IVALDWPQLEPLWRSILALS"
FT   gene            177640..178764
FT                   /locus_tag="Syncc9605_0172"
FT   CDS_pept        177640..178764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0172"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33948"
FT                   /db_xref="GOA:Q3AN84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33948.1"
FT                   /translation="MTARVLVLAPTRRARTETFVRANLARLPFAVEACFGDEMPWREPL
FT                   KALYGLAVLTSKVCTRLGWLRLATLPTSIVAMLLVKRHRPDVVMVEFGFHAVRVMELAR
FT                   LGVPLAVHFRGADASAERYLKRLEPRYRRLFQLTSAVIVKNQTMRSRLISLGAQPAQLV
FT                   ISPSGADEQRFQGATPASMPPRFLAVGRFVAKKGPLDTLEAFALLQGLTDHADACSLVM
FT                   VGDGPLLSVVQDRAHQLGLEHLVQFPGVLSPDAVVQEMRRARVFVQHSRTAEDGDEEGC
FT                   PVSVMEAQLCGLPVVATRHGGIPDVVVDQQTGRLVEEGDRWGMAEAMALLADRPGLAAA
FT                   WGAAGQRRTQARFTVKHHVDQITMLLNDLVEHRA"
FT   gene            178761..179615
FT                   /locus_tag="Syncc9605_0173"
FT   CDS_pept        178761..179615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33949.1"
FT                   /translation="MSSKRLKLLLIRGLGHSGTTMLDLALGAHPQIIGLGEAARILATP
FT                   KPGDEHRGPSQLRGAHRFERRCTCGVVAAECPIWGPQLEWLRLHDQMPMQEKVLRLLKG
FT                   SPHDGGAVWHVDSYQDDLELTRLPEAMFDIRIIHLVRDVRSWVHSRARAGRKSDLRWPA
FT                   MRQLARWWRVNAKFERSFRQSPYPVFHLGYEEFALQPQRSLELLSTWLSIDFQEAMLAP
FT                   GQNSSSHILAGNRVRFDAERSRTIAYDGAWLGAPAPTAAHLGLLLPNVARMNRRLVYSN
FT                   GLL"
FT   gene            complement(179640..180470)
FT                   /locus_tag="Syncc9605_0174"
FT   CDS_pept        complement(179640..180470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33950"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33950.1"
FT                   /translation="MASDATFLLGVGAQKAGTSWLHDQLNRRKDADFGFLKEYHVFDAL
FT                   ELEHFSSFRPKNPTPLKWRTWRRARFMEQPERYFDYFASRLKPPQIRLTGDITPSYAGL
FT                   SAESYQRIQKAFAQRGVQTRAVFIMRDPVERFLSQQRMQLRKRGLLTPKHEIEHLNKAS
FT                   LKLLKRDSPRNDYPATLDALKDGFAASHVFIGLYETLFTADNHRALCRCLNIAEQIPEL
FT                   SHRVNASQATTAVPTEVLRRLGQHFTPLVTAVQERCPDLGVEQHWATAMTWRDA"
FT   gene            complement(180495..181343)
FT                   /locus_tag="Syncc9605_0175"
FT   CDS_pept        complement(180495..181343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0175"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33951"
FT                   /db_xref="GOA:Q3AN81"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33951.1"
FT                   /translation="MAQQIQLGEITFANDRPFALLGGVNVLEDLDFALRCSKHYKDVCE
FT                   RLNIPLVFKASYDKANRSSIHSFRGPGLKHGLEILQAVKDTHGIPVITDVHSPEEAAAA
FT                   AKVADIIQLPAFLARQTNLVRAMAETGAVINIKKPQFLSPEQMRNIVDKFRECGNEQLL
FT                   LCERGTNFGYDNLVVDMLGFGVMKRTCDDLPLIFDVTHALQCRDPGGAASGGRRTQVVD
FT                   LARSGMAVGLAGLFLEAHPDPAKARCDGPSALPLDQLEPFLTQVKAIDDLVKGMPDLHI
FT                   N"
FT   gene            complement(181389..182213)
FT                   /locus_tag="Syncc9605_0176"
FT   CDS_pept        complement(181389..182213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33952"
FT                   /db_xref="GOA:Q3AN80"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33952.1"
FT                   /translation="MPFSRTQKRIRRELQEQRALLSLAIERKTLKIKRDNLDRVVFYPE
FT                   HNIAFNRIAKSGNSSVILYLDEAIRGPSSHQNDYKQAKRSAMGTGKSLVEMSRTKQDRA
FT                   SLKKASFFTVVRNPWTRTLSAFLDKIANGPQDKYGSIPGFGDNSKAGFEAFITFLESGG
FT                   LHANHHWKPQKDALLLPASQFKSICRLEHLSTELPNALAESGLTLPNSEQLQQPHRIES
FT                   NQHSKLTQASSKLSRYYSPTTIQAVANLYTADFKLGSYNLDPRSIGLSLQSS"
FT   gene            complement(182241..183134)
FT                   /locus_tag="Syncc9605_0177"
FT   CDS_pept        complement(182241..183134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33953"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33953.1"
FT                   /translation="MPPTQPRMTGEVSMPSPKGSQRALLVPAPPKCASQTLAALLSNHL
FT                   DAPVVRHKTTKGFGHLLLNVPELGRRERWMRRIRFNQPHKRLLVYGHYPASHHNLKQLK
FT                   RRYSTAAVVMPVRPLGALLCSLIHHTRRKSYGPLDLRCAGLTDGIPNLHQRSESDLFHL
FT                   LGILYLPQIHLLIRSWIEATKTNKFPLFFVPFESITGAQSDLLAKINSLLPEDYQSAAD
FT                   PNGKDNAVKVNMSTNRKIKIGDIGFNQRESVEEMATKLFGCDDRLGALLPYLLSDLHSP
FT                   VRDCVAPLTWNFNSHQ"
FT   gene            183158..185548
FT                   /locus_tag="Syncc9605_0178"
FT   CDS_pept        183158..185548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0178"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33954"
FT                   /db_xref="GOA:Q3AN78"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33954.1"
FT                   /translation="MSFLAGLNDAQRRAVDHHEGPLLVVAGAGSGKTRALTHRIAHLIG
FT                   EHGADPAQILAVTFTNKAAREMKERLEVLLAQRLAQSQYGQPWSTLPPVEQRQLRSCIY
FT                   REVTKELWIGTFHALFARMLRYDIDKFKDAEGLTWTKQFSIYDEADAQSLVKEIVTQEL
FT                   QLDPKRFEPKKTRWAISNAKNQGWLPDQLEANAEGQRGKLTADVYRRYRKALAANNALD
FT                   FDDLLLLPVQLLQQNDQVRSYWHRRFRHVLVDEYQDTNRTQYDLIKLLVTDGKDPQDVE
FT                   DWSGRSVFVVGDADQSIYSFRAADFTILMGFQDDFGDQAPDDSTQTMVKLEENYRSTAT
FT                   ILEAANALIANNSERIDKVLRPTRGEGELITLTRCDDEIAEAEAVVHRMRTMEAANPEL
FT                   SWGDMAVLYRTNAQSRAIEESLVRWGIPYIVVGGLRFYDRREIKDLLAYLRLLVNPADT
FT                   VSLLRVINVPKRGIGKTTIQRLTDAANQLGIPLWDVVSDPEAVRSLGGRSAKGLLQFCD
FT                   LVNDLKARSRDVAPSELIQQVMEKSGYVSELIADGTDEAEERRRNLQELVNAALQYQEE
FT                   NDEGYLEGFLATAALSSDADSKDTAADRVTLMTLHSSKGLEFPVVCLVGLEQGLFPSYR
FT                   SLDDPASLEEERRLCYVGITRAKERLFISHACERRLWGGMREAAVPSVFLSELPEALIQ
FT                   GDIPQTGGAALRRERRLDRLTRVDRDKPSSAPANAVRRRQAGPAPGRSWQVGDRVIHAS
FT                   FGVGEITHTFGSGEKVSIAVKFAGMGPKILDPRLAPIEPVTTA"
FT   gene            185574..186284
FT                   /locus_tag="Syncc9605_0179"
FT   CDS_pept        185574..186284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33955"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33955.1"
FT                   /translation="MSSISQPIPIFIGYDPRERAATNVLIDSLYQNSSVPLAITPLVTP
FT                   QLEAQGLFRRERDPKQSTAFSFTRFLVPYLMGYEGWALFMDCDMLCRADIKALWDQRDD
FT                   AYGAMCVQHEHVPGETVKFLGEVQSPYPKKNWSSLMLLNCSRCTKLTPDYVNTATGLEL
FT                   HRFHWLEGDHEIGAIQGGWNHLVDVQAPPESEQAAPMLHWTLGGPWFREQRTMGGPLAA
FT                   EWFSARDDAMKLWD"
FT   gene            186284..187063
FT                   /locus_tag="Syncc9605_0180"
FT   CDS_pept        186284..187063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0180"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33956"
FT                   /db_xref="GOA:Q3AN76"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33956.1"
FT                   /translation="MAIRKCVVAVPARLQSSRLPNKVLADIGGKPMIQRVLERCSEAQG
FT                   VEAVVLCTDSTELQTLAEGWGFPVLMTSESCNSGSERIASVAHPLMALGWGDADPVAEE
FT                   TAVINVQGDQPFIEPAVIDAMAEEFRSQDPVPAVVTPVYGLKPESVHNPNVVKTLLAHD
FT                   GRALYFSRSAIPHVRDIAEADWHQHTTYWGHVGMYGFRGDVLAAWDQLPASPLEDLERL
FT                   EQLRLIEAGLTIATFRVEGTSLSVDTAEQLEQARAMV"
FT   gene            187138..189327
FT                   /locus_tag="Syncc9605_0181"
FT   CDS_pept        187138..189327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0181"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33957"
FT                   /db_xref="GOA:Q3AN75"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33957.1"
FT                   /translation="MSDLKCPFSGHTGAVTASAHTGNRQWWPIQIDLGLLHQHHPASNP
FT                   LGDTFDYPAAFAGLDLEALKADLAALMTDSQDWWPADWGHYGGLFIRMAWHSAGTYRGA
FT                   DGRGGAGHGNQRFAPLNSWPDNTNLDKARRLLWPLKRKYGNAISWADLIILSGNVALES
FT                   MGFRTFGFAGGRTDIWQPEEDVFWGKETEWLSDERHTTEGALDQPLAAVEMGLVYVNPE
FT                   GPHGHPDPVASGPDVRDTFARMGMTMEETVALVAGGHTFGKCHGAAPVSQLEAEPEGAE
FT                   LHQQGLGWHNRFESGKGEHTITSGIEGAWKPHPTRWDQGYFEMMFTYEWELTKSPAGAW
FT                   QWVAKDVKPEHMIPDAHVPGRASAPIMTTADLSLRHDPLMEPVARRFHQDQDAFADAFA
FT                   RAWFKLTHRDLGPRALYLGADVPEEIQIWQDPVPALDHPLIGAVEIKALKQKLLATGCS
FT                   VGALVATAWGAASTFRGSDRRGGANGGRIRFQPQNTWEVNDPEQLRSVLQTLETVQQQF
FT                   NAEATGGQRVSMADLIVLAGSAAVEQAAAAGGHSVTVPFLPGRMDASADQTDTASFNLL
FT                   KPIADGFRNWQRSGLPLRAEECLVDRAQQLGLSAPEMTVLLAGLRVLGANNGGNRQGVL
FT                   TDRVGVLSNDFCVNLLDMSIRWSPTSEAMEGYIGRDAQGSERWTASRADLVFGSNSQLR
FT                   AIVEVYAQDDGASRFVSDFVQAWVKVMNLDRFDVR"
FT   gene            complement(189341..189892)
FT                   /locus_tag="Syncc9605_0182"
FT   CDS_pept        complement(189341..189892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0182"
FT                   /product="phosphatase kdsC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33958"
FT                   /db_xref="GOA:Q3AN74"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33958.1"
FT                   /translation="MNKLRWWLLRRRLRSIQLLVLDVDGVLTDGGLWFDAAGQLSKRFD
FT                   VRDGLGIRLLQQAGLHIAFLSGGQGGATEVRARQLGISHCLVGIKDKPAALTALQNQLG
FT                   VSAQKTAFVGDDLNDLAVRPVVGLLFAPADACRPVRCGADAVLRRQGGHGAVRELAERI
FT                   LQERGRWGRLSRDGWKDRND"
FT   gene            complement(189889..190902)
FT                   /locus_tag="Syncc9605_0183"
FT   CDS_pept        complement(189889..190902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0183"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33959"
FT                   /db_xref="GOA:Q3AN73"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33959.1"
FT                   /translation="MGRSSRIRSLSALTRCLEEEASAIATAAARLSSDQVEAALALLDR
FT                   CANRKAKLVITGVGKSGIVARKIAATFSSIGLMALFLNPTDALHGDLGVVAAEDVCLLL
FT                   SNSGETTELLEVLPHLTRRGTGRIAIVGRADSSLARGSDVVLEASVDREVCPLNLAPTA
FT                   STAVAMAIGDALAAVWMERRGISPADFALNHPAGSLGKQLTLTASDLMVPASQLHPLQP
FT                   HTPLPEVIGGLTRDGIGSGWVENPDSPGSLLGILTDGDLRRALQDHGAETWTHLTAKDL
FT                   MTADPITVQTDVLVVKALEQMERNRRKPISVLPVVNQDKQLMGLLRLHDLVQAGLA"
FT   gene            190921..192132
FT                   /locus_tag="Syncc9605_0184"
FT   CDS_pept        190921..192132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0184"
FT                   /product="possible polyA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33960"
FT                   /db_xref="GOA:Q3AN72"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33960.1"
FT                   /translation="MDLPGVPSSVLEALQRAGQSRDVRCLALVGGVVRDQLLHQRCGRS
FT                   WSGVPDLDWVVEGDAAALVAELVVQVGSERISGVQEHGAFGTVAFQLDGIPLDLATARQ
FT                   EHYPAPAENPIVRAGTLEADLARRDFTINAMALDLVAGELIDLHHGQEDLASGQIRFLH
FT                   AGSVQDDPTRVIRAARYAARLGFELAKESREQIRSTMQQWPWAWGQGDAALTAPPALAS
FT                   RLRMELERLLEREPWPQALDLLEQWQALPLLDAQLQRDPGRTQRLHWARRLGLPLMPAL
FT                   LAGAADPVALAERLQIPGKQQQWLKQCGALCDWLMDNPPVLQASPSIWSTALEQKGWQP
FT                   EAVALAVTLRPKQWRPLLRWWGRWRRIQAPQTARNLIAAGWQPGPAIGEELRRQRSAAQ
FT                   DRSR"
FT   gene            192129..193553
FT                   /locus_tag="Syncc9605_0185"
FT   CDS_pept        192129..193553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33961"
FT                   /db_xref="GOA:Q3AN71"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33961.1"
FT                   /translation="MKRSWIVVVAAVCLAFGLRALVLIDATALWSDELYSVGKSFQPSF
FT                   SHLLAMLREDTHPPAYYGLLWLWGHLVGQSPVSLRFLSWLAYLAGGLVMVRQAMALGHA
FT                   GTRARVGAVAALLAFCSPYPVRFAIEGKSYAVLVLLVALAWWWRRSAHPVAYGAVAGLA
FT                   GLTHFYGLFLVLAAAAWDGWRRRWSFFTAALIGVIPALAWMTYAADYLFSSRAGSWIGV
FT                   PDYALVEETLARGLGLWPLPKLALILLLLVVLRRWGGLRRVPWPAWNLLDRSGLIPSLL
FT                   MVLGVVVVSFVKPMAFSRYFVVLLPAVVPVLAVQIGAFELNRFGRGCGLIIPVLLVVSW
FT                   WGPGFSELDAGAGGVREQDQFRLISQRTMGLEDRYSPRPRLFNLSDRMEAAMGRIPLPS
FT                   SPWGGKGDLKQRLQGPDLPRQLWLASSGPPPAMERKLKPLQSRVEKVGYRCDPQATDLT
FT                   HARLLHCRSEAMGPSE"
FT   sig_peptide     192129..192191
FT                   /locus_tag="Syncc9605_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.683 at
FT                   residue 21"
FT   gene            complement(193498..195525)
FT                   /locus_tag="Syncc9605_0186"
FT   CDS_pept        complement(193498..195525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0186"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33962"
FT                   /db_xref="GOA:Q3AN70"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33962.1"
FT                   /translation="MSRGGMLVMAGGGHSHALVLKRWAMKPEQRPRQSIVLVNRSSTTL
FT                   YSGMVPGWIAGLYQLDELAIDLRQLCDQAGVAFVEAEITGLDPQDRCLRLRKRPALHFD
FT                   WLSLDVGGVSRPSATGVPIKPLETSLAFLESEDPCDPKPLRVIGAGAAGLEVILALRRR
FT                   WPQRALQLQQRCGQLDPTVQKVLQRAKIALIDDERDYGGPSLLCTGSQGPAWLAVSGLP
FT                   LDRDGRIRTDRCLRVEGHPCLFASGDCAVISTEPRPASGVWAVRAGRPLAANLEAACQG
FT                   QQLRPWHPQREALQLIGSHEDAAWARWGRWRLGPSPLLWRLKQRIDHAFMAGFQQPATM
FT                   ADAAPMTCRGCAAKLPAQPLAAALERVGLGGQPEDAAHLPGSEELLQSVDGFPALVSDP
FT                   WLNGRLTALHACSDLWACGARVSSAMATITLPMVPANEQQELLVQTLAGIRSVLDEQGA
FT                   ELIGGHTMESRSASPLPASLGVQITLSVNGRSSQSPWLKSGLQPGDALLISRPLGTGVL
FT                   FAGAMTGATKATDLDAALKGMAGSQHTLLEQLEPVRGDIHACTDITGFGLLGHLGEMLQ
FT                   NRTGLKILLNGAAIPAYSGALDLFERGISSTLAPSNRTAWCWLDGPVQLQQPPSAALLE
FT                   LLVDPQTCGPLLLACSSKAAAQLTQKGPWLRIGNATTGHG"
FT   gene            complement(195522..196556)
FT                   /locus_tag="Syncc9605_0187"
FT   CDS_pept        complement(195522..196556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0187"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33963"
FT                   /db_xref="GOA:Q3AN69"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33963.1"
FT                   /translation="MGRRVLITGGAGFIGSHTCLVLLEQGHELVVLDNFDNSSPEALRR
FT                   VQELAGSTQLTLVEGDVRDPSAVDQAFSSGGAVDGVIHFAGLKAVGESVANPLRYWDVN
FT                   VNGSRVLAAAMERHGCRTLVFSSTSTAYGEPETFPLREDMPTAPVHPYAQTKVAVEQML
FT                   AALCRSGSWQVACLRYFNPVGAHPSGRIGEDPLGIPNNLFPFITQVAAERRERLRIFGN
FT                   DYPTPDGTGIRDYLHVMDLAEAHGSALDHLFKRQASDPLTLNIGTGCGLSVLDVVHGFE
FT                   QATGLAIPYEIVERRPGDVPRLEACPQTAQTVLGWRARRSLEEMCRDGWAWQQANPSGY
FT                   RGPT"
FT   gene            196613..197950
FT                   /locus_tag="Syncc9605_0188"
FT   CDS_pept        196613..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0188"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33964"
FT                   /db_xref="GOA:Q3AN68"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33964.1"
FT                   /translation="MLPPGRLSRCTCILHVSQLQSLRGMVDLLPEVLQRWQAVEAKARE
FT                   HFQRSGFGEIRTPLLETTDLFCRGIGEGTDVVGKEMYSFQDRGDRSCTLRPEGTASVVR
FT                   AALQHGLLSQGAQKLWYAGPMFRYERPQAGRQRQFHQIGVEWLGAERARSDVEVIALAW
FT                   DLLASLGVGGLQLELNSLGTAEDRKAYRNALVAWLEQRSEVLDPDSQARLSTNPLRILD
FT                   SKNKNTQALLEDAPTLVDALSDASRERFEEVQRGLTSLGIHFLLNPRLVRGLDYYSHTA
FT                   FEITSDQLGAQATVCGGGRYDGLIGQLGGPQTPAIGWALGMERLLLVLEAAAKADPQGD
FT                   AARLTAAAAPDVFLVNRGDEAECVALALARDLRAAGLRVELDGSGSAFGKQFKRADRSG
FT                   ASWAMVLGDEEVERGEVRLKRLQQQAEESTVALAPVAAIVEKLLTP"
FT   gene            197953..198903
FT                   /locus_tag="Syncc9605_0189"
FT   CDS_pept        197953..198903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0189"
FT                   /product="putative nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33965"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33965.1"
FT                   /translation="MQIHLVTGGAGFLGSHLIDRLMEAGDEVICLDNYFTGRKANIARW
FT                   IGHPRFELIRHDVTEPIKLEVDRIWHLACPASPIHYQFNPVKTAKTSFLGTYNMLGLAR
FT                   RVGARLLLASTSEVYGDPEVHPQPESYWGSVNPIGVRSCYDEGKRIAETLCFDYQRMND
FT                   VEVRVARIFNTYGPRMLPDDGRVVSNFIVQALRGEPLTLYGDGSQTRSFCYVSDLIEGL
FT                   IRLMNGDHTGPINLGNPAEFTIRELAELVRQQIRPNLPLMEKPLPQDDPRQRQPAINFA
FT                   RQQLNWEPTVSLEQGLAPTIHSFRNLLEIAEGCGT"
FT   gene            198900..200303
FT                   /locus_tag="Syncc9605_0190"
FT   CDS_pept        198900..200303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0190"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33966"
FT                   /db_xref="GOA:Q3AN66"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33966.1"
FT                   /translation="MTIQRICCIGAGYVGGPTMAVIADHCPQIQVQVVDINQARIDAWN
FT                   DADLSKLPVYEPGLDRVVERARGRNLHFSTDVAESIAAADMVFISVNTPTKTKGLGAGQ
FT                   ASDLRWVEACAREVAQAATEHTIVVEKSTLPVRTAAAIKTILQAASNGEGQRTFSVLSN
FT                   PEFLAEGTAIRDLEAPDRVLIGGDDPASIDALAAIYAHWVPQEQILRTNLWSSELSKLT
FT                   ANAFLAQRISSINSIAAFCEASGADVREVARAIGTDSRIGPKFLNAGPGFGGSCFQKDI
FT                   LNLVYLCRHFGLPEVADYWESVVALNTWQQHRIARLVVEKLFGTVTGKRLAILGFAFKA
FT                   NTNDTREAPAIRICRDLLEEGAQLAIHDPKVVARQMTRDLQQEAAPQADALSATGSWAE
FT                   ACSVEEAVTGADAVLVLTEWQDYRNLNWMSLAGRMRKPAWVFDARAITDHGQVRASGLN
FT                   LWCVGDGEG"
FT   sig_peptide     198900..198962
FT                   /locus_tag="Syncc9605_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.794) with cleavage site probability 0.774 at
FT                   residue 21"
FT   gene            200303..201322
FT                   /locus_tag="Syncc9605_0191"
FT   CDS_pept        200303..201322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0191"
FT                   /product="putative nucleotide sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33967"
FT                   /db_xref="GOA:Q3AN65"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33967.1"
FT                   /translation="MSRTVLVTGAAGFIGAALSKRLLQRGDRVVGLDNLNDYYDPGLKQ
FT                   SRLRQVEAIAPAGAWRFERLALEDDQGLMALFVEERPQVVVNLAAQAGVRYSLENPAAY
FT                   IQSNLVGFGNLLEGCRYHGTQNLVYASSSSVYGGNRNLPFHERQPVNHPVSLYAASKKA
FT                   NELMAHTYSHLYGLPATGLRFFTVYGPWGRPDMAPMLFARAILAGEPIKVFNHGKMQRD
FT                   FTYIDDIVEGVLRCCDKPATSNPEFDPLQPDPATAAAPHRVFNIGNSQPTELLRFIEVM
FT                   EQALGREAIKDFQPIQPGDVIATAADTSALEKWINFTPSTSIEDGIQRFANWYFEYFN"
FT   sig_peptide     200303..200362
FT                   /locus_tag="Syncc9605_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.854) with cleavage site probability 0.831 at
FT                   residue 20"
FT   gene            complement(201515..201772)
FT                   /locus_tag="Syncc9605_0192"
FT   CDS_pept        complement(201515..201772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33968"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33968.1"
FT                   /translation="MPDSSKLSQEFKEFRFRRRYDHLLRFRLRNAKPNEIIKAARELGF
FT                   KINAKDLEKARSRKAEQAAKKAEPIQKKSAFDRLNNFFKC"
FT   gene            202312..204084
FT                   /locus_tag="Syncc9605_0193"
FT   CDS_pept        202312..204084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33969"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33969.1"
FT                   /translation="MLAKITSINPIDHFGFNITLKHLSIALDEFSFVGVIVPKHQLSPP
FT                   AFSLLLVSGSRSWSFPCHFHEGNHIIQGEIPTKELDIDVSFKLLLNNIQCPWMQMRLDM
FT                   TNLDDATKWTNYFSGYKRLMPALNLGGLAKSILSTVEVVHAGNPPSQFSAFCDLVTRPD
FT                   FVVHMARLSRLGRFPAVFSQEDGVLLGSRLLVDWNVLMIQEADQRLFVFQGVTSCDAIF
FT                   IPGLNKLIIVCHITPQNILSCLRELSLTPDFYQLDRSRSFHGYLVGHARPYHCNYDSLL
FT                   ALQRIRDEGELLSEDALFSKDDEAFIDLGAGLGLVQQHQICTKASLNKLTESQEGYLLK
FT                   LGLWFYCNSKPDPHSFTLATTTDTSLREFADTSSHLASSGALEFLEESQPLLWVGITGQ
FT                   KRRWLEQVEGTAAILNKLYEHYPNLAVVFDGWTPPLVSGDRSDYHRKESRKDNDVIQEI
FT                   IKKLPFRKHGRFGVIAGLPMLEKIRIGMSVDLFMANYTTGSINIARICQKPGVGHMSNK
FT                   MADHKAQHIHYCTKTVDKALVEDQPDPENRVGYMDYSLPWQAVYNKLLETLIELKIEPV
FT                   TPLAPLTLPNHSEK"
FT   gene            204725..207817
FT                   /locus_tag="Syncc9605_0194"
FT   CDS_pept        204725..207817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0194"
FT                   /product="Lipopolysaccharide biosynthesis protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33970"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33970.1"
FT                   /translation="MDNSLAKQFSHFLSSGDYSSANQIVNQARNLNYPVGLISSWENLL
FT                   AKTNPGFVHPLDAVVSQEYNVDNLCSELTPDLRAVFEEKISEYSKKNNIDSNLIDKIVE
FT                   LVFDNFQIDTGRIIIPDLTSNDPIANLFHYSVKEYSIDNPDVPEAVDRGVCVSVIDHFL
FT                   RYGYIEILEGRRHSSLSFSHAKKKYDGNLLYIVDNYDDLDESERLDLKSLQLSKLHADV
FT                   YSIKDTCVYTHNGSSMTIEQYLFYNISDDHNLCILLKGKTLTRSAAKWIVDIKLEDRTA
FT                   IFGYSANNGRFCAVTEYSRPNMLISDITNGCIIANSIEVLAVVSSLKDYQTAYGYFHAL
FT                   VLELEDFGVEFNLKREILSESFSKAIANFDSTHSTYWSPFYYLNDYKSSFFPIRRDLVK
FT                   TWQKQLASIDQSDKSESTKSSLHVDGENSIVKFIPSLNNSVGVVIPFKDKIHLLEDCVK
FT                   SLILNEEEVALKIYAINNGSIEPKTFEVLDRLKNQYEDLFVCIDFPGEFNYAKINNYAV
FT                   DFVEEEYLLFLNNDIVIESSFAVTTLLKTHCFYNAVITGSKLLYPSGKIQHNGLSSTME
FT                   KHIAINSPFSRHYTHSNHGFSLDHYVHPWERTHECSAVTAACMIMKKEEFLRIDGFDED
FT                   FKVAYNDVDLCFRATKEYHQRPIICSTEVKIYHLESESRGDDNDDESGTRLYHERVNLV
FT                   SRHEDIFSRPDKFTGVSTVFNNLQKIVKTSFDRKFIDHTSKPSSDIELDDLVLHQVHNS
FT                   MKQRYACIFVHYDIDPLITDDCVYHLEKLSEYCDIFFVSSSECLANAPEEVEKIKPLCS
FT                   QILIRKNSGYDFGCWSHVIRKNYARLCNYEGVLLANDSNWGPLNDFSDTFARINRYSSE
FT                   ADFMGLTSSITPSWHLQSFFIFYSRKVFSSSFFKLYWFNIGILDSKYEIIMNYEVGWSA
FT                   RLVRLGFKGIALYGTSEATNPTHVNWESLLRSRYPYLKKELIRDNPLKINLDNLPNILR
FT                   SQDLNWQASILDYLKRYNRENSETAKLFSSSKSSVIKSGMD"
FT   gene            208010..208291
FT                   /locus_tag="Syncc9605_0195"
FT   CDS_pept        208010..208291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33971"
FT                   /db_xref="GOA:Q3AN61"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33971.1"
FT                   /translation="MIMICVGVLVFGFRHLNSRNFLCVGSIDTLCQSALFNFIDRDNIF
FT                   AFVCSSVLRGSRHRFLSNLFIAIFILAMMTLSHEVVSSSISQNRIRLN"
FT   gene            208383..208682
FT                   /locus_tag="Syncc9605_0196"
FT   CDS_pept        208383..208682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33972"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33972.1"
FT                   /translation="MMHPINSSLVNQDSDVNNSSSEIKSLERRIRELKLQVECQDAKYK
FT                   QSLADGKLAMQHIEKLQEEVEYYFLLSEKKQKIIESLEELQAKSTEIIYNYVQK"
FT   gene            complement(208764..208964)
FT                   /locus_tag="Syncc9605_0197"
FT   CDS_pept        complement(208764..208964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0197"
FT                   /product="putative photosystem II reaction center J
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33973"
FT                   /db_xref="GOA:Q3AN59"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33973.1"
FT                   /translation="MSGKKSPYPDGRIPDRNPDGTPAVPWRSRWTEGVLPLWLVATAGG
FT                   MAVLFVVGLFFYGSYTGVGSA"
FT   gene            complement(208975..209094)
FT                   /locus_tag="Syncc9605_0198"
FT   CDS_pept        complement(208975..209094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0198"
FT                   /product="photosystem II reaction center L protein (psII 5
FT                   Kd protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33974"
FT                   /db_xref="GOA:Q3AN58"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33974.1"
FT                   /translation="MERNPNPNNLPVELNRTSLYLGLLFVFVTGVLMSSYFFN"
FT   gene            complement(209102..209242)
FT                   /locus_tag="Syncc9605_0199"
FT   CDS_pept        complement(209102..209242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0199"
FT                   /product="cytochrome b559, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33975"
FT                   /db_xref="GOA:Q3AN57"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33975.1"
FT                   /translation="MTQAPPVATTPRNYPIFTVRWLALHTLGIPTVFFLGALAAMQFIR
FT                   R"
FT   gene            complement(209246..209494)
FT                   /locus_tag="Syncc9605_0200"
FT   CDS_pept        complement(209246..209494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0200"
FT                   /product="cytochrome b559, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33976"
FT                   /db_xref="GOA:Q3AN56"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33976.1"
FT                   /translation="MAAGSTGERPFFEIITSIRYWVIHAVTLPSIFLAGFLFVSTGLAY
FT                   DAFGTPRPDAYFQASESKAPVVSQRYEGKSELDIRLK"
FT   gene            complement(209566..210567)
FT                   /locus_tag="Syncc9605_0201"
FT   CDS_pept        complement(209566..210567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0201"
FT                   /product="photosystem II stability/assembly factor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33977"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33977.1"
FT                   /translation="MKRLLNSATQLLLVLVLGISLSGCVTTHVPTATTSPWQAMDLDTQ
FT                   ANPLDVAFTDSSHGYLVGSNRMIRETNDGGAHWNERSLDLPDEENFRLISIDFSGDEGW
FT                   IAGQPGLLMHSDDGGQNWTRLFLDTKLPGEPYLITALGSHSAELATNVGAVYETHNDGS
FT                   SWEAKVTDAAGAVRDLRRSKDGSYVSVSGLGNFYATWEPGDSVWQVHQRVSSQRLQSIG
FT                   FQPDGNLWMVARGAQIRLNDEPGDFDSWSKAIIPITNGYGYMDLAWDDDGAIWAGGGNG
FT                   TLLVSRDGGDSWENDPVGDRQPSNFTRMVFDGEHAFVLGERGNLLRWVDNAV"
FT   sig_peptide     complement(210484..210567)
FT                   /locus_tag="Syncc9605_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.668 at
FT                   residue 28"
FT   gene            complement(210577..210996)
FT                   /locus_tag="Syncc9605_0202"
FT   CDS_pept        complement(210577..210996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0202"
FT                   /product="probable rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33978"
FT                   /db_xref="GOA:Q3AN54"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33978.1"
FT                   /translation="MSDEQQSVQPVEATEAVEPAIEAVKPAIETASESDPRTHRFECRS
FT                   CGYVYDPEEGVKKVGIEAGTAFEDLDPMSFRCPVCRSRVAAFRDIGPRAKASGFDENLN
FT                   FGLGVNRMTPGQKNVLIFGGLALGFAFFLSLYSLR"
FT   gene            211080..211442
FT                   /locus_tag="Syncc9605_0203"
FT   CDS_pept        211080..211442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0203"
FT                   /product="putative NADH dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33979"
FT                   /db_xref="GOA:Q3AN53"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33979.1"
FT                   /translation="MFALPGYDAFLGFLLIAAAVPVLALVTNKLVAPKSRAGERQLTYE
FT                   SGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAIL
FT                   LVALAYAWRKGALEWS"
FT   sig_peptide     211080..211154
FT                   /locus_tag="Syncc9605_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.930 at
FT                   residue 25"
FT   gene            211445..212185
FT                   /locus_tag="Syncc9605_0204"
FT   CDS_pept        211445..212185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0204"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33980"
FT                   /db_xref="GOA:Q3AN52"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33980.1"
FT                   /translation="MSENTSPSIAAVRDLREASCSPIGAPTVTNDLSENVILTSLDDLH
FT                   NWARLSSLWPLLYGTACCFIEFAALLGSRFDFDRFGLVPRSSPRQADLLIVAGTVTMKM
FT                   APALVRLYEQMPEPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPPRPE
FT                   AIFDAVIKLRKKVGDESLAERRKHQQTHRYVTVSHQMKRVEPVVNGSYLRAESQKAALA
FT                   AAPAGQTLATDAAVLTPAAEPLES"
FT   gene            212182..212748
FT                   /locus_tag="Syncc9605_0205"
FT   CDS_pept        212182..212748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0205"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33981"
FT                   /db_xref="GOA:Q3AN51"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33981.1"
FT                   /translation="MSETPSKQTAASDETGAVVAPEPGPVSQWLNKQGFDHNILEPDHL
FT                   GVEQIGVDAAVLPMIAAALKSNGFDYLQCQGGYDEGPGEQLVCFYHLLAMAEQVEAMVA
FT                   DPSAKLREVRIKVFLNREGTPSLPSIYGLFRGADWQERETFDMYGIQFEGHPHPKRLLM
FT                   PEDWKGWPLRKDYVQPDFYEMQDAY"
FT   gene            complement(212756..214111)
FT                   /locus_tag="Syncc9605_0206"
FT   CDS_pept        complement(212756..214111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33982"
FT                   /db_xref="GOA:Q3AN50"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33982.1"
FT                   /translation="MMRDQRRRDLMTRSQRAVRWLQPGLVVKRWLLTSGLGLLMALLGA
FT                   AVWADLKPIYWILETLSWILGTLTTVLPREITGPLVVLIGSGLLLWGQSRSFGSIQQAL
FT                   APDKDTVLVDALRAKSRLNRGPNIVAIGGGTGLSTLLSGLKRYSSHITAIVTVADDGGS
FT                   SGVLRRELGVLPPGDIRNCLAALSTEEPLLTRLFQYRFAAGSGLEGHSFGNLFLSALSA
FT                   ITGNLETAITASSRVLAVQGQVVPATNVDVQLWAELENGQRIEGESNIGHAPSPIVRLG
FT                   CSPERPPALPRALEAIANADLIVLGPGSLYTSLLPNLLVPELVNAIKRSRAPRLYICNL
FT                   MTQPGETDGLDVRGHIRAIEAQLASLGIEPRLFTAVLAQDDLPDSDLVRYYQTRGAHPV
FT                   HCDAEGLRSDGYDVTQAPLQGVRPTATLRHDSRSLALAVMRFYRSHRSQNAA"
FT   sig_peptide     complement(213962..214111)
FT                   /locus_tag="Syncc9605_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.982 at
FT                   residue 50"
FT   gene            214273..215019
FT                   /locus_tag="Syncc9605_0207"
FT   CDS_pept        214273..215019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0207"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33983"
FT                   /db_xref="GOA:Q3AN49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33983.1"
FT                   /translation="MMQWGPRPVLDRVNLTLRAGERLAVVGPSGAGKSTVLRLLAGLQL
FT                   PTSGELRLFNQPQTYLRLDQTDPPDVRLVFQNPALLASLTVEDNVGFLLRERAQLSRQE
FT                   IRDRAHACLEAVGLYDVAHLYAGELSGGMQKRVSFARALIDDPQRGDQSMPLLLYDEPT
FT                   AGLDPVACTRIEDLIVKTTTVAQGCSVVVSHVRSTIERSAERVVMLYDGRFQWEGSVDA
FT                   FRTTDNPYVVQFRTGSLRGPMQPAEH"
FT   gene            215025..215885
FT                   /locus_tag="Syncc9605_0208"
FT   CDS_pept        215025..215885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0208"
FT                   /product="possible ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33984"
FT                   /db_xref="GOA:Q3AN48"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33984.1"
FT                   /translation="MRRSVRDAIVGFTVIGGIIGFASTALWLRGVRLGASHWTLTARFD
FT                   DAAGLAERSPVTYRGILIGAVRSIEVTPEAVVAELEINKGDLRLSRPVTVTVGAGSLLG
FT                   GDAQVALVSSGEPLPQDAPLPRGVDCQPTRQLCNGGTVVGREAPSLSTVTATMQELLAQ
FT                   VQDERVIPNVAASLEQMEATTKEFEALTVQLLNELAKAAPVIRNLESATAHVNNIAASL
FT                   DNPQTVSEFKQTAANAAQLTAKIDAVGGDVAQLTGDPEFMKGVRNLTIGLGELFSEIYP
FT                   AQTAQ"
FT   gene            complement(215936..218041)
FT                   /locus_tag="Syncc9605_0209"
FT   CDS_pept        complement(215936..218041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0209"
FT                   /product="Magnesium chelatase ATPase subunit D"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33985"
FT                   /db_xref="GOA:Q3AN47"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33985.1"
FT                   /translation="MVSSGLAIKDDQATRAFPLAAITGHGTLKLALLLAAVDPGLGGVV
FT                   IAGGRGTGKSVLARGLHALLPPIDVLDAEGGVGRNLDPQNPEEWDDATRESVSGEAPST
FT                   VIPAPFVQIPLGITEDRLVGAVDVAASLSSGSAVFQPGLLADAHRGVLYVDELNLLDDG
FT                   IVNLMLAAVGSGENRVEREGLSLSHPCRPLLIATYNPEEGNVRDHLLDRFAIALSANQL
FT                   VSTEQRVEITNAVISHGQCSRSFAEKWGEETDALATQLLLARQWLPDVQISGEQIEYLV
FT                   TEAIRGGVEGHRSELYAVRVAKAHAALSGRDQVEADDLQVAVALVIAPRASQMPPPDQQ
FT                   MEPPPPQDQEPPPPPQDQGDQQQDNPPPPEGSGEEENEPPEDNSEDDSTDDDEGDDEED
FT                   QAPPAVPEEFMLDPEAIEVDPDLLLFNAAKAKSGNSGSRSVVLSDSRGRYVKPMLPRGP
FT                   VRRIAVDATLRAAAPYQKIRREREPGRSVIVEEGDLRAKLLQRKAGALVVFLVDASGSM
FT                   ALNRMQSAKGAVIRLLTEAYENRDEVALIPFRGDQAEVLLPPTRSITAARRRLESMPCG
FT                   GGSPLAHGLTQAARVGANALATGDLGQVVVVAITDGRGNVPLSTSLGQPELEGEEKPDL
FT                   KQEVLDVAARYRMLGIKLLVIDTERKFIGSGMGKDLAEAAGGKYVQLPKASDQAIAAVA
FT                   MDAISNI"
FT   gene            complement(218050..219456)
FT                   /locus_tag="Syncc9605_0210"
FT   CDS_pept        complement(218050..219456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33986"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33986.1"
FT                   /translation="MIIKKFIKKLSFLNFSKYERKKSIPLLNPSKDEIERLTLKEVDSL
FT                   ISEKKYKKALKLITTSIKSGAKTNKILLKKAFLLSQIGQYTDAHAIWERLSNLTNKPKI
FT                   AALAKKSLEMSKHLQANQINSVKLLIETCHAIAQKYQQKLNHLPSSKDEYSGENIIPAI
FT                   RREAEIARTYELPKLSSDIIEQTLQAGLESPLLINDKALSMGMLGQHKKALEILTSLEQ
FT                   EIKNPSIKNTIKESITNLEKSANHHQAKKSIYLIKQSKLLAISSGIEAKHIPDEFNANT
FT                   ELEVKSLIFGVAINCIKTNPKACLRIVNSILDYFPDDGASMQLKGEALAELKRDKEAIN
FT                   VWTKLAHSEHEETADKARKSISQLLAQKALLISANKSPQEALSIFIDEHLKINLAPTFN
FT                   ELIAPILNQFGPGDETLFDPELEHHQLQLQFNTIVIQRLEAQLINQSNSKNHSPAEKPD
FT                   AISKTASKAG"
FT   gene            219542..220039
FT                   /locus_tag="Syncc9605_0211"
FT   CDS_pept        219542..220039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0211"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33987"
FT                   /db_xref="GOA:Q3AN45"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33987.1"
FT                   /translation="MAPFPLQQALAIGLGANVRSCHGPPEATLRLIAPLLSGWLLTWGD
FT                   VDSCDVRCSSFLTTQPIGGPLGQDAYCNAVLLLTRVQRLPSELAALELLEHLQRLEQSC
FT                   GRDRQREQRWGPRPLDLDLLFWGELRLEHPRLVLPHPRMHLRSFVLEPLLQAMQGIHPP
FT                   CW"
FT   gene            220058..220618
FT                   /locus_tag="Syncc9605_0212"
FT   CDS_pept        220058..220618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0212"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33988"
FT                   /db_xref="GOA:Q3AN44"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33988.1"
FT                   /translation="MAPLPAPEPFELLDTVEAVDARKIRFERNRIKLPMGVEATFGMIR
FT                   HPGASLAVPITGDGQVVLLRQYRFAVQARLLEFPAGTLEEGEDPLMSMQRELGEEAGYS
FT                   AAKWDALGPMLPCPGYSDEVIHCFLARALTPLENPPAGDDDEDLEVVLMTPAALDAALA
FT                   SGDEWLDGKSVTAWYRAKQLLGL"
FT   gene            220618..222051
FT                   /locus_tag="Syncc9605_0213"
FT   CDS_pept        220618..222051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0213"
FT                   /product="Deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33989"
FT                   /db_xref="GOA:Q3AN43"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33989.1"
FT                   /translation="MPTSRVLFWHRRDLRLADNLGLVVAAQISPAVTGVYVLDPAVINP
FT                   PPELPPMAPARLWFLIESLVELQQRWREAGSRLLVVEGDPVAVLPQVAQQISAEAVVWN
FT                   RDVEPYARKRDRQVAKTLQADGRRVVADWDQLLIAPELLKTGAGDPYRVYGPFLRNWRG
FT                   QVLAQKPATVAAPTGLVDLPPELMPAGDPLPALRESHGFQGSEICPCRPGEAAALEQLT
FT                   TFCNGPLLGYEPDRNFPGTAGTSYLSAALSVGTLSPRQAWCAAQDSREQARSEEQLQAI
FT                   AVWEQELGWREFYQQALFYFPELADGPYREQWRRFPWENNEDWFDFWKEGQTGMPIIDA
FT                   AMRQLNQTGWMHNRCRMIVASYLVKDLICDWRWGERAFMELEVDGDLAANNGGWQWSAS
FT                   SGMDTKPLRIFNPATQASKFDSAGDYIRRWVPELRHVNTKDLLSGEIGALERRDYPEPL
FT                   VDHKNQQARFKALYATIRS"
FT   gene            complement(222030..223271)
FT                   /locus_tag="Syncc9605_0214"
FT   CDS_pept        complement(222030..223271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0214"
FT                   /product="putative pleiotropic regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33990"
FT                   /db_xref="GOA:Q3AN42"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33990.1"
FT                   /translation="MQVPPFSLSQQIDDLGVDLEEAVLEVLRSGQYIGGPQIKRFEEAF
FT                   AASVGCEHAVGCNSGTDALILALRGLGIGACDEVITCSFSFFATAEAISAVGATPVFVD
FT                   VDPSTYLIDFDQIEASITPATRALMPVHLFGRAVNMTRLMAIAERHQLKVIEDCAQATG
FT                   ARWQGQAVGSFGDAGCFSFFPTKNLGAAGDGGVVTTSDAGLAQAMRELAVHGMPERYLH
FT                   TSLGYNSRLDAIQAAVLNVKLPKLEAWISKRTAIAERYRDALGDLNGLTLPTADDGHSW
FT                   NQFVVRIGSCPNGQQLCNASCNPSSTSARHGIPESCCRDWVKQTLQEHGVSTIIYYPIP
FT                   IHRQPAYAHLGLKQGSLPVTEQLCSQVLSLPTFPELSDTQQQAVIDTVRQLMAPKVPAQ
FT                   FRRSDEGDQDRMVA"
FT   gene            complement(223291..223875)
FT                   /locus_tag="Syncc9605_0215"
FT   CDS_pept        complement(223291..223875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33991"
FT                   /db_xref="GOA:Q3AN41"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33991.1"
FT                   /translation="MALTPSTMLALGTRLPDFDLPQVTDGRLNSQSLVERPVLLMVLCA
FT                   HCPFVKHVEPELSRLDHDFSEAVQLVGVSSNSLITHPQDGPEQLADQAKRQGWSFPYLL
FT                   DEQQTLARDLRAACTPEFYLFSPDGEGLQSLRYRGQLDGSRPSNDLPLDGRELRAALDA
FT                   VLTGSPVNPDQTASVGCNVKWNPGHEPEWFG"
FT   gene            223933..224451
FT                   /locus_tag="Syncc9605_0216"
FT   CDS_pept        223933..224451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33992.1"
FT                   /translation="MPRPRLLWGVALLLGACAAPKEPPSWRLFPLQRHVSHDGVAVVNQ
FT                   PDGFGLHIYLETDTSFPGVCRPRWLPDPARLFNGNGSTPFSSGLATRQEFFDAVARIDV
FT                   RALLKGELKALCLARAPEDRWQWTEPPRKEDQVVPVQLPSLEEEDLLTNPVEELKRARQ
FT                   LLRDQRAGE"
FT   sig_peptide     223933..223989
FT                   /locus_tag="Syncc9605_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.856) with cleavage site probability 0.856 at
FT                   residue 19"
FT   gene            complement(224433..224873)
FT                   /locus_tag="Syncc9605_0217"
FT   CDS_pept        complement(224433..224873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33993"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33993.1"
FT                   /translation="MTFQRPILWIHEEALGANNPALQAWPEAPAVFVFDTQWIQDARIS
FT                   RKRLGFLYENALDLPVTLRKGNVADEVLAFARRHQADGVVSSSAVDPRLGRIGEAIDAE
FT                   LPLDLLDPAQFVELPRPPRLGRFSRYWREAEAVVWEGYSPAR"
FT   gene            complement(224889..225800)
FT                   /locus_tag="Syncc9605_0218"
FT   CDS_pept        complement(224889..225800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0218"
FT                   /product="probable deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33994"
FT                   /db_xref="GOA:Q3AN38"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33994.1"
FT                   /translation="MPSAASPPINGDLPRQFASREALNTLLAQEFPGAEGELSPIRGGR
FT                   VPAEEKLRRIDARRYAKSRNHLRGAVTGLSPYIRHGVLTLAEVRDSVFERIRNRDEGGK
FT                   LINELGWRDFWQRMWLDLGDGIHDDQEPFKTGHDAGAYAQELPADVRAGTTGLACMDGF
FT                   RDQLVSTGWLHNHARMWMAAWLVHWRRVHWKAGADWFLEHLLDGDPASNHLSWQWVAST
FT                   FSHKPYFFNRGNLERYSEGQYCNSCPSANSCPFEGSYDQLENQLFAPMPAIRETGNNRN
FT                   QQRNRQRRSSGGASAALARPKR"
FT   gene            225824..226666
FT                   /locus_tag="Syncc9605_0219"
FT   CDS_pept        225824..226666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0219"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33995"
FT                   /db_xref="GOA:Q3AN37"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33995.1"
FT                   /translation="MILAGDGGESREFNPFRSVPMLLDLTGKKILVTGIANNRSIAWGI
FT                   AQQLKAAGAELGITYLPDDKGRFEAKVRELTAPLEPSLFLPLNVQDADQMAEVFGEIKE
FT                   KWGVLDGLVHCLAFAGKEELIGDYSATTAEGFARSLDISAYSLAPLCAHAKPLFSEKAG
FT                   VITLSYLGAERAIPNYNVMGVAKAALEASVRYLAAELGPEKQVRVNAISAGPIRTLASS
FT                   AIGGILDMIHNVEEKAPLRRTVTQMEVGGTAAFLLSDLASGISGQTIYVDAGYCVTGM"
FT   gene            226696..227304
FT                   /locus_tag="Syncc9605_0220"
FT   CDS_pept        226696..227304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0220"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33996"
FT                   /db_xref="GOA:Q3AN36"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33996.1"
FT                   /translation="MARQGTIHRVTGETDVKVRLDLDGSGQCQASTGVPFLDHMLHQIS
FT                   SHGLIDLEINAVGDTHIDDHHTNEDVGIAVGQALAQALGDRRGIHRFGHFVAPLDEALV
FT                   QVALDCSGRPHLSYSLAIPSQRIGTYDTELVKEFFVAVVNNSGLTLHIRQLDGVNSHHI
FT                   VEACFKAFARALRMATEVDPRRAGAIPSSKGVLEQAGAS"
FT   gene            227365..228831
FT                   /locus_tag="Syncc9605_0221"
FT   CDS_pept        227365..228831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0221"
FT                   /product="lignostilbene-alpha,beta-dioxygenase and related
FT                   enzymes-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33997"
FT                   /db_xref="GOA:Q3AN35"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33997.1"
FT                   /translation="MTVAPTRSYDRSDWASSFVNVEQELTDVALTPVRGTVPAELQGTF
FT                   YRNGPGRLERDGHRVHHPFDGDGMIAAMRFENGSVSLSNRYVRTEGWLAEEKAGKILYR
FT                   GVFGSQKPGGRLANAFDLRLKNIANTNVVRLGDQLLALWEAAEPHALDPRSLETRGLSR
FT                   LDGVLKKGEAFSAHPRFDPGHNGRPCMVTFGVKTGPRSTIRLMEFATDGPEAGALLHDR
FT                   SDSFPGFAFLHDFAITPNWAVFLQNAIAFNPLPFVTGEKGAAQCLASQPGGKGRFWLIP
FT                   RDSGRFAGQKPRILEAPDGFVFHHLNAFEDGDHVVVESIVYDDFPSIGPDEDFAEVDFD
FT                   TVPEGTLHRCRLDLSRESVQTERISERTCEFAMVNPERQGLSARYAWMAVAERETGNDP
FT                   LQAIQKLDLDSGATHTWSAAPRGFVSEPLMVRRPGAESEDDGWVLDLVWNGARVASDLV
FT                   ILNARDLSEVAVLELPLAVPHGLHGSWAAG"
FT   gene            228919..229620
FT                   /locus_tag="Syncc9605_0222"
FT   CDS_pept        228919..229620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33998"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33998.1"
FT                   /translation="MTNRLWGVAKVAVSVLFGLSVVAPSPLRAAERVCNGTLLQIQVNE
FT                   RGTSHSDRFRFSLGIDAEKANKDAAMTALNGRLAEARQVIQPLALGRLTIPAPRSYSVG
FT                   GGTSGPRLERASTTITGEVSRDNYNALIQAVGRLPGVRLRGMTSLATSDSRASLADQLL
FT                   KKALETGQRRAQATARALGLRKVELLLIDQRGSTQRPMQMAVRRENTSFRPGEAPKPSQ
FT                   SLALKLDYCLR"
FT   sig_peptide     228919..229008
FT                   /locus_tag="Syncc9605_0222"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(229605..231161)
FT                   /locus_tag="Syncc9605_0223"
FT   CDS_pept        complement(229605..231161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0223"
FT                   /product="putative glycine betaine transporter, BCCT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABB33999"
FT                   /db_xref="GOA:Q3AN33"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB33999.1"
FT                   /translation="MSDIPTNQRSWWRQPPLWVGAAPLLIFLLVSAIDLALAKQFTDNG
FT                   KAVISDALGGVWQWMVVLLFLIALILAISPVGKLRLGGAEAKPSLKFFDWCAVLICTLL
FT                   AGGGVFWSAAEPLYHFQTPSPVFEGVEGSTAAAVDPALAVSFLHWGFLAWALVATTTTI
FT                   TFSILERRGEPLRPRTLLVNIVPRSWVDGPLGHLADGLSVVAAIAGTVGPLGFLSLQLS
FT                   NAAGQLPWLSDSAGLQSLVVVLLTAVFATSTVSGIQKGIKWLSELNVWLTLALAAGLLL
FT                   LGPGLWLIQHFFSGFITYLIHLPQMALTPNAVPANWVNGWTVFYWGWFLGYAPLMGLFT
FT                   AGVSRGRSIRELVLAVAILCPIVTNLWFTLLGGTGLHLELAGGVISDALAQNGAAAALL
FT                   TILSQLPLAGLLIPIGLVLVVLFMCTSADSMSYAAAMVVSGRNEPPALLRLFWALMIGS
FT                   LTLVLLRIGSGLGDSTSIDALQAFIVITAVPVTPLVLATLWSAPRLAWKEWHRTADQRR
FT                   Q"
FT   gene            complement(231180..232370)
FT                   /locus_tag="Syncc9605_0224"
FT   CDS_pept        complement(231180..232370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0224"
FT                   /product="putative sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34000"
FT                   /db_xref="GOA:Q3AN32"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34000.1"
FT                   /translation="MSTPTSIPSRAAVVIVGGGMAGLSCAASLARRGVRDVVLLEAQTL
FT                   AHAKASSYGETRMFREMYSDPVLCRLAQEANRLWREEENHAGQQLRETHGLLFYGESWD
FT                   EETIEGSIPGARRVMDNQGIPYEALDANQIAARFPLKPKAGFTGLFEPTAGAVRSDRVV
FT                   AHWINTARNASHQLIEHCPVAGLDPDGGGVTLESGEHIAAGQLVVACGIWSQLLLAPLG
FT                   LAPKLEVWPMLWAHYTVDPALADRYPQWFCFQQERGDDGGLYYGFPVLSQTADGRPRIK
FT                   AGIDWAPSELRVAEPNAMVTGPPARLVELLDAFLFNELDGVQERVETVISPYSMASDVN
FT                   FVLDRLTPKLSLFAGGSGQAFKFAPLIGDSLARLASGEQPAVDLSCWSHQRTAVRA"
FT   sig_peptide     complement(232290..232370)
FT                   /locus_tag="Syncc9605_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.948 at
FT                   residue 27"
FT   gene            complement(232367..233422)
FT                   /locus_tag="Syncc9605_0225"
FT   CDS_pept        complement(232367..233422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0225"
FT                   /product="Glutamate dehydrogenase/leucine
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34001"
FT                   /db_xref="GOA:Q3AN31"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34001.1"
FT                   /translation="MSSGKKTAPTVSVLAEHVSDHLSVFVVAEDTDAKRPANGGLRVLN
FT                   YPSDEACIADGQRLAGLMTHKHDLYGTGFAGGKIVARAAEPDAVKDELISVTAELLESL
FT                   DGAMITGCDLNTSLEDMERLTALTPHVLAAVGSPVDASAATAHGTLGAVEAVLDKALND
FT                   AQPGRALVHGCGAVGGTVARHLVEHGWTVFTVDLNREKASFTGATPLPDSCAWWELNHD
FT                   LLLPCSISGLINAEMATALKTPAVVPAANAPFQQPQLADDLRRRGVKVLPDPLVNAGAV
FT                   IADSIERFSPDAWKDAGAVDVYAFVRDEVRRRASDYLNRREQGLSVGAALDEVAATPST
FT                   EPIGLSFGESE"
FT   gene            complement(233422..234459)
FT                   /locus_tag="Syncc9605_0226"
FT   CDS_pept        complement(233422..234459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34002"
FT                   /db_xref="GOA:Q3AN30"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34002.1"
FT                   /translation="MAIAMTTGYSAQTEGALLCIEAASDWALTCVDELAVADSHVLIDY
FT                   GAADGGTAVGLWNQVLDRLHANQPKAHLTVIGNDLPSNDNTALANNLALQIPRDPRPTV
FT                   LVSARSFYEPSVAPNSVSFGFSATAMHWLSASPGPLNSHTHVLASGDAGALQRFTAQAM
FT                   KDWNHILELRSRELKVGGRLLTVNLSRDEAGLYLGHNGGETRNVHDQLHQIWRGMAEEG
FT                   LISQEQYQQGTVLNFYKSPEEFMAPLKDETSAAYRNGLRLVDERTVYVKCPYRRRWNEN
FT                   GDTATFAAGLMATIRSWSRHSFASAAGDTAADTVFERLQQRIAEAPSEWSLDYVEHHQM
FT                   MEKVA"
FT   gene            complement(234529..235110)
FT                   /locus_tag="Syncc9605_0227"
FT   CDS_pept        complement(234529..235110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0227"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34003"
FT                   /db_xref="GOA:Q3AN29"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34003.1"
FT                   /translation="MKTLVIASGNAGKIREFQGLLQSLPVSVQPQREGLEVEETGTTFA
FT                   ANAQLKAQAVAAATGEWALADDSGLSVDALDGAPGVHSARYAPTDPERIARLLQALNGS
FT                   DQRQAYFCAALCVAAPDGTILLEVEGRCDGLITAAPRGDQGFGYDPIFEVAGTGRTFAE
FT                   MPLAEKKQHGHRGKAFTLLEPRLRQLLQAS"
FT   gene            complement(235107..236570)
FT                   /locus_tag="Syncc9605_0228"
FT   CDS_pept        complement(235107..236570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0228"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34004"
FT                   /db_xref="GOA:Q3AN28"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34004.1"
FT                   /translation="MASAPLPLSPAPIKFGTDGWRGITGVDITVERLLPVAAAAAQELA
FT                   HRAPEGLSSRTVVIGYDRRFLAPELAEAIAAAVRGCELEPLLTDTAVPTPACSWAVVER
FT                   KALGALVITASHNPPEWLGLKIKGPFGGSVEGDFTAAVERRLAAGGITAPIKAQVPRFD
FT                   GRGEHLEGLRRKLDLNALVEGLKAINLKVIVDPMHGSAAGCVTELLGPEAAGVVEEIRS
FT                   ERDPLFGGHPPEPLAPYLGGLITAVKASTAAGTPAVGLVFDGDGDRIAAVDETGRFCST
FT                   QLLMPLLIDHLARARQLPGAVVKTVSGSDLMRLVAEAQGRKVLELAVGFKYIAAEMLAG
FT                   DVLIGGEESGGVGFGMHLPERDALFAAMLVLEALVEGKQPLGARLDALQQQHGGSSHYD
FT                   RLDLRLADMEARRRLETLLAQSTPSSVAGAEVLEVISTDGIKLRMGPNHWLMLRFSGTE
FT                   PLLRLYCEGPDASRVNEVLAWARQFAEAA"
FT   gene            236624..238099
FT                   /locus_tag="Syncc9605_0229"
FT   CDS_pept        236624..238099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34005"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34005.1"
FT                   /translation="MGDTPPADNALTDRLLRSWLRCRRKAWLDRHGNPAERRWTAHRNL
FT                   LLDDQQRCFVALLPRKPGHGIAACAAGAEAVVGLRLKGLGPSGEPLEAHPPLLRRVKGQ
FT                   SRWGDFAYQPVLARQGRRTTREHQLPLALMALLLEQIQQGDVPSMLVLGGGGRRLEQER
FT                   LHLSSGLRRQLSEGLRKLHADLERPVPPPLAADRRKCSLCSWRVACNAVAVEEGHLSEV
FT                   SGIGAKRREMLLELGIRGLSDLAAADPLQLAERLQRFGDQHGEVAASLVAQARAQRDGR
FT                   VERLSASAALPELQDCPGVLLYDIESDPDARHDFLHGFLVLPRTQSGDWDLASVAYHPI
FT                   LALAEHGEARCWLRLQRLLNRYRGWPILHYGETESLALRRMAERQGAAEAEVLQLRQRL
FT                   VDVHARVRHYWRLPLASYGLKAVAAWQGFQWSQAGVDGARALLWWRQWQGEGPDRRGNR
FT                   YGLRWIFDYNRDDCLATWAVAAWLLEQDQASGS"
FT   gene            complement(238081..238875)
FT                   /locus_tag="Syncc9605_0230"
FT   CDS_pept        complement(238081..238875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34006"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34006.1"
FT                   /translation="MSKLFWDAQVPWLRLNGSGARQFLQGQTSADLNALQSGDLLQTCW
FT                   LTATGRLRAVLELRFDAEGADVIVLAGEASAVHAGFDQVIFPADRVRLQPLAELRRLQW
FT                   LEPNAAAVWCDAEAELPEPWASGEAATVMALEQWRLQSGFPPGPGELNGETNPLELGLV
FT                   AQISTEKGCYLGQETMAKLIGQAGVKQQLRRWSCSSALSPTAKLTLEGERAGVITSALE
FT                   RDGTWLGLALVRRQCLASPTLEGPNGEQLQIRQPEAFQDPDA"
FT   gene            complement(238872..239444)
FT                   /locus_tag="Syncc9605_0231"
FT   CDS_pept        complement(238872..239444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0231"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34007"
FT                   /db_xref="GOA:Q3AN25"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34007.1"
FT                   /translation="MSESSSVPTEREQLLNRLATLAYRRGDFTLASGRKSEHYVNCKPV
FT                   SLSGSGLALISRAMLTHVEADARAVAGLTLGADPLVSGVAMAAADQSRELDALIVRKEA
FT                   KGHGTGAWLEGPLPAPGTLITVLEDVVTTGGSSLKAVRQLRDAGYKVTRVVTIVDREEG
FT                   GDAAMAADNLELISLYKLSEIAAFVPA"
FT   gene            239477..240001
FT                   /locus_tag="Syncc9605_0232"
FT   CDS_pept        239477..240001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0232"
FT                   /product="possible occludin/ELL family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34008.1"
FT                   /translation="MRIELFHSVLLRSFLGSSLLLLVGPSVLAGPLVCTTSVEAPPSGS
FT                   GSAPVEVTVCHPMETTSELINRCFYTWTSPMARGMDPLHQLTDVLGIAVGGIEGNRFMG
FT                   FGFPDQTLVWDGSALQNTTGALLEEQSPPLPTRTLDISSGFNGSLAATEVNESMPDAPM
FT                   ADHFPDATSLW"
FT   sig_peptide     239477..239566
FT                   /locus_tag="Syncc9605_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.991 at
FT                   residue 30"
FT   gene            240013..240085
FT                   /pseudo
FT                   /gene="tRNA-Pseudo2"
FT                   /locus_tag="Syncc9605_R0005"
FT   tRNA            240013..240085
FT                   /pseudo
FT                   /gene="tRNA-Pseudo2"
FT                   /locus_tag="Syncc9605_R0005"
FT                   /product="tRNA-OTHER"
FT   gene            240099..241382
FT                   /locus_tag="Syncc9605_0233"
FT   CDS_pept        240099..241382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34009"
FT                   /db_xref="GOA:Q3AN23"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34009.1"
FT                   /translation="MRLLLLAVLLALPAFFAAAEVALLRLRPSRVEVLVEEQQAGARSI
FT                   QRLQRRLRRALLVSQLGATLALVALGWAGRGLGGRLWSDGSVGVVWRDTALFLSIVLLA
FT                   TLVAGLLPKAWVLNRPESSALRLAPLLEAVMRCLAPLLNLLEALAGLLMRLLGLAPQWD
FT                   VLVPALSAGELETLVESGRVTGLFPDEKNILEGVFALRDTQVREVMVPRSGMVTLPATV
FT                   RFAEMMEAVHHTRHARFPVIGQSLDDVRGVLDLRQMAEPIARGELQADSLLEPYLQPAV
FT                   PVLETCTLAELLPMIRSGQPLLLVVDEHGGTEGLVTAADLTGEIVGDEDPGETDEPDLL
FT                   EDKDYPGAWLVAGDLEIFELNRQLNLDLPEADDHHTLAGFLLERLQHIPSAGEGLHFNG
FT                   LQFEITAMAGPRIERVRLVLPSSEEEFD"
FT   sig_peptide     240099..240158
FT                   /locus_tag="Syncc9605_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            241420..242427
FT                   /locus_tag="Syncc9605_0234"
FT   CDS_pept        241420..242427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0234"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34010"
FT                   /db_xref="GOA:Q3AN22"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34010.1"
FT                   /translation="MSPDPMVPVKVGVIGIGNMGWHHARVLSLLRDADLVGVADPDAER
FT                   GKLATEQFGCRWFADYYAMLSEVEAVCIAVPTVLHHPVGLACLRAGVHVLIEKPIAASQ
FT                   DEATALIEAASAAGCLLQVGHIERFNPAFRELTKVVANEEVVVLEARRHSPHSDRANDV
FT                   SVVLDLMIHDIDLVLELAKAPVVQLAAAGGRSAEGPIDYVNATLGFKNGVVASLMASKM
FT                   SHRKIRSLSAHCRSSLVETDFLNHTLHIHRRAHEWYSADHGELLYRNDGFIEEVSTTSI
FT                   EPLYAELEHFLQCVRGRETPAVDGLQASRALKLADLIEQAVEHPDTGAPLCAPI"
FT   gene            complement(242443..245619)
FT                   /locus_tag="Syncc9605_0235"
FT   CDS_pept        complement(242443..245619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0235"
FT                   /product="putative phosphorylase kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34011"
FT                   /db_xref="GOA:Q3AN21"
FT                   /db_xref="InterPro:IPR008734"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34011.1"
FT                   /translation="MVLKTTRMLKENQTKSLQRLDQSIQRVVLDRQDPISGLLPASTAH
FT                   TIHGNYGDAWVRDCVYSVQCVWGLALAHSRQQGQTSRRAWELEQRVVALMRGLLRSMMR
FT                   QAGKVERFKESLNPLDALHAKYDSTTGEPVVADDAWGHLQLDATSLFMLQLAQLTKGGC
FT                   AVVQSRDEVDFLQNLVHYIARAYRTPDYGIWERGDKGNHGLPERNASSIGMAKAALEAL
FT                   DGLDLYGPHGDGSCVLLIPQGAIVRLRRALEGLLPRESASKEADSACLSVIGYPAWAVE
FT                   DAALVERTGRRIRRELGGAYGYKRFLRDGHQTAVEDVTRLHYEPEELAVFEGIESEWPL
FT                   FLAFELVTTCCEENWDKARRLHSQLKTLAVEQDGERLYPELYQVPASAIEQERMNPGSQ
FT                   KRVANTNLPLIWTQSLVWLGEMLLDDLICPEDIDPCGRREPEPLGAKKILVAMAPESDA
FT                   VRQELLAAEVPIDPTSVISVQSSDELKQRLKAAGTNPRLELTGRPGHRVETEDAARVYR
FT                   QGGVIRVFTPSVLEDVSSYLADDPEELLETVIDELHLLQRHWCGVGCPLLVIPIRDAAL
FT                   QQHRDVILKMARQLSSGVIESIPVHLGCLSKLVDQAQEVQLPALEEKPVPTTEPPQPLL
FT                   RDATDLRDLTAAEEQELDDTPIEQLSQRLWSSELLHEQAEVLELLQRRLGRQEIQHSPE
FT                   SHPVALRNLLEEVYQRGLRCEDWNVVRRCAGAMGMVHPQLEDALTDLLVRQKQVVVGRN
FT                   YTGDSRLRQPMDSAAIAERIETTSGIDGRERMLEQELLLALDSVARREPALLKGSLTLQ
FT                   LGQLMLLLTSELAVEKMLSQDEAFEALCSEAPHAIRKRLHGVLSDVDHARAALQRGEQL
FT                   HVSGRVQWSVPDPLEETPGGGDWLQHRIRLGSFQKVPRDFYAGIWSLLQHCRGLVIGDK
FT                   LERRNRLNSSLILEKTPGERNFAAQVDHLLSRIKAPEYRQLCSECLLSLMAFVEANPEV
FT                   RFEDDLALDVVIGHAVRVGWQQSHPSLRPENYPQHKAQAWGQFYRSSPGDCRRWQVTAL
FT                   RELAEQQGLV"
FT   gene            245667..246401
FT                   /locus_tag="Syncc9605_0236"
FT   CDS_pept        245667..246401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0236"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34012"
FT                   /db_xref="GOA:Q3AN20"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34012.1"
FT                   /translation="MDFVSTAPDDRRRCQVLGVPVDACRDVCAAALGLHARGGGRIVTL
FT                   NAEMTMSARADTALGQAIRTADLVIPDGAGVVWALGRQQIRVVKTAGIELAWTLLEYAA
FT                   AHQWRVALVGATPEVMETMRAELPQRIRGLYLALAVDGYQAPEAWPGLEDQLKALKPDL
FT                   VLVALGVPRQETWAERVAAGQPGLWMGVGGSFDVWAGTKKRAPAWMCRMQLEWLYRLIQ
FT                   EPSRWLRMLSLPAFALKVIRLG"
FT   gene            complement(246406..246558)
FT                   /locus_tag="Syncc9605_0237"
FT   CDS_pept        complement(246406..246558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0237"
FT                   /product="photosystem II 4 Kda protein psbK precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34013"
FT                   /db_xref="GOA:Q3AN19"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34013.1"
FT                   /translation="MQGMAAFTLDLLAQLPEAYQAFSPLIDILPLIPVFFLLLAFVWQA
FT                   SVGFR"
FT   gene            complement(246581..247699)
FT                   /locus_tag="Syncc9605_0238"
FT   CDS_pept        complement(246581..247699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0238"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34014"
FT                   /db_xref="GOA:Q3AN18"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34014.1"
FT                   /translation="MFGFEINAHCANTSARCGTFETPHGPVNTPRFMPVGTLATVKGIS
FT                   TEQLGRTGAQMVLSNTYHLHLQPGEEIVAAAGGLHRFMGWNGPMLTDSGGFQVFSLGDL
FT                   NKIDDRGVVFRNPRDGRTIDMTPEHATQIQMALGADVAMAFDQCPPYPATENDVIDACR
FT                   RTHAWLERCVTAHTREDQALFGIVQGGCFPHLRRESAMAVASFDLPGTAVGGVSVGEPA
FT                   EEMHRIVRDVTPLLPSHKPRYLMGIGTLREMAIAVANGIDLFDCVLPTRLGRHGTVLVG
FT                   GERWNLRNARFRHDHTPLDPSCSCVACTGHTRAYLHHLIRSEELLGLTLLSIHNITQLV
FT                   RFTSAMAQAIRDGCFSEDFAPWEPDSPAHHTW"
FT   gene            247729..248499
FT                   /locus_tag="Syncc9605_0239"
FT   CDS_pept        247729..248499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0239"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34015"
FT                   /db_xref="GOA:Q3AN17"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34015.1"
FT                   /translation="MRADCIHRAISRIVLPWLSDLAGAWIFYTVLPPWPWPQPSFQRIA
FT                   RFAPWMGLLIGALQGLLWIGLSRLAWPPAACALCVVALGIQLSGGLHHDGLIDTADGLG
FT                   APAERRLEAMEDSRVGASGVLALVIVLLLQVAALIQLGGQAPLGLCLAAFWARVAPLWA
FT                   MARFNYLRADGTAAFHRDNGRPLWDALPSLLVVVALAGWVRPLPLLLGGVVAILVAQSL
FT                   GRRLGGHTGDSYGAVLVLTEMITLLGLALLLPAS"
FT   gene            complement(248459..249580)
FT                   /locus_tag="Syncc9605_0240"
FT   CDS_pept        complement(248459..249580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0240"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34016"
FT                   /db_xref="GOA:Q3AN16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34016.1"
FT                   /translation="MQLTDRFFDFTDQQLVDLTAKEGIQHLGLYVSAPPNQQGPPLLLI
FT                   RQWSANERSLPPADADPNLRLPHESRRWYPLQDAGLILGALRADLDPQRSWTQTLDQRM
FT                   RRSAAAISHALGRDLECLQLRQELNQQNDQLRTLVHQLRNPLAALRTYAQLLLRRLEAD
FT                   SSHRPLVEGMLSEQRQLGQYIDVLEGLGQQRLPQQEPLGPTLLPPGPAEGEATMQTLLM
FT                   PLLERAEATASLQGRPWRGPDLWPQWIDQPSQDGTIAEIVANLLENAFRYSPAGCSVGL
FT                   CLLPDGLCVWDNGPPIPLEERELIFERGARGSTGHDRAGTGLGLALARSLAEQQGRKLT
FT                   LCVEPSTIAPDLPAQGNAFVLSWPAEAKPDPTT"
FT   gene            249918..250286
FT                   /locus_tag="Syncc9605_0241"
FT   CDS_pept        249918..250286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34017"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34017.1"
FT                   /translation="MSKKRKRISRRRLAGQRVLAHVPTHHLETGEYKPVTAARRYIAEG
FT                   GLVPPALLNVRRNEHTTDRFFWGEKGLFSAQYAEENHFLFPSLRTIVDSIGEDKLFEGL
FT                   ELGADDWEEMEEYEYAFV"
FT   gene            complement(250287..250859)
FT                   /locus_tag="Syncc9605_0242"
FT   CDS_pept        complement(250287..250859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0242"
FT                   /product="probable esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34018"
FT                   /db_xref="GOA:Q3AN14"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34018.1"
FT                   /translation="MDGRLVLLHGWGANGEDLKPLSDRLARECSKTLDVVCLEAPELHP
FT                   YQPGGRQWYGLFPAQWDAVPAAVERLKAQLQSLSRSGLGLERTVVFGFSQGGAMALEGG
FT                   CALPIAGVISCSGYPHPNWAPRQQHPPVLLMHGSDDPVVPFQAMQLIAAQLQPNQCQTL
FT                   QFKNGHTIPDETVKPILMFIERVLENA"
FT   gene            250916..252478
FT                   /locus_tag="Syncc9605_0243"
FT   CDS_pept        250916..252478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0243"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34019"
FT                   /db_xref="GOA:Q3AN13"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34019.1"
FT                   /translation="MAPVALLSVSDKSGLVPLAEALHRTHGYQLLSSGGTAKVLEQAGL
FT                   PVTRVSDHTGAPEILGGRVKTLHPRVHGGILAKRGDASHQADLEQQNIAPIDMVVVNLY
FT                   PFRETIARPDVTWDQAIENIDIGGPAMVRAAAKNHADVAVLTSPDQYDRLLTAMAESGG
FT                   SVPSALRRQLALEAFNHTASYDTAIGRWMAEQATAKGCPWLEAVPLRQTLRYGENPHQK
FT                   ARWFSHPKQGWGGAIQLQGKELSTNNLLDLEAALATVREFGYGADGSAPASQPAAVVVK
FT                   HTNPCGVAVGASMPAALTRALDADRVSAFGGIIAMNDVVEATAARELTSLFLECVVAPG
FT                   FTPEAREVLAAKANLRLLELAPQAIDVAGPDHVRSILGGLLVQDLDDQAITPTDWTVAS
FT                   QRPPTPQEKLDLEFAWRLVRHVRSNAIVVAKDGQSLGVGAGQMNRVGSARIALEAAGEK
FT                   AQGAVLASDGFFPFDDTVRLAASQGITAVIHPGGSMRDGDSIKACDELGLAMQLTGRRH
FT                   FLH"
FT   gene            252533..252991
FT                   /locus_tag="Syncc9605_0244"
FT   CDS_pept        252533..252991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34020"
FT                   /db_xref="GOA:Q3AN12"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34020.1"
FT                   /translation="MLATLPFSLNFAHPLAEWGLLAVGGWALYLGIKAKKTRTGTPEQR
FT                   KELVPKKFAQRHYLWGSILLAVMTLGTLGGMAVTYLNNGKLFVGPHLLVGLAMTGMIAV
FT                   AASLSPLMQRGNVIARKAHVGLNMGMLTLFLWQAVSGMEIVNKIWANR"
FT   gene            complement(252999..253598)
FT                   /locus_tag="Syncc9605_0245"
FT   CDS_pept        complement(252999..253598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34021"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34021.1"
FT                   /translation="MSSTETDNQLHGADPQVRCYSSLFEDSMQMLAPQAVVARYLDDHQ
FT                   SWFERCASPMQVEAIDQQSYSLTLGKFGNFGFEVEPTIALRLLPQQEGIYRIETVRTVP
FT                   QSLGLRHHYDVDFRAGMHLVPEQEQTSVQWDLDLKVWIRLPKVITMLPDQLVQSSGDHL
FT                   LKQIVRQISRRLTWKVQEDFHAAHGLSCPPRQRAAF"
FT   gene            complement(253668..254867)
FT                   /locus_tag="Syncc9605_0246"
FT   CDS_pept        complement(253668..254867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0246"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34022"
FT                   /db_xref="GOA:Q3AN10"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34022.1"
FT                   /translation="MDTHAFKRSLHHSERYNRRGFGRAEEVAESLEQAYQSGLIGTIRD
FT                   NGYRLEHGRLNVRLAEAFGFCWGVERAVAMAYETRKHYPSERLWITNEIIHNPSVNDHL
FT                   REMDVQFIPVEQGVKDFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKV
FT                   WNTVEKHKKHTFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEAQYVADYILGNGDRED
FT                   FIKRFAKACSPGFDPDRDLERLGVANQTTMLKSETEEIGRLFERTMLSKYGPTQLNDHF
FT                   LAFNTICDATQERQDAMFSLVDEPLDLMVVIGGFNSSNTTHLQEIAVSRGIRSFHIDTP
FT                   ERIDVGSNSIEHKPLAADLCREGDFLPEGPVRVGITSGASTPDRAVEEVIEKLMQLSEN
FT                   "
FT   gene            complement(254978..256450)
FT                   /locus_tag="Syncc9605_0247"
FT   CDS_pept        complement(254978..256450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0247"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34023"
FT                   /db_xref="GOA:Q3AN09"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34023.1"
FT                   /translation="MTTAFHAPPQKRRKTLQEASLLEGPMLLLKSIRGFSSNRAMTWLA
FT                   CAPLALMGLGIFTLSAKAEELPELSAAFLANNLWLLVATILVIFMNAGFAMVEAGMCRQ
FT                   KNAVNILAKNLFVFALAVTAYWFVGYSLMYGDSVIDGWLYFGGLFFDPTVTAETISDAG
FT                   LVPTVDFLFQAAFAGTAATIVSGLVAERIKFGEFVIFALVLTAFIYPVAGSWEWNGGWL
FT                   NSVGSVEFIDFAGSSIVHSVGAWAGLVGAMLLGPRIGKYVDGKVQAIPGHNMSIATLGA
FT                   LILWIGWYGFNPGSQLAMDQWVPYVAVTTTLGAAGGAIGATVISTMTSKKPDLTMIING
FT                   ILAGLVSVTAGCGNLTLTGSWVAGVVGGIIVVFSVAALDASGIDDPVGAFSVHGVCGVW
FT                   GTIVIGLWGYDVQGDGSGLGLLVGGGVEQLGIQALGAAAYAIWTVVTCFIAWSIIGSLF
FT                   GGIRVTEQEESEGLDIGEHGMEAYAGFSTTNN"
FT   sig_peptide     complement(256259..256450)
FT                   /locus_tag="Syncc9605_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.955 at
FT                   residue 64"
FT   gene            complement(256553..257317)
FT                   /locus_tag="Syncc9605_0248"
FT   CDS_pept        complement(256553..257317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0248"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34024"
FT                   /db_xref="GOA:Q3AN08"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34024.1"
FT                   /translation="MTGLSSPGDALLRFEPLTEGVLLKRYKRFLADVELSSGETVTAHC
FT                   ANTGPMTGVLIPGQRVRLRYAPSPKRKLAWTWEQAEVPGADGQHCWVGINTALPNRLIR
FT                   ATVEAGCLEAQLGAIARIRAEVAYGTNKRSRIDLLLTPAEQNPDQRPIYLEVKNTTWTD
FT                   GSTALFPDTVTERGQKHLIELMGVLPDARAVLVPCLSRPDVTAFAPGDSADPRYGELFR
FT                   QATNSGVEVLPCCFSFSADAVHWQGTRLVDLG"
FT   gene            257386..258993
FT                   /locus_tag="Syncc9605_0249"
FT   CDS_pept        257386..258993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0249"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34025"
FT                   /db_xref="GOA:Q3AN07"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34025.1"
FT                   /translation="MARSLKGIALVVTLGTLLSKVGGLIRQLVIAAAFGVGAAYDAYNY
FT                   AYVLPGFLLILLGGINGPFHSAMVSVLSRRPRAEGAHILAALNTSVSALLLMVTIVLVL
FT                   AADPLITLVGPGLAPELHAIARLQLQVMAPMALLAGLIGLGFGSLNAADEFWIPAISPL
FT                   MSSGALIIGVGLLWWQLGADIALPSAAMAGGVVLALATLVGALLQWLIQLPALIRQGLA
FT                   RFQLVWDWRHPGVREVWRVMGPATLSSGMLQINVFTDLFFASGILGAAAGLGYANLLVQ
FT                   TPLGLISNALLVPLLPTFARLTAPEDRPQLIDRIRQGLMLSAASMIPLGGLFIALGGPI
FT                   VALVYERGAFDASAAQLVTGLLMAYGLGMPAYLGRDVLVRVFYALGDGTTPFRLSLAGI
FT                   GLNVIFDWLLVGGPTPWGNQSPFNFGAPGLVLATVAINLLTCFALMLGLQQRISGLPLR
FT                   RWGMDLLRLAIAGVLAAGGAGIIVTFVSWPAGLLGLLFQVGAPGLLGLALFALIGAQLQ
FT                   VPEVREITQLVMGRFRAR"
FT   gene            complement(258980..259243)
FT                   /locus_tag="Syncc9605_0250"
FT   CDS_pept        complement(258980..259243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34026.1"
FT                   /translation="MLIIEVTNSRELVRQRIGRLGERLIGRVVDAEAQVEKALIQELET
FT                   AFKEFGIEARIVSVQGPQLVGREQLELPIQVREELDVRLSEP"
FT   gene            complement(259271..259561)
FT                   /locus_tag="Syncc9605_0251"
FT   CDS_pept        complement(259271..259561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34027"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34027.1"
FT                   /translation="MSLSASDLQDLQSALADRLYVQISGWHLYLGDADLASALAIECSA
FT                   RVNQGAEVAARQALDAVKVPLAGGASQLPLSKLIPPAQLRDLEEILEPYCG"
FT   gene            complement(259604..259849)
FT                   /locus_tag="Syncc9605_0252"
FT   CDS_pept        complement(259604..259849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34028"
FT                   /db_xref="GOA:Q3AN04"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34028.1"
FT                   /translation="MPIRWYGPADPEDPTYRHFERIVNLCLHGGVFAAVNSGGWFLQEM
FT                   RHPFPGGSLTWITSLWATLWLGQLIWVILQRPKPEE"
FT   gene            259938..260011
FT                   /gene="tRNA-Arg3"
FT                   /locus_tag="Syncc9605_R0006"
FT   tRNA            259938..260011
FT                   /gene="tRNA-Arg3"
FT                   /locus_tag="Syncc9605_R0006"
FT                   /product="tRNA-Arg"
FT   gene            260108..261403
FT                   /locus_tag="Syncc9605_0253"
FT   CDS_pept        260108..261403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0253"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34029"
FT                   /db_xref="GOA:Q3AN03"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34029.1"
FT                   /translation="MSQASGRAIDADLAQSDPDIAAFINQERQRQETHLELIASENFAS
FT                   RAVMQAQGSVLTNKYAEGLPSKRYYGGCEHVDAIEELAIERAKQLFGAAWANVQPHSGA
FT                   QANFAVFLALLQPGDTIMGLDLSHGGHLTHGSPVNVSGKWFNVVQYGVDKETQRLDMEA
FT                   IRQLALEHKPKLIVCGYSAYPRTIDFAAFRAIADEVGAYLLADMAHIAGLVAAGVHPSP
FT                   VPHCDVVTTTTHKTLRGPRGGLILCRDAEFAKKFDKAVFPGSQGGPLEHVIAAKAVAFG
FT                   EALQPSFKAYSQQVVANAAALAEQLIARGIDVVSGGTDNHVVLLDLRSIGMTGKVADLL
FT                   VSDVHITANKNTVPFDPESPFVTSGLRFGTAALTTRGFDSQAFREVADVIADRLFNPED
FT                   DAIRQRCLDRVGALCERFPLYADSKHKQPVLV"
FT   gene            261518..262660
FT                   /locus_tag="Syncc9605_0254"
FT   CDS_pept        261518..262660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0254"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34030"
FT                   /db_xref="GOA:Q3AN02"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AN02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34030.1"
FT                   /translation="MNLLASPIAVASVSFLLAAVTTTVLVPQVRRLGLRFGWTDLPDER
FT                   KQHVTPMVRLGGIAMVLGFGTALTAVWSMGGFGLLAPAKDQLIWSTLAGSLCFFLIGLA
FT                   DDLFALSPWPRLAGQIAVACSVWSQGVRIGAIDLPWFTAAAGPIALPDTLSLLATVVWL
FT                   VGITNAINWLDGLDGLAAGVAGIAAVGLVSVSFSLHQVAAGFLAAALAGCCLGFLRHNF
FT                   NPARIFMGDGGSYFLGFTLAAVSIVGPAKGLTTVSLLLPLLILSLPLADMSAVIMGRLR
FT                   EGRSPFYPDRRHLHHRLLRAGFSHRRTVLLIYVFTQWLAALALVVANAEMRFLWLALAT
FT                   AILVATVVISRRQLQHERALMNTNPCSTPVDPAALGEPRG"
FT   sig_peptide     261518..261574
FT                   /locus_tag="Syncc9605_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.529 at
FT                   residue 19"
FT   gene            262653..263912
FT                   /locus_tag="Syncc9605_0255"
FT   CDS_pept        262653..263912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0255"
FT                   /product="Competence-damaged protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34031"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34031.1"
FT                   /translation="MAESGVEILCVGTELLLGDILNGNSRWIAEQLAGLGLPHYRQTVV
FT                   GDNKERLISAVREARQRCRVLVTTGGLGPTPDDLTTEALAAAFDTPLEERPELWLEIQQ
FT                   KLSAGGRPVAPSNRSQAFLPRGAEVLPNPKGSAPGMIWSPRPDFTILTFPGVPSEMRAM
FT                   WTETAAPWLQANAGTSGVFVSRQLRFSGIGESDLAERVADLLASTNPTVAPYASLGDVK
FT                   LRLTACAPTADAAAELLLPVEAELRRRTGNHCYGVDADSLASVVIDLLKQRHQTMAVAE
FT                   SCTGGGLAAALTAVPGSSSVFQGGVVAYSNAVKQALLGVSLDLLTAHGAVSQPVVEAMA
FT                   RAARERLNCDWAIAVSGIAGPGGGSAEKPVGLVHLALAGPGGCEAWVQHFGERRGREAI
FT                   QRMSVIRGLDRLRLCLLAQV"
FT   gene            263939..265357
FT                   /locus_tag="Syncc9605_0256"
FT   CDS_pept        263939..265357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0256"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34032"
FT                   /db_xref="GOA:Q3AN00"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AN00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34032.1"
FT                   /translation="MSSGTLYDKVWDLHRVAELPGGSTQLFVGLHLIHEVTSPQAFSAL
FT                   KDKGLLVRCPERTVATVDHIVPTTSQQRPFADPLAEEMLSTLERNCQEYGIPLNNIGSG
FT                   RQGIVHVIAPELGLTQPGMTVACGDSHTSTHGAFGAIAFGIGTSQVRDVLASQSLAMNK
FT                   LKVRRIQVNGLLPEGVSAKDLILHVIRHLGVKGGVGYAYEFAGSAIEALSMEERMTLCN
FT                   MAIEGGARCGYVNPDQVTFEYLKGRPHAPEGDAWTRAVAWWSSLATDANATVDDEVVFD
FT                   AAAIPPTVTWGITPGQGLGIDETVPSLDQLDPGERPIAEEAYRYMDLQPGTAIAGVPVD
FT                   VCFIGSCTNGRLSDLRAAADVARGRQVAEGIKAFVVPGSEQVAKAAEAEGLDAVFRAAG
FT                   FEWREPGCSMCLAMNPDRLEGRQISASSSNRNFKGRQGSASGRTLLMSPAMVAAAAVNG
FT                   RVTDVRTLISPSAS"
FT   gene            265357..265971
FT                   /locus_tag="Syncc9605_0257"
FT   CDS_pept        265357..265971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0257"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34033"
FT                   /db_xref="GOA:Q3AMZ9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34033.1"
FT                   /translation="MAHFPTGPIQQVSGTAIVVSGEDIDTDRIIPARFLKCVSFEALGD
FT                   QVFADDRLELSGEHPFDQARYQGASILVVNGNFGCGSSREHAPQALMRWGIRAVVGVSF
FT                   AEIFYGNCLALGIPCATAAPEQIKAIQAQVDGDPGRSWSLDLASLQLTAADTSWPMSID
FT                   PGPLDMLRSGRWDATSQLLDHGPQVAELMQKLPYINQFAAG"
FT   gene            266023..266466
FT                   /locus_tag="Syncc9605_0258"
FT   CDS_pept        266023..266466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34034"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34034.1"
FT                   /translation="MACSLSRLVLPFVPLLVVAGVGPAGALPLQVQAHDPLDRSCPGCD
FT                   LRQADFRQAHLIGADFRGSDLRGADLREANLEGADLTGALLEGADLRGANLTNAELSGV
FT                   DLRNADLREAHVINAYAPNVRTSGMRYAGASLFGSNLIIGGGD"
FT   sig_peptide     266023..266124
FT                   /locus_tag="Syncc9605_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.756 at
FT                   residue 34"
FT   gene            complement(266467..269253)
FT                   /locus_tag="Syncc9605_0259"
FT   CDS_pept        complement(266467..269253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34035"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34035.1"
FT                   /translation="MLLVTAGSAESTPETVSPAPARLNIRADLQYTDTKSKATIAEGNV
FT                   SVQLGQAELHADRIEFDAAYRTLYARGAVRFRRGKQFFQASSFRYNLVQNEGQLNDVYG
FT                   VIDLEEPLTNPLTSSRTTSAPPEPATSASREDMPPVACPPLLPPVPDWHPQPWAVTAWG
FT                   GQMIDAAFGDTFLFNGRMRPEAVLGVGVQKRIMRAGPFAIELEADLFSHIAKQQQGGEF
FT                   NQSKPYADLPAQNFGEGVLGIGARVWVQPWLSFSVIEGISYNSNVSLYEKTFRENYTQL
FT                   LNYLGFEVEAAVSSDLSLVGRIHHRSGAFGTYGGVTEGSNAYLLGLRYRWGRDTPKQAS
FT                   DVMPPMLECDDPDRGQRFKPSSLSERLDSIALGDGGSPQRHVSSDNTAEQPTIPPAQQQ
FT                   AMRTEAIARINQRISDVDLQGSFSIERRSGIPVQRLNSSVRDENRFGVVKVPQLKSLGS
FT                   TNFLNGTISRWRVQASKILITADGWEADRMGFSNDPFTPAQTRIDAEDVIAREQANGDV
FT                   LISARRNRLIVEERLPIPVTRRQLIQKEEEVENRFVVGIDNRDRDGLFVGRNLKPLTIG
FT                   TSTELSVQPQFMVQRAIDGDFNSAADLFGLDAKLRGRYGNYKLNGDADISSFDPADILS
FT                   SSRYWGSFGQDIDMGSLGVLSTNLFGAYRYRTWNGSLGETDINAAYGVYAQTKGSWSTG
FT                   EVDHDYLIRGAIGDYDADRFNSNRRLRSGRGSLFASVTSKIPLLKGKTAELIPTAAYRY
FT                   SPVPIVPGLSLNTNVNTSIAVYGDGLHQETLSLSGGPTITLGTFSKPFLDFTQISIVGN
FT                   GSLKNGDSPFAFDRNVDLATLGVGLTQQIVGPVVLSTGVSYNVDPGSKFYGSTVNSNIE
FT                   LRWQRRSYDVGVYFNPYKGIGGVRFRLNDFDFKGTGVPFVPYTPTNWMETTDSDRPF"
FT   gene            complement(269408..269527)
FT                   /locus_tag="Syncc9605_0260"
FT   CDS_pept        complement(269408..269527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0260"
FT                   /product="photosystem II reaction center I protein (PsbI)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34036"
FT                   /db_xref="GOA:Q3AMZ6"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34036.1"
FT                   /translation="MLALKISVYSVVFFFLGIFVFGFLASDPSRTPSRKDLED"
FT   gene            269565..272531
FT                   /locus_tag="Syncc9605_0261"
FT   CDS_pept        269565..272531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0261"
FT                   /product="possible alpha mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34037"
FT                   /db_xref="GOA:Q3AMZ5"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34037.1"
FT                   /translation="MGHDSVSRGMNPDQVGRSEWIETFRSRSRRDLRGRWLRSGAAQAG
FT                   FFLDESWGFTHRPDWAKRGLLIWPRGRQWLRLEQRLSWPDGWSTSDSCCARLVLSWWAE
FT                   QMRLWVDGVLVHEGDLFDTACRWPLPARCRQGASLDLVLELCSPLHDDGALISSHLDLE
FT                   PQFAGPDPEGTLLPAALELHLAADGDLPSHWADLDPSGVEAQDAVATHLHQVNPPRGSL
FT                   HWLGHAHLDLAWLWPVADTWQAAERTFRSALDLMRRWPELRFAHSTPALYAWMEQHRPA
FT                   LFAEIQAASRAGRWEPINGPWVETDCVLVSTASLWNQFALGQKDSLRRFPEWTHELAWL
FT                   PDSFGFAAGLPAVAAATGVRWFCTHKLAWNAENPFPHRLFRWRGRGRSELRSLMLPPIG
FT                   RRADPVEMQGEQRAWHQATGLEAALWIPGVGDHGGGPTEELLEQIGLWEKQAAAVPTRA
FT                   GTVREFLANLEQDDQAWAVWRDELFLELHRGCATSRPDQKRHNRTLERLLREADAASAL
FT                   LALAGRDGGGSDWRPLLFQQFHDILPGTSIPEVFEQAEPVWRSARRQARGERDRRLARL
FT                   TRQKDTAAAWSWWGLQPLASWSPLVRLPAGSWSSEGVSLPQQAAAGGGAWVQLPRQHGS
FT                   CSVPLRREPGMASCAAQPRQPVVITSLGAGVWRLVNGLIDLDVSAVGLMALRDRDGRNQ
FT                   LSSPLQLERYRDCGEFWDAWDLAADYRSQPLGVLGTDSLEWLDQGPLVAHLVLRRQLGA
FT                   SCMRLDLRLKADTAWLELICSINWCQTHELLRLDLPLATPAVRIAADTSGGVIERPAEP
FT                   MTVRERARWEVPVISWFASQSQAPGGGMAVLLDGPQGVDWSSDRLGISLLRGPTWPDPS
FT                   ADQGWHRQRLALMPFSGSWSEAGVPQAAIAFREPGWCAALPAELRQWFPSLPLQLTPVA
FT                   LERHANVCLLKLLNAGSARCRWTPGADWSVRRDVDSSAADAVVIAPGELVSLVVDQSS"
FT   gene            complement(272519..272659)
FT                   /locus_tag="Syncc9605_0262"
FT   CDS_pept        complement(272519..272659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0262"
FT                   /product="photosystem II reaction centre N protein (psbN)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34038"
FT                   /db_xref="GOA:Q3AMZ4"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34038.1"
FT                   /translation="METSSPALSVAIGVLAVLFGLTGFGVYQAFGPPSKALDDPFDDHE
FT                   D"
FT   sig_peptide     complement(272570..272659)
FT                   /locus_tag="Syncc9605_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.618 at
FT                   residue 30"
FT   gene            272744..272944
FT                   /locus_tag="Syncc9605_0263"
FT   CDS_pept        272744..272944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0263"
FT                   /product="photosystem II 10 kDa phosphoprotein (PsbH)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34039"
FT                   /db_xref="GOA:Q3AMZ3"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34039.1"
FT                   /translation="MAQRTRLGDLLRPLNSEYGKVVPGWGTTPVMGIFMVLFLVFLLVI
FT                   LQLYNKSLILEGINVNWNGLG"
FT   gene            272954..273184
FT                   /locus_tag="Syncc9605_0264"
FT   CDS_pept        272954..273184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0264"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34040"
FT                   /db_xref="GOA:Q3AMZ2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34040.1"
FT                   /translation="MNIFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSAS
FT                   KEFEREINKAMADPEMSGDAAKPVEELPPSD"
FT   gene            273199..273816
FT                   /locus_tag="Syncc9605_0265"
FT   CDS_pept        273199..273816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0265"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34041"
FT                   /db_xref="GOA:Q3AMZ1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34041.1"
FT                   /translation="MATDLKLVVGLGNPGAKYAGTRHNIGFMALELLGERSGFSFRQQA
FT                   KLHGLAADTGVGEQRLRLLMPQTYMNDSGRAIRAALDWFGLEPHQLLVLVDDMDLPLGR
FT                   LRLRAQGSAGGHNGLRSTIQHLGTQAFPRLRIGIGAPAENPAERRVRTVSHVLGPFSKV
FT                   EQPCVGAVLDAVLDGIQRLQRQSFERAGTWINGFRYDLEPVD"
FT   gene            273816..274073
FT                   /locus_tag="Syncc9605_0266"
FT   CDS_pept        273816..274073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34042"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34042.1"
FT                   /translation="MPALPATTAHLRVLRQCFQAKCVEGEVSAGGFEWQFSWAFDRGEL
FT                   VVEPSLGRALIEDALRRFLVRSDYRLEPGGDYTFMVRARF"
FT   gene            complement(274051..274497)
FT                   /locus_tag="Syncc9605_0267"
FT   CDS_pept        complement(274051..274497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34043"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34043.1"
FT                   /translation="MKRVAVLDPGRCKCGLVLADLQLGLVREGYVLAPEAVEPWLEQWN
FT                   QDQALDRILIGDGTGSRAWIKRLERLCHLTLVPEQGTTLRARQRYWTLWPARGWRRMLP
FT                   AGLRIPPVDLDAVAALVMLEEHLQCSLRWPEPAPTFSLRTWPEP"
FT   gene            complement(274494..275645)
FT                   /locus_tag="Syncc9605_0268"
FT   CDS_pept        complement(274494..275645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34044"
FT                   /db_xref="GOA:Q3AMY8"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34044.1"
FT                   /translation="MSGWALILVLLVLGGVLSTLGDRLGSRVGKARLSLFKMRPRRTAV
FT                   LITVLTGSLISALSLGLMLLVSRQLRVGLFELDALQEKLQDSRRQLKAAERERDKTQTE
FT                   TRRIAIELKQAQQRANTLRLELAPLQNERAQLEAERERLSQDIASRDADIQRTEAELNS
FT                   VRSRIRAGEQELKQLERNLVALRRGSVVISSGQTLARATVRLEAPDQAKQAVDRLLQEA
FT                   NLNAYGKVRPGEAPERQLIRVPRSDVERLQNIIRKPETWVISLRSATNVLRGETAVYAF
FT                   PEARPNRPVAQRGDVLATTTLQPNDRTPEGIRTRLNLLLASAYAEVQRRGSLTEGLQFD
FT                   GSALSQLAQTLMEGPSQSVVLEVISAGVSDSADPVVVTIQASL"
FT   sig_peptide     complement(275580..275645)
FT                   /locus_tag="Syncc9605_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.717) with cleavage site probability 0.603 at
FT                   residue 22"
FT   gene            complement(275673..276389)
FT                   /locus_tag="Syncc9605_0269"
FT   CDS_pept        complement(275673..276389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0269"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34045"
FT                   /db_xref="GOA:Q3AMY7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34045.1"
FT                   /translation="MTSSRGFSRYAPQMVAPSPSAEPANRSLLEIIRDLDGASSELVDR
FT                   NKTIFFPGDPAERVYLIRRGAVRLSRVYESGEEITVALLRENSLFGVLSLLTGQRSDRF
FT                   YHAVAFTRVEMVTAPATSVKAAIEADTSVGLRLLQGLSSRILQTETMIETLTHRDMSSR
FT                   LVSFLLVLCRDFGVADELGITIDLRLSHQAIAEAIGSTRVTITRLLGDLRQSGLVQIDR
FT                   KKITVLDPIALAKRFS"
FT   gene            complement(276448..277191)
FT                   /locus_tag="Syncc9605_0270"
FT   CDS_pept        complement(276448..277191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0270"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34046"
FT                   /db_xref="GOA:Q3AMY6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34046.1"
FT                   /translation="MSQSPEHRTDGRRPEQLRPFSVTWNPMGFALSSLVVHTGRTAVLC
FT                   SVCLEGKVPRWRKGEGLGWLSAEYRLLPGSTPQRQSRELMKLSGRTQEIQRLIGRSLRA
FT                   VIDMERLGERTLLIDCDVIQADAGTRTASITGAWLALDQACRSLVEQGVLEQSPLVDQV
FT                   AAVSVGLVDGQALLDLDYSEDSRAEVDLNVVQAGDGRLLEIQGTAEGAPFSRSQLNELL
FT                   DLAEPGLSSLMQAQRQAFTEHSSVT"
FT   gene            277337..277936
FT                   /locus_tag="Syncc9605_0271"
FT   CDS_pept        277337..277936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0271"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34047"
FT                   /db_xref="GOA:Q3AMY5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34047.1"
FT                   /translation="MTTSLANPQAFQNSLDQDQQALQRAGLRPVAPVSDSPPLHLVAPE
FT                   GQLQVHTAPYRGSFASVLSQAMRAAGLGSRVLISQFLKGGVQQGPAGRVQLCGGLVWLR
FT                   PEVPLCLSSPGHPGGAEAVAAVWSICRQHLIQGDLDQLVLDEIGLAVAFGYLDEADVIA
FT                   ALEQRPASMDVIITGPAIPAGVMEMADQVTELRRGF"
FT   gene            277936..278529
FT                   /locus_tag="Syncc9605_0272"
FT   CDS_pept        277936..278529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0272"
FT                   /product="Deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34048"
FT                   /db_xref="GOA:Q3AMY4"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34048.1"
FT                   /translation="MLKCDRWITEQAGQGMIEPFQSGLVRHLDPEQKLRPVLSFGCSSY
FT                   GYDLRLSPQEFLIFRHVPGTVMNPKRFNPANLEPTPLHEDEDGRYFILPAHSYGLGVAL
FT                   EKLRVPPNITVICLGKSTYARLGIIVNTTPAEASWEGHLTLEFSNSSGADCRIYADEGI
FT                   CQLLFFEGDPCSTTYSDRQGKYQHQPERVTLAKV"
FT   gene            complement(278537..279292)
FT                   /locus_tag="Syncc9605_0273"
FT   CDS_pept        complement(278537..279292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0273"
FT                   /product="Thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34049"
FT                   /db_xref="GOA:Q3AMY3"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34049.1"
FT                   /translation="MITTTRHSDAPMDRFRVDLIAATPNPQQCVYAAMHQDYSEGFVAA
FT                   DRANWPDEQRAGEICVKRLLSGERGHYGPMEHAQIVLNVGCFPHSVMQQARTHRVGVSF
FT                   DVQSMRYTGERICRAADGALDLEDVFYLRPVGEYSDRQGKKYTYTEALRQQDLDLCRSA
FT                   AERYRDLLKAGFAEEHARGILPFDYRQHFVVSFSLRAFLHFMDLRAKLDAQLEIRQLCD
FT                   LMWPHMVNWAPEFAAWYEKTRLHRARLAP"
FT   gene            complement(279304..279879)
FT                   /locus_tag="Syncc9605_0274"
FT   CDS_pept        complement(279304..279879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0274"
FT                   /product="thioredoxin-like protein TxlA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34050"
FT                   /db_xref="GOA:Q3AMY2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34050.1"
FT                   /translation="MTGTPKSSPLGTAQQWVLVLIAVVLAIGLVILRGGIQSESPMEQL
FT                   ARRSLDPQTALTNGRPTLIEFYADWCQVCREMAPSMLDLEKRSRDRLDVVLVNVDNPRW
FT                   QDLVDRYDVNGIPQLNLFNAEGEAKGRSIGLRSVEELQLLTTALIEDQPLPALPGVGNI
FT                   SRLETPFSANNALAGASSPANAGPRSHG"
FT   gene            279943..280446
FT                   /locus_tag="Syncc9605_0275"
FT   CDS_pept        279943..280446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34051"
FT                   /db_xref="GOA:Q3AMY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34051.1"
FT                   /translation="MPILRLLSLPVRAPLLTVLFLVAVVLGNHWQMAQPSFTSLHGVSA
FT                   AWFWCFVLLQVQVVVVFCTMPDLLLRQVSMLMASSRVMTLVVTLLVVITGGIYLLKLNV
FT                   LTDVLILASAVMLARLDLIRIGVLPAAGICLCLMSVVVIGGIVSGTLLPHPSISFFAEG
FT                   WITA"
FT   gene            complement(280351..282396)
FT                   /locus_tag="Syncc9605_0276"
FT   CDS_pept        complement(280351..282396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0276"
FT                   /product="possible soluble lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34052"
FT                   /db_xref="GOA:Q3AMY0"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34052.1"
FT                   /translation="MQAGPRIGTLLLLSVAGFSGLAAWGGQHLLKRQHQPLTPEVSQAS
FT                   LWQHYRWAIDPQTRREAALLMVARDGAPDLLHGQGWGRDPMAAVVLERAALTADALGKT
FT                   SEATQTWQFLLDRFPKAPGSAWARLALGNTNPALHQRLLQLQPAHPAALTLAARDGSEA
FT                   LPNHQGALHLARWNARQAGALELMVDACQATGAQAPQADQRQTLVQALAKRGHADAALT
FT                   CLQELDAAPQTQLAIGRSLLLHGDPDVGTAQLLTLAQSHPNHPASLEAAQILSEPLNPQ
FT                   PGVLDALPERSAAVTAARVRLAGGNGADAALSRWPNDPDVWQLQWDLAREAFLAGDWER
FT                   ARDLLKRHNEDGPLPSPLETRRLFWLGLSQKQLGETAKAERTWRRLIEAFPGGYYRWRA
FT                   MEQLGMAEPLDLRAPAPQRESATWQPLNSHNNLVNELWRLGQVHAAWEAWQAQADPEIP
FT                   PPPEERLAEGRLRLAVGDTWMGLDQLWWLSLRWRDPSCQQRSLLHRSQFPRLFEAEIKT
FT                   AAKQEGLQANLLRAIAKQESRFAPGVVSPAGAVGVMQLLPSTAAEMAGEPTSTPMLKDP
FT                   ANNFELGARYLNQLLNQWENDPFRSIASYNAGPGAVDSWADPKAAAETALWVERIPYPE
FT                   TRFYAKKVLDNLMGYLGGNPSFCKKADAGMRKQRAGNDATDHDHTH"
FT   sig_peptide     complement(282328..282396)
FT                   /locus_tag="Syncc9605_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.871 at
FT                   residue 23"
FT   gene            282550..283944
FT                   /locus_tag="Syncc9605_0277"
FT   CDS_pept        282550..283944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0277"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34053"
FT                   /db_xref="GOA:Q3AMX9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34053.1"
FT                   /translation="MVQEACSPIGPALGDAAPGFGTDGIRGLAGTVLTPALCLQVGYWV
FT                   GRVLQAEGPVLIGMDSRTSGSMVVAALTAGLTAAGRDVWTLGLCPTPAVPLLIRQLGVA
FT                   GGLMVSASHNPPADNGIKVFGVDGAKLSASRQAQVEACLKGQTSMAEQGKFRCGVARPS
FT                   ADLLDRYREVLQESVAERRLDGVPIVLDLCWGSATACGADAFRALGADLTVLHGEPDGS
FT                   RINVACGSTHLEPLQRAVIERGAAMGFAFDGDADRMLAVDGRGRIIDGDHVLFLWGSVL
FT                   QEQQALPEQRLVATVMSNLGFERAWQQRGGTLERTPVGDQHVHAAMVASGAALGGEQSG
FT                   HILSASHGLCGDGVLTAVQLATLCYAQGISLSDWLDRSFQAYPQKLVNVRVMDRARRKN
FT                   WSACTALTDAIASAEQSMGENGRILVRASGTEPVLRVMVEAEQSDAVEHLTGHLAAVAE
FT                   EHLNVA"
FT   gene            complement(283931..284884)
FT                   /locus_tag="Syncc9605_0278"
FT   CDS_pept        complement(283931..284884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34054"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34054.1"
FT                   /translation="MRLLAGFDAGQTHTRCRLSVVQNGLHQPVGEGEGPGVSHLDAPQG
FT                   ERRFLEAIRTSAQQALKTHPDGVIQAAVVGASGIEHGTALQQRAERLVSQALAIGDATG
FT                   VIKVLVTGDERTALRGAIPEGAGILAISGTGMIVLGRDENGHEHRCGGWGWLLDGAGSA
FT                   FDLGHQGLQLTLRMADGRLPDHPLRLQIWNQMGCDSHAAVKARVVQHGFSTADFAALAP
FT                   LVVEAAVQDCPGAKEIVQRSAAALSSCISTVVQQLYLRSPVVICHGGAVTHLPGFRTAV
FT                   QQAIRQSIPEAQWGKAKGDACDGALQMAEALPLRPR"
FT   gene            complement(284881..286197)
FT                   /locus_tag="Syncc9605_0279"
FT   CDS_pept        complement(284881..286197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0279"
FT                   /product="possible bicarbonate transporter, ICT family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34055"
FT                   /db_xref="GOA:Q3AMX7"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34055.1"
FT                   /translation="MASADATQTANGGALLVRWQGLIAPDQAVLKRLESLAGLLLLVLL
FT                   TGLPLFSRTGLALVVTACGALWLLWCLCSPPHERIGTISRWLMLFLAIAIVATGCSPVP
FT                   IAASKGLIKLLSYLGVYALLCKLLLSNSRWWDRLVAGLLSGGLLSSVLALRQLYASSEE
FT                   LARWADPNSISAGTIRIYGPLGNPNLLAGYLLPLIPFAAIALVRWRGVGAQLFAGTTLV
FT                   LAPTATLFTYSRGGWLGMVAAGAVLLLLLLLRWTRHWPPLWRRLVPLAMLLVGAACLVV
FT                   AATQIDPIRTRITSLLAGRGDSSNNFRINVWMAAIQMVQDRPWLGIGPGNAAFNSIYPL
FT                   YQQPKFNALSAYSVPLEILVETGIPGLLACLGLLATSLRQGLLQLNANGSSALTSIASL
FT                   AAIAGLLMQGSTDTIFFRPEVQLIGWFALASLVSQPMKS"
FT   gene            complement(286207..286911)
FT                   /locus_tag="Syncc9605_0280"
FT   CDS_pept        complement(286207..286911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0280"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34056"
FT                   /db_xref="GOA:Q3AMX6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34056.1"
FT                   /translation="MRQHVNPLSSFFQLPLELPPPEQLFRVPDQPIHLDIGCARGRCLL
FT                   GLAERDPHWNHLGVEIRRPLVTSADRDALASEHGNVRILFCNANISLEGWMKALKQDQL
FT                   QRVSIQFPDPWFKRRHRKRRVLQPALLLAIATALQPGRELFLQSDVLNVIEPMVALTEL
FT                   SACFDRPVEDQRHWRASNPLSVPTERERYVLKQNLPVYRVLYRRNQNPLPSVSDLEQRW
FT                   QEIDNPAEALTT"
FT   gene            complement(286936..288231)
FT                   /locus_tag="Syncc9605_0281"
FT   CDS_pept        complement(286936..288231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34057"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34057.1"
FT                   /translation="MAPFAPFSWFRSGGAEASCRTGLSAKASLDEAVRDVAEQLGRSRG
FT                   EADLALVFTSTGYATDLPRLLPMLRAQISAKHWIGCTGGGVVGTRGDGSASELEQTPAL
FT                   SVTVLSLPGASIATQHLNTEELPDLDGAAQQWHDWVDITPKAARSQILLIDPTSSGIND
FT                   LFSGLDYAYPGAEKIGGIASPHNSPHGSLLLDDQVVTGAVVCSIGGSWRLETVVAQGCR
FT                   PIGPVFSIEQVQRNVLLELSDGSTKASPINCLQRVLADLSERERELVRHSLFLGVQRSS
FT                   LRLNANGAASEASAFLIRNLIGVDPNNGAVAVAERVRAGQNVQFHLREAAASQDEAVSL
FT                   LKAATADSGDTVHFGLLMACLGRGQGLFGRADGDISVARQLMPDLPVAGAFCNGEIGPV
FT                   GGTTHLHGYTACWGLLRQDPDSTSGSSSDNLG"
FT   gene            288301..288912
FT                   /locus_tag="Syncc9605_0282"
FT   CDS_pept        288301..288912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34058"
FT                   /db_xref="GOA:Q3AMX4"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34058.1"
FT                   /translation="MNELTYRALVWLTYRLAATFAVGVPLVLLIWSAWRREPLVLRLLG
FT                   IYWKVASLMAISLLLLTDQRPLGYAMAVAAPVLMVISMWFWVDINEELADQPSWRPLPL
FT                   AVKVWRWAFSGFGLLSLGMSVTGLGCMQQLQSPACLTWLEAPQGIHGLAATVFNFLFGG
FT                   LWTEAVAAFVGYVALVAYLAGLLQWLLVRLPRYGRVAGDF"
FT   gene            288912..289205
FT                   /locus_tag="Syncc9605_0283"
FT   CDS_pept        288912..289205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34059.1"
FT                   /translation="MTDQAVVQALEERTRVQPQRVVRLRGQVRDELFELLIFRGFSSST
FT                   THPTAFDPDASVLPEGTSLDQAELLQGPLSPSQEVVLAGPMPPNDLLAQGNW"
FT   gene            complement(289190..292114)
FT                   /locus_tag="Syncc9605_0284"
FT   CDS_pept        complement(289190..292114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0284"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34060"
FT                   /db_xref="GOA:Q3AMX2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34060.1"
FT                   /translation="MSKETRDAAAEERPSYKHTLNLLQTGFGMRANAVQREPELQAFWK
FT                   DQGIDGKLGLNNSGPTFTLHDGPPYANGALHMGHALNKVLKDVINKYQVLNGRQVRYVP
FT                   GWDCHGLPIELKVLQSIDQEQRKALTPIKLRKKAAAYARKQVDGQMKGFQRWGIWADWE
FT                   QPYLTLQKEYESAQIRVFGEMVLKGHIYRGLKPVHWSPSSRTALAEAELEYPDGHTSPS
FT                   VYAAFPAVELPEALRDSLKAEGLDLPTETDALGKALQVAIWTTTPWTLPANLAVSVNER
FT                   LDYALADDGAGRLLLVAADLIEALSGTLERPLSRRATVKGALLAGLTYRHPLLDRTSPV
FT                   VIGGDYITTESGTGLVHTAPGHGVDDFHTGQKNGLPVLCPVDEAGNLTDEAGPFAGLNV
FT                   LQDANAKIIEALESAGALLKQEAYGHRYPYDWRTKKPTIFRATEQWFASVEGFRQQALD
FT                   AIAAVEWTPASGRNRIESMVKERGDWCISRQRTWGVPIPVFYHRNNGEVLLNADTLDYI
FT                   QALIAEHGADVWWEKDEADLLPPTYADQADQWRKGTDTMDVWFDSGSSWAAVARQRDNL
FT                   SYPADLYLEGSDQHRGWFQSSLLTSVAVNGHAPYKRVLTHGFALDEKGRKMSKSLGNVV
FT                   DPMVIIEGGKNQKQEPPYGADVLRLWVSSVDYSADVPIGAGILRQLADVYRKVRNTSRY
FT                   LLGNLHDFNPATDAIPTAELPLLDRWMLQRTAEVMDEITEAFESFEFFRFFQLLQNFCV
FT                   TDLSNFYLDIAKDRLYVSAPQDQRRRSCQTVMALIIERLAGLIAPVLCHMAEDIWQNLP
FT                   YPVEETSVFHRGWPQIPAEWRDATLSAPVQELRELRAAVNKVLEDCRGRQELGASLEAA
FT                   VRIEAHRTELQAALSWLSETGDAEVDGLRDWLLVSQLQLGGEPWAEVLASQDDELASIE
FT                   VSRARGTKCERCWHYEGDVGQHPEHPHICGRCVGVLERRTHQLP"
FT   gene            complement(292142..292648)
FT                   /locus_tag="Syncc9605_0285"
FT   CDS_pept        complement(292142..292648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34061"
FT                   /db_xref="GOA:Q3AMX1"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34061.1"
FT                   /translation="MLATLSGDLCLLLGLALLLLPLLAVELSRPRDGVWGAVVLLLGLV
FT                   LVTSTDRLRGAPMLAVLCAGLLIARLGSEVGQARWNSLSETEQQRFTSLDHWRTSLQQL
FT                   FITTGRVGVGISGIAKQLKPAGNSGVTGKKWVRPESPETTGASETASTEAATEAAEVTS
FT                   PEGED"
FT   sig_peptide     complement(292574..292648)
FT                   /locus_tag="Syncc9605_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.972 at
FT                   residue 25"
FT   gene            292703..292784
FT                   /gene="tRNA-Leu4"
FT                   /locus_tag="Syncc9605_R0007"
FT   tRNA            292703..292784
FT                   /gene="tRNA-Leu4"
FT                   /locus_tag="Syncc9605_R0007"
FT                   /product="tRNA-Leu"
FT   gene            292821..293870
FT                   /locus_tag="Syncc9605_0286"
FT   CDS_pept        292821..293870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0286"
FT                   /product="beta-carotene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34062"
FT                   /db_xref="GOA:Q3AMX0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34062.1"
FT                   /translation="MLPDLRMHQSTAQQQQPRPVGVGYRSVPREFVDPPSFWNPTVGLF
FT                   LGGYALAVLTIWGWFVAALPLPVLLCTGFLALHLEGTVIHDACHNAAHPNRWINQAMGH
FT                   GSALLLGFSFPVFTRVHLEHHAHVNDPKNDPDHIVSTFGPLWLIAPRFFYHEWFFFQRR
FT                   LWRRWELMQWGLERSIFVVIVLAAARFDFLPFIFNCWFAPALMVGVTLGLFFDYLPHRP
FT                   FTSRNRWTNARIYPGKLMNWLIMGQNYHLVHHLWPSIPWFEYKPAYEATKPLLDSKGSP
FT                   QRLGIFETRQDGYNFLYDILVGVRSHKRRSGKMRRAARFMPGRGLRRNWLGFVDRIAIK
FT                   TEPKRWVSR"
FT   gene            complement(293878..294171)
FT                   /locus_tag="Syncc9605_0287"
FT   CDS_pept        complement(293878..294171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0287"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34063"
FT                   /db_xref="GOA:Q3AMW9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34063.1"
FT                   /translation="MSQISSDDVRKVAQLARLDLPEDKIATYTGQLESILEYVGQLQQV
FT                   DTEGVPETTRAVEVTNVTRVDGVQPTAVREDILDQAPQREGDFFRVPKILAD"
FT   gene            complement(294168..294956)
FT                   /locus_tag="Syncc9605_0288"
FT   CDS_pept        complement(294168..294956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34064"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34064.1"
FT                   /translation="MTAATPGPVDSTDAIRLALRSWPEVESYLQGCKGVIIPLGSTEQH
FT                   GPTGAIGTDALTAEAVALEVGRRTGVLVTPAQAFGMAEHHLGFAGTMSLQPATLLAVLH
FT                   DLVLSLGRHGFERVFVINGHGGNIATAKAAFAQAHGTATTRNLPVAPQLRCRLANWFMA
FT                   GPVMRQARDLYGDKEGHHATPSEIAVTLAVEPSLQSKQRPLPDPAPAGPIHGPDDFRRR
FT                   HPDGRMGSHPSLATAQHGDALLETAATALSEDLRTFLGES"
FT   gene            complement(295000..295146)
FT                   /locus_tag="Syncc9605_0289"
FT   CDS_pept        complement(295000..295146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34065"
FT                   /db_xref="GOA:Q3AMW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34065.1"
FT                   /translation="MMDAATSSFNLGTVLLASIVLFPLACLFFGTRGGYYNTDQYDGNG
FT                   TAH"
FT   gene            complement(295185..295841)
FT                   /locus_tag="Syncc9605_0290"
FT   CDS_pept        complement(295185..295841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0290"
FT                   /product="Protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34066"
FT                   /db_xref="GOA:Q3AMW6"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34066.1"
FT                   /translation="MLNILGLTRFLQLGSIGSWPIVVAVGALPYPITFLCTDLISELWG
FT                   EQKANQVVWVGLLLNGWVLLILWLGGVLPSMSGSDDSTFRTIQQLSFGSVGASMVAYLT
FT                   AQFVDVRLFHFWKQLTKGKALWLRNNGSTLVSQLVDTSAVVLISHYGAHVLPVQPERPV
FT                   LPQLISFIGSGYLFKVLAALTDTLPFIWLTGWLREWLDMPVEGGEVTTEATSSMQ"
FT   gene            295906..296586
FT                   /locus_tag="Syncc9605_0291"
FT   CDS_pept        295906..296586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0291"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34067"
FT                   /db_xref="GOA:Q3AMW5"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34067.1"
FT                   /translation="MLSTACNVQAGTSVAANRQPVIDFVSLPLNFFARPAQIVGPDLVG
FT                   CRLVKRQDDGSLLWGVIVETEAYSQDDPACHGYRRRSPQNETLFGEPGRFYVYVSYGIH
FT                   HCVNVVTDRGDWANGVLLRAVALPDEPERIAAGPGLLARRFGLDRRDDSRPVTGEHDVW
FT                   MAPRSDTFASQDLVTTTRIGISQGAAIPWRWYLQSSRSVSRRARGDRTPPKAQCWSPSL
FT                   ELSS"
FT   gene            296583..297632
FT                   /locus_tag="Syncc9605_0292"
FT   CDS_pept        296583..297632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0292"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34068"
FT                   /db_xref="GOA:Q3AMW4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34068.1"
FT                   /translation="MSGWPHRHVLDLASFSREDFAAVLELAQRFRSLPITGARKLPALQ
FT                   GRLVATLFFEPSTRTRSSFELAAKRLSADVMSFSPSSSSLSKGESVLDTARTYVAMGAD
FT                   VLVVRHRSTGVPQQLAHDLQQMGERTVVLNGGDGLHSHPSQGLLDLLTLARFFSPRHPM
FT                   PEALQGRRIVIVGDILHSRVARSNLWALSACGADVVLCGPPSLVPDDFAAFVDAPPPGL
FT                   PEDPVPQRGKVSVVRRLEHALPGADAVMTLRLQKERMGQQLLTSLERYHRDFGLSHERM
FT                   QLCGQNVPVLHPGPVNRGVELSGSLLDDPRCSLVEEQVRNGVPTRMALLYLMAASESAA
FT                   EASLVSSSS"
FT   gene            complement(297572..299086)
FT                   /locus_tag="Syncc9605_0293"
FT   CDS_pept        complement(297572..299086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0293"
FT                   /product="putative type 2 NADH dehydrogenase"
FT                   /note="Ndh, Ndh2B or NdbA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34069"
FT                   /db_xref="GOA:Q3AMW3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34069.1"
FT                   /translation="MAGNHYFLELEPPAERLRDAPHVVIVGGGFAGVHACKALAKADVR
FT                   ITLIDKRNFNLFQPLLYQVATGLVSRSDVATPLRELVGTQGNVQVLLGEVTAVNPEGKQ
FT                   IVFNGKAYSYDHLILATGSGSTYFGHEDWRTFAPPMKILEHAEEIRRRLLMAMEQAEQT
FT                   PNPEARQFLQTVVIVGGGPTGCEMAGAVSELMRWALNSAFKQLDSQKTRIVLVDPGDRV
FT                   LRAMPEELSKDAQKTLELNGVEFIPQGRVQTMRPGEVVISSPDGDVRIQAATVIWTAGV
FT                   KPSHLGQKLTEATGCELDRGGRVIVNPDFSIPNHPEIRIAGDLCSYSHTVNGKPLPGMA
FT                   APAKQAGTFIGKDIAAIVAGQDRPTFRYFDFGSMAVVQASAVADLHGFKVSGRMGLLLW
FT                   AIVHLALMPNRENRITLSIKWLYVLATRERASILLTGMPSQHLALDAEDAHFPMASGKG
FT                   PSIAEPDAALKAAMDYYAHQLSGLPQTQELLDTKDASAADSEAAIK"
FT   gene            complement(299159..299491)
FT                   /locus_tag="Syncc9605_0294"
FT   CDS_pept        complement(299159..299491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34070"
FT                   /db_xref="GOA:Q3AMW2"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34070.1"
FT                   /translation="MRRLQSTRLQTNAGAALQRLENWARNPWRRLSLLAIAGLIGFLIG
FT                   TAITPVAGVLGQMDPVAALLVVLGTELTIRRQRSSEPSLKLPQQLLDLGRIGFLYGLFL
FT                   EGFKLI"
FT   gene            complement(299715..299915)
FT                   /locus_tag="Syncc9605_0295"
FT   CDS_pept        complement(299715..299915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34071"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34071.1"
FT                   /translation="MSQSKREQVVSHLRYIRQELREMHQGVMEDGLLPEAGEVRGVMAQ
FT                   MEALLELLEGKASRKAKAESK"
FT   gene            complement(300106..300178)
FT                   /gene="tRNA-Ala2"
FT                   /locus_tag="Syncc9605_R0008"
FT   tRNA            complement(300106..300178)
FT                   /gene="tRNA-Ala2"
FT                   /locus_tag="Syncc9605_R0008"
FT                   /product="tRNA-Ala"
FT   gene            300245..300445
FT                   /locus_tag="Syncc9605_0296"
FT   CDS_pept        300245..300445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34072"
FT                   /db_xref="InterPro:IPR019678"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34072.1"
FT                   /translation="MLTQERLDAFDEASTAELARRLEEDDYPSPFDSLSDWHLLRALAI
FT                   HRPELILPYHHLVDQEPFDED"
FT   gene            300435..301721
FT                   /locus_tag="Syncc9605_0297"
FT   CDS_pept        300435..301721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0297"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34073"
FT                   /db_xref="GOA:Q3AMV9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34073.1"
FT                   /translation="MKTEQASPLCGRRVLVAVSGSIAAVKTPLLVSALIKAGAEVRCLV
FT                   TASGAALVSPVALASLSRHRCYLEADQWDPAASKPLHIELAEWAELIIVAPLSASSLAR
FT                   WSQGSADGLLASVLLATEVPVIAAPAMNTAMWRHPAVQGNWLRIQSFPAVVPLVPASGL
FT                   LACDRVGDGRMADPLLIELAAASVFSRGSGTPDVTLDWSGLSVLVSAGPTQESIDPARF
FT                   LSNRSSGRMGVLLAQAARFRGASVHLVHGPLDLPDAWLEGLKCTAVESAAELGSALLLA
FT                   QPGSDVLVMAAAVADLRRDGPLPSKLTKLELQQALTSGWTEVPDLLSNLTRQRRSEQLV
FT                   LGFTALTGSDADLLERAESKRLAKGCDLMMVNPVDRDGQGFGDQPNGGWLLGDGWRREL
FT                   PVTAKLSLAHQLLDALIEARDQAAASMES"
FT   gene            complement(301694..302029)
FT                   /locus_tag="Syncc9605_0298"
FT   CDS_pept        complement(301694..302029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34074"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34074.1"
FT                   /translation="MQLSTTCRKHVTSNDPDSTQARMAPALAALGELAEELRGNPEALL
FT                   TLLRELEALHRDVQDGPFRQSLPENRQKLFTLLQKMEKNGGWPYIPRLQLRTFIDLLGQ
FT                   DSIDAAA"
FT   gene            302120..302950
FT                   /locus_tag="Syncc9605_0299"
FT   CDS_pept        302120..302950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0299"
FT                   /product="photosystem II manganese-stabilizing polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34075"
FT                   /db_xref="GOA:Q3AMV7"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34075.1"
FT                   /translation="MRIRPLLAVVLALCLAFFTTACSGDSDAVQRGGSNVTYDDIHNTG
FT                   KANDCPTIGDSARGSIPLDAGGSYELREICMHPVQVYAKEEPKNIRQQAEFVEGKILTR
FT                   YTSSLDSVFGDLKVTESGLQFQEKGGIDFQPITVLVPGGEEFPFTFSSKSLNATAEGSA
FT                   LTTSTDFEGTYRTPSYRTSNFIDPKGRALTTGVQYAQGLVALGGDDEQLEKDNNKRYID
FT                   GVGTMSLSITKVDPETGEFAGVFSAIQPSDSDMGGREVVDIKITGDLYGRLEEA"
FT   sig_peptide     302120..302191
FT                   /locus_tag="Syncc9605_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.548 at
FT                   residue 24"
FT   gene            303057..304229
FT                   /locus_tag="Syncc9605_0300"
FT   CDS_pept        303057..304229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0300"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34076"
FT                   /db_xref="GOA:Q3AMV6"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34076.1"
FT                   /translation="MTARASAPAQRSVVIAPYGGTLVDLMVAEVDRAAVKATATKTIEC
FT                   SDRNACDVELLCVGGFSPLRGFMHQEDYDAVVSGHRLAAGQLFGLPIVMDTDRDDVVVG
FT                   DKLLLTYKGQDLAVFEVEDKWEPNKVAEAKGCYGTTSIEHPAVRMITMERKRFYMGGSL
FT                   QGLALPERVFPCKTPAEVRAGLPEGEDVVAFQCRNPIHRAHYELFTRALHAQNVSDNAV
FT                   VLVHPTCGPTQQDDIPGAVRFQTYERLATEVNNDSIRWAYLPYAMHMAGPREALQHMII
FT                   RRNYGCTHFIIGRDMAGCKSSLTGDDFYGPYDAQNFAKECAPELTMETVPSLNLVYTQE
FT                   EGYVTAEHAEARGLHVKKLSGTQFRKMLRGGEEIPEWFAFKSVVEVLRAA"
FT   gene            304274..306124
FT                   /locus_tag="Syncc9605_0301"
FT   CDS_pept        304274..306124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0301"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34077"
FT                   /db_xref="GOA:Q3AMV5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34077.1"
FT                   /translation="MNKRWRNIGLGALLVLSIVVIAPAFFGGGGGSQPQVNTIRYSEFV
FT                   EAVKDDQISRVLISPDQGTAQVVENDGRRAQVNLAPDRELLGLLTEHSVDIAVQPSRQT
FT                   PGWQQAAGSLIFPLLLLGGLFFLFRRAQGGGGGNPAMQFGKSKARVQMEPSTQVTFTDV
FT                   AGIEGAKLELTEVVDFLKNPDRFTAVGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPF
FT                   FSISGSEFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGNDERE
FT                   QTLNQLLTEMDGFEGNTGIIIVAATNRPDVLDAALMRPGRFDRQVTVDRPDYSGRLQIL
FT                   GVHARGKTLAKDVDLDKVARRTPGYTGADLANLLNEAAILAARRELTEVSNDEISDAIE
FT                   RVMAGPEKKDRVMSERRARLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFT
FT                   PSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVASTARQMIT
FT                   RFGMSDELGPVALGRAQGGMFLGRDIAAERDFSEETAAMIDKEVSELVDVAYKRATKVL
FT                   VDNRAVLDELAEMLVEQETVDAEELQELLIKRDVRVAEYV"
FT   sig_peptide     304274..304372
FT                   /locus_tag="Syncc9605_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.535 at
FT                   residue 33"
FT   gene            306096..306797
FT                   /locus_tag="Syncc9605_0302"
FT   CDS_pept        306096..306797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0302"
FT                   /product="2-dehydro-3-deoxyphosphogluconate aldolase /
FT                   4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34078"
FT                   /db_xref="GOA:Q3AMV4"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34078.1"
FT                   /translation="MTSGSPNTSDFDSSSNPWLVRQELLVASLQHQPLLLVIRPEPGDL
FT                   VASDSGSGLLEQVQQLHAAGLRHLEVAWLDQPGWMGFMQRVQDHCPGLNLGAASVTVSK
FT                   ALNDLSRLDLSYAMAPCWCPELVEHARELGVLLVPGVFSPTEVHQAIQFGCRVVKLFPA
FT                   VNLGPGYWGRLRAPLGPLPFVIAAGGLEVSDLPAWLEAGHGAVALGRRVVGSPPAFQAL
FT                   LDWLRQSTTQR"
FT   gene            306860..307327
FT                   /locus_tag="Syncc9605_0303"
FT   CDS_pept        306860..307327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34079.1"
FT                   /translation="MSQLTIKLSDKADALIAQLQKEIFNRRRKKVSAAGVVETLVESGA
FT                   KSQSDKRFATSWTNLIKDIEKAAKLSYAHGSKPSTLSDEEWALVLSHRSRGTTGRARRT
FT                   VKKTMAAKKPASAKPQASKKPARRTRTRSAAKTKAAAAAASSNVSSAVGSV"
FT   gene            complement(307347..308447)
FT                   /locus_tag="Syncc9605_0304"
FT   CDS_pept        complement(307347..308447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0304"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34080"
FT                   /db_xref="GOA:Q3AMV2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34080.1"
FT                   /translation="MAMGSSFGDLFRISTFGESHGGGVGVIVEGCPPRLNLSVESIQAE
FT                   LDRRKPGQSHITTPRKEADQVQVLSGLLDGETTLGTPIAMVVRNKDQRPGDYKDMAVAF
FT                   RPSHADATYQAKYGIQARSGGGRASARETIGRVAAGAIAKQLLKQAAGTEILAWVKRIH
FT                   NIEASGIDPQRVQLSDVEANIVRCPESAVAERMVERIEAIGREGDSCGGVIECVVRHPA
FT                   VGLGMPVFDKLEADLAKAVMSLPATKGFEIGSGFDGTLLKGSEHNDAFLPSDDGRLKTA
FT                   TNNSGGIQGGISNGEPIVIRVAFKPTATIRKEQQTIDSDGKATTLAGKGRHDPCVLPRA
FT                   VPMVEAMVALVLADHLLRQQGQCSLW"
FT   gene            complement(308481..308939)
FT                   /locus_tag="Syncc9605_0305"
FT   CDS_pept        complement(308481..308939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34081"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34081.1"
FT                   /translation="MNQTEALIQQLGLMPHPEGGWYRELHRSSDRVQRQDGAERSALTA
FT                   ILFLLPAGAVSCWHRVIGADEVWTHVDGATLELLQCQADGTGLQRDALQPSNPVQVVPA
FT                   NAWQAARSLGDYSLVSCCVGPGFDFCDFEMARQQPTTERPKLPHPELI"
FT   gene            complement(308936..309694)
FT                   /locus_tag="Syncc9605_0306"
FT   CDS_pept        complement(308936..309694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34082"
FT                   /db_xref="GOA:Q3AMV0"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34082.1"
FT                   /translation="MSSSKAKRKQLTTIQRVIRWGPWHYRFWREIARWCYEQSLHNPAV
FT                   VPADVGFPAHRQLLECYQQIRQETLEVALSGRLPANHDIMQQQRTLYEFDRKIWGMLPL
FT                   RGYGYNYPANQALIPSLRSFLQHHPDVVSAAVSLFPPGKVLRPHKGPFKGVWRYHLPLF
FT                   VEDFGDGRSSCELTIDGQSYHLQEGEGFLWDDTFMHSAINRSSQPRVVLLFDVFRKDQP
FT                   FWLFGMSWIFLWVAQIWQHVQDMRGRAGLQ"
FT   gene            complement(309915..310994)
FT                   /locus_tag="Syncc9605_0307"
FT   CDS_pept        complement(309915..310994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0307"
FT                   /product="photosystem q(b) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34083"
FT                   /db_xref="GOA:Q3AM89"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34083.1"
FT                   /translation="MTTTLQQRSGASSWQAFCEWVTSTNNRLYVGWFGVLMIPTLLAAT
FT                   ICFVIAFVAAPPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDE
FT                   WLYNGGPFQLVVFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPF
FT                   GQGSFSDAMPLGISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSS
FT                   LVRETTESESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVV
FT                   GIWFTALGVSTMAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFP
FT                   LDLAAAESTPVALQAPAIG"
FT   gene            311166..312755
FT                   /locus_tag="Syncc9605_0308"
FT   CDS_pept        311166..312755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0308"
FT                   /product="Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34084"
FT                   /db_xref="GOA:Q3AMU8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34084.1"
FT                   /translation="MAADVAPQEERVLLVRLPCNPIFPIGPIYLADHLHKCFPEMPQRI
FT                   LDLAALPVLDVHRVLDATVDQFQPTLLVFSWRDIQIYAPVDGRGGNPLQNSFEVFYARN
FT                   PLKRLHGALGGLQLMSSHYGELHRNQRLVRQGLKRARRHQPAARAVLGGGAVSVFYEQL
FT                   GKSLPKGTVVSIGEGEPLLEKLIQGHSLEGERCFVVGEKPRSGLIHEQPESRPKTACNY
FT                   DYIASIWPQLDWYLEGGDFYVGVQTKRGCPHNCCYCVYTVVEGKQVRLNPVDEVVKEMR
FT                   QLYDRGVRGFWFTDAQFIPARRYIEDAKELLRAIKSEGLTGIRWAAYIRADNLDPELAQ
FT                   LMVETGMSYFEIGITSGSQELVRKMRMGYNLRTVLESCRMLADAGFRDHVSVNYSFNVI
FT                   DERPETIRQTVAYHRELEAIFGADLVEPAIFFIGLQPHTHLEQYGFDQGLIKPGYNPMS
FT                   MMPWTARKLLWNPEPMGSTFGRVCLEAFDRNPADFGRTVMSLLERDYGVASLQEALRAP
FT                   VAGRAALATAVR"
FT   gene            complement(312695..313567)
FT                   /locus_tag="Syncc9605_0309"
FT   CDS_pept        complement(312695..313567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34085"
FT                   /db_xref="GOA:Q3AMU7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34085.1"
FT                   /translation="MLQPLNRFLLLHPFWLPTVLFIPLLYALGWLAAVPLTLLGLPAER
FT                   VSLTGTVLSFVLFIALMPRWVATRWSAEQPWAALGVCRSNRQVQPAPAAALLKGLLLAA
FT                   GLLTLITSIVLIGGWGNWRGEVSATQLTNAVLLCLGVGFAEELIFRGWLWTELNQLTGS
FT                   RRAALAQASIFSLVHTRFNLGLGAMSALLIGLFLLGLVLARQRQTNHGSLWGCIGLHGG
FT                   LVAGWFLLQSGLLQLSTNAPSWLVGPGGSAPNPLGGAVGLISLLILLLIQRTAVAKAAR
FT                   PATGARNAS"
FT   gene            complement(313572..313892)
FT                   /locus_tag="Syncc9605_0310"
FT   CDS_pept        complement(313572..313892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34086"
FT                   /db_xref="GOA:Q3AMU6"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34086.1"
FT                   /translation="MVMAVESPSQKPGGAAVLDKAPEKVRKRSPRYKVLLHNDPVNSME
FT                   YVVATLQQVVPQLSEQDCMAVMLEAHNTGVGLVIVCDIEPAEFYCETLKSKGLTSSIEP
FT                   EN"
FT   gene            complement(313940..315166)
FT                   /locus_tag="Syncc9605_0311"
FT   CDS_pept        complement(313940..315166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0311"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34087"
FT                   /db_xref="GOA:Q3AMU5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34087.1"
FT                   /translation="MVQVNGNYLKLKAGYLFPEIGRRVKAFSSANPDAALIRLGIGDVT
FT                   EPLPLACREAMKTAIDAMGTAEGFHGYGPEQGYGWLREAIAKNDFQARGCDISAEEIFV
FT                   SDGSKCDSSNILDILGEGNKVAVTDPVYPVYVDSNVMAGRTGEAGEIGRYAGLTYLPIS
FT                   ADNGFAALIPSEPVDLIYLCFPNNPTGAVATREQLQAWVNYARANGALILFDAAYEAFI
FT                   QDPELPRSIFEIEGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAANGEAVELWG
FT                   LWNRRQSTKFNGVSYIIQRGAEAVYSEAGQAEVKALVSFYMENAAIIRRELTAAGLTVY
FT                   GGEHAPYVWIKTPEGMDSWGFFDHLLNKANVVGTPGSGFGAAGECYFRLSAFNSRANVD
FT                   EAMARIKAL"
FT   gene            315220..317883
FT                   /locus_tag="Syncc9605_0312"
FT   CDS_pept        315220..317883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0312"
FT                   /product="Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34088"
FT                   /db_xref="GOA:Q3AMU4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34088.1"
FT                   /translation="MTTGVRTSDVVVSSLDHPVDFHALVDSGINKPARYMGHELGVEPR
FT                   DWQTATVRWALTYPEIYEVGSSNLGHIILYSILNAVPGQLCDRAYLPAADLAGRLRERS
FT                   QALFAVESRRPLPAFDILGFSLSYELGATNILEMLDLAQVPIRAADRGDLLLNDPAAPP
FT                   LIFAGGPTATSNPEPYAPFFDFIALGDGEELLPEIGLVVAQAKGDGLTRLQLLRDLAQV
FT                   PGVYVPSLYATGADGVTLEPLHPHVPARVLRRVATPMPHYAMGLVPHVETVHDRLTVEI
FT                   RRGCTRGCRFCQPGMLTRPARDVEPEAVIEAVETGMKQTGYSDFSLLSLSCSDYLALPA
FT                   VGVELRNRLADQNVTLQLPSQRVDRFDEDIAHILGGTRKAGLTFAPEAGTQRLRDIVNK
FT                   GLTDDDLLHGIRTAMQNGYRKVKLYFMIGLPGETDADVLGIAETCVMLQQRCRDLGRLN
FT                   LNITISNFTPKPHTPFQWHSVSTAEFERRQALLKEAFRRLRGAKVNFTDVRLSAMEDFV
FT                   GRSDRRLAPVIEAAWRAGAGMDAWFESLDRTYAAWTGAIADAGLEGHYREMEMGGWSAV
FT                   AALDREDLEAFCAQPLPWDHIDTGIDKAWLADDLQRALAAAVVPDCSFDGCSSCGVCGP
FT                   DLGHNVVVSAPEVPTQVPTQAPPSERVCRIRVQFAKTGSMALLSHLDLMRMLERALRRS
FT                   ALPISFTGGFHPLPRIQIALALPLGAEAESEWMDLEFTEALDPNHFCKTLQPLLPEGIQ
FT                   LLAAAEVPVSGKSLSQELKSAVWCFDLVPEAQASMPLDWHAAVDQLLQATSLVWHDTDK
FT                   KGRPRERDCRPALKALHVTDQNPDGSIRLRLEAAVDEMGRSLRPAQIQHWLAENVGQPL
FT                   QVQRLAREALLLDAQC"
FT   gene            318140..320080
FT                   /locus_tag="Syncc9605_0313"
FT   CDS_pept        318140..320080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0313"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34089"
FT                   /db_xref="GOA:Q3AMU3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34089.1"
FT                   /translation="MPQQIVIAEQLRIAAVLTDERVDELIVAQGRYQIGDVYLGTVENV
FT                   LPGIDAAFVNIGESEKNGFIHVTDLGPLRLKKGSAGITELLEPRQKVLVQVMKEPTGTK
FT                   GPRLTGNLALPGRYLVLQPHGQGVNISRRISSDAERNRLRALGVLIKPPGAGLLIRTEA
FT                   DSISEELLIEDLESLLRQWEAIQQAAETAAPPVLLNRDEDFIHRILRDHMGPDLARVVV
FT                   EDAAAVGRVSSFLGADASNVLVEAHSEPSELLEHYKVNAAIRDALKPRVDLPSGGYVII
FT                   EPTEALTVIDVNSGSFTRSANARETVLWTNCEAAIEIARQLKLRNIGGVIIIDFIDMDS
FT                   RRDQLQLLEYFTTAVRDDSARPQIAQLSELGLVELTRKRQGQNIYELFGRACPSCGGLG
FT                   HVAVLPGKDLLQPLATATGLVRSAASARAEVVAPGENGGNGRRRRGGRGRGSQDAVLPL
FT                   ETSDTAAPEVSTQEAQEPATARRQDPEMVAVPMTDEQQQLFGWLGLNPALLLEEPPASD
FT                   NVVVRVVRPGEDEQEVLEAARQQLAASSGRRRRRGGRGGRSGSRNGASQPTSNSSSETP
FT                   VVVTSSAPDEAAPLMVEITPLEAVTNLTITEPEPAPISEPAEPEPVAVVEPAEPEEPRR
FT                   RRRRSSAVATV"
FT   gene            320086..320685
FT                   /locus_tag="Syncc9605_0314"
FT   CDS_pept        320086..320685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0314"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34090"
FT                   /db_xref="GOA:Q3AMU2"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34090.1"
FT                   /translation="MTAQESLPLGRDVAGVDEVGRGCLFGPVFAAAVVLEGSAAECLLK
FT                   AGLTDSKKLSAKRRAALVPLIQSLCVASALGQASAREIDACGIRVATERAMLRALQRLP
FT                   QSPGLVLVDGNLPLRLWHGPQRTVIAGDSRSAAIAAASVLAKEARDALIRRLSARFPGY
FT                   GLERHAGYGTAQHRQSLIDSGPTPLHRHTFLKRLLG"
FT   gene            complement(320632..321207)
FT                   /locus_tag="Syncc9605_0315"
FT   CDS_pept        complement(320632..321207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34091"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34091.1"
FT                   /translation="MPLAFEASQKLDLPVRTGAERLPTYLLEEERVLGALLDAKQLTRL
FT                   QPGRYRYVVTSLQVFQLQVKPVVSLQIHMEGDTLVMQALDCELEGLGIVDDFALNLEAR
FT                   LTSTPGGLQGHAHLSVSVSQPSLLKLIPKRVLESTGESILSGILIGIKARVGRQLIDDY
FT                   RCWCRETEEQRSTEQTLQERVPMQGRGA"
FT   gene            321227..322102
FT                   /locus_tag="Syncc9605_0316"
FT   CDS_pept        321227..322102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0316"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34092"
FT                   /db_xref="GOA:Q3AMU0"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34092.1"
FT                   /translation="MILSSPCSAASMPTRLAFLGPAGTYGEQAARVLIEQDALEDVQLV
FT                   PCVGLRSVVEQLAGGECDAAVVPIENSVEGGVTATLDALWSHPELCIRRALVLPIQHAL
FT                   LGSGPLSRVTEVLSHPQALAQCSGWLAQHLPDALQLPTSSTAEAARMVAGSPFRAAIAS
FT                   QSAAREHGLDELAFPVNDVAGNRTRFLLLCRGQRSEHGDVASLAFSLHRNAPGALLEAL
FT                   ACLAERGLNMSRIESRPSKRELGEYVFFVDVDLPPDPSTALQDLIAQLQPLCEHLAHFG
FT                   AYPSSDLSGS"
FT   gene            complement(322106..323020)
FT                   /locus_tag="Syncc9605_0317"
FT   CDS_pept        complement(322106..323020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0317"
FT                   /product="probable sterol-C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34093"
FT                   /db_xref="GOA:Q3AMT9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR025774"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34093.1"
FT                   /translation="MVAGAVGTTGVALWLRRDRRYESSESVASAYDAWTEDRLLEQLWG
FT                   EHVHLGHYGTPPGSFDFREAKEAFVHELVRWSGLDQLPAGSRVLDVGCGIGGSARILAR
FT                   DYGLDVLGISISPAQVERATQLTPSGLSCRFQVMDALDLQLPDQSFDAVWSVEAGPHMP
FT                   NKQRYADELLRAMRPGGLLAVADWNRRDPSDGGMTRTERWVMRQLLNQWAHPEFASIKG
FT                   FRQNLDNSVHHRGEIVTGDWTQATLPSWIDSIIEGIRRPWAVVSLGPKAVLQGLRETPT
FT                   LLLMHWAFATGLMQFGVFRISKD"
FT   gene            complement(323038..323673)
FT                   /locus_tag="Syncc9605_0318"
FT   CDS_pept        complement(323038..323673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0318"
FT                   /product="Peptidase S16, lon-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34094"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34094.1"
FT                   /translation="MSDFSVRELPLFPLPDVVLFPQQLLPLHIFESRYRMLLQTVLETD
FT                   KRFGIVRINPENGEMAEIGCCAEVLQHQTTEDGRSYIVSLGQQRFRLLNITRETPYRTG
FT                   MVSWLEDEPVADTDQLNSLRDKVSEALNDVVQLTSKLQNREVELPEDLPDLPRELSFWI
FT                   SAHLDQAASEQQSLLELTDTHERLSQQFEMLDHTRRQLAARTVLMDLK"
FT   gene            complement(323730..324050)
FT                   /locus_tag="Syncc9605_0319"
FT   CDS_pept        complement(323730..324050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0319"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34095"
FT                   /db_xref="GOA:Q3AMT7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34095.1"
FT                   /translation="MSTAIAQQKIRIRLKAFDRRMLDLSCEKIIETADNTAATAIGPIP
FT                   LPTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYSPSAKTIDALMKLDLPSGVDIEV
FT                   KL"
FT   gene            complement(324172..325371)
FT                   /locus_tag="Syncc9605_0320"
FT   CDS_pept        complement(324172..325371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0320"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34096"
FT                   /db_xref="GOA:Q3AMT6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34096.1"
FT                   /translation="MAREKFERNKPHVNIGTIGHVDHGKTTLTAAITNVLAKKGQAEVQ
FT                   NYADIDGAPEERERGITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMAQTKEHILLAKQVGVPALVVALNKCDMVDDEEIIELVEMEIRELLSSYDF
FT                   PGDDIPVVQVSGLKAIEGEAEWEAKIEELMAAVDSSIPEPEREVDKPFLMAVEDVFSIT
FT                   GRGTVATGRIERGIVKVGEEIEIVGIKDTRKTTVTGVEMFRKLLDEGMAGDNVGLLLRG
FT                   IQKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTG
FT                   QITAFTAEDGSNVEMVMPGDNIQMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE
FT                   "
FT   gene            complement(325416..327491)
FT                   /locus_tag="Syncc9605_0321"
FT   CDS_pept        complement(325416..327491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0321"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34097"
FT                   /db_xref="GOA:Q3AMT5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34097.1"
FT                   /translation="MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHD
FT                   GAAVTDWMAQERERGITITAAAISTSWQDHRINIIDTPGHVDFTIEVERSMRVLDGVIA
FT                   VFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVHGQIKDRLKANAVPIQ
FT                   LPIGAEGELSGIIDLVANKAYIYKNDLGTDIEEADVPADMADEVAEWRNTLMETVAETD
FT                   EALIEKFLESGELSVDDLKKGIREGVLKHGLVPMLCGSAFKNKGVQLVLDAVIDYLPAP
FT                   VDVPPIQGVLPDGSEAVRPSDDSAPFSALAFKVMADPYGKLTFVRMYSGILEKGSYVLN
FT                   STKGEKERISRLVVLKADDREEVDALRAGDLGAVLGLKNTTTGDTLCTQDDPIVLETLF
FT                   IPEPVISVAVEPKTKGDMEKLSKALVALAEEDPTFRVNTDSETGQTVIAGMGELHLEIL
FT                   VDRMLREFKVEANIGAPQVSYRETIRGSAGGEGKFSRQTGGKGQYGHVVIEMEPGEPGS
FT                   GFEFVNKIVGGVVPKEYIKPAEQGMKETCESGVIAGYPLIDVKCTLVHGSYHDVDSSEM
FT                   AFKIAGSMAFKDGVKKCNPVLLEPMMKVEVEAPEDFLGSIIGDLSSRRGQVEGQSVEDG
FT                   TSKISAKVPLAEMFGYATELRSMTQGRGIFSMEFDNYAEVPRNVAEAIISKNQGNS"
FT   gene            complement(327581..328051)
FT                   /locus_tag="Syncc9605_0322"
FT   CDS_pept        complement(327581..328051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0322"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34098"
FT                   /db_xref="GOA:Q3AMT4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34098.1"
FT                   /translation="MSRRNAAEKRPILPDPQFNSRLATMMVVRLMQHGKKSTAQRILSD
FT                   AFGLINERTGGDPLELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWL
FT                   VSFSRARNGRSMAQKLAGELMDAANEAGNAVRKREETHKMAEANKAFAHYRY"
FT   gene            complement(328093..328467)
FT                   /locus_tag="Syncc9605_0323"
FT   CDS_pept        complement(328093..328467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0323"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34099"
FT                   /db_xref="GOA:Q3AMT3"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34099.1"
FT                   /translation="MPTIQQLIRTERSRLKAKTKSPALKSCPERRGVCTRVYTSTPKKP
FT                   NSALRKVARVRLTSGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
FT                   AGVKDRRQSRSKYGAKAPKE"
FT   gene            complement(328540..328866)
FT                   /locus_tag="Syncc9605_0324"
FT   CDS_pept        complement(328540..328866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34100"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34100.1"
FT                   /translation="MAANLRLTAAAAAELGRQAAVAGTPGQMHLDLTPGECAQHVLRIR
FT                   AGHLAGVAIARADGVTLHAPAEQLKLLEGLCLDYRGDLSGGGFLIRNSDGVEPCACGSA
FT                   FSRI"
FT   gene            complement(328901..330586)
FT                   /locus_tag="Syncc9605_0325"
FT   CDS_pept        complement(328901..330586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34101"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34101.1"
FT                   /translation="MLAFAPLPPPPPELRPAPNQSGEEVLIGQKRSKAVWLWKGREAEP
FT                   EELWLPLEVLESRLGFRRVSRLDGEALEWFGRTVSLTALATRSLGDEVGLEVSDWLAAT
FT                   GVRSKVRGNTLELRLPRPTVNNLRRGKGSTADRLVLDLDGPALVQRLKGDLLLELKLSR
FT                   TQQRQLKAWGLTPQQHRHGGIVLKGQATKLRSLSLASPWRVVLDGVLIGGRRPAQSAHL
FT                   PLRDPAVAEWLRRGFVLEQRTIKVGVKPIQVFRAGGQLSRLGITLQTLVKAEQQQGLRF
FT                   LPQLSQPAGALVAVNGGFFNRINQLPLGAVRHQGIWLSGPILNRGVIAWGASGDLQFGR
FT                   LRLNQTLRVNNGRRWSLMALNSGYVQKGLSLYTPAWGPRYRALSGEEEALLIRGGRVET
FT                   TFNQRSLQSGIAIPENAALVVARGRTPLPAQPGDQIQVTERSSSPLAQQPNVLGGGPLL
FT                   MQNGRVVLNGRQEGFSPGFMSLAAPRTVVAQGASGQWLMTLRGAAGSDPTLVETALAAK
FT                   QLGLRDALNMDGGSSTTLVVAGRTVMNGRSSSPRVHNGLGLIPL"
FT   gene            330689..335290
FT                   /locus_tag="Syncc9605_0326"
FT   CDS_pept        330689..335290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0326"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34102"
FT                   /db_xref="GOA:Q3AMT0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34102.1"
FT                   /translation="MSDAIRSAVWPYCDSPAPQVVAGEKDACGVGFLAQLQGQASHWVL
FT                   EQALRGLGCMEHRGGCGGDGDSGDGAGVLCEIPWSYLKAVWPEAAAARGLGMMFMPTDA
FT                   SRRAEVRGLCDEEARSLGMQPLGWRTVPVEPAVLGPLARATAPVIEQWVLNGDADDSTF
FT                   DGQLLRLRRRIGARVRAALGAEVAQDVYVASLSSRTVVYKGMVRSEVLEQFYADLQDSR
FT                   FEVSFAVYHRRFSTNTLPRWPLAQPMRLLGHNGEINTLLGNLNWAKASEASLENVWGEA
FT                   ADDLIPVVNPAFSDSANLDATLELMVRSGRSITDSLITLVPEAFRNQPDLDSRPDVTAM
FT                   YEFNAGIQEPWDGPALLVFADGKRVGATLDRNGLRPARWCTTADGFVIMGSETGVVDLS
FT                   GKTIVQKGRLGPGQMVAVDLERGELLDNWSVKEDAARRFPYADWLQKHRRGVPPQPWTQ
FT                   DRKVGELDLLRLQTAMGFTAEDFDLIIEDMAALGKEPTYCMGDDIPLAVLSDKPHLLYD
FT                   YFKQRFAQVTNPPIDPLREKLVMSLEMHLGERRPALKPQPEAASVIHLETPVLNEAELA
FT                   AISEQGLPVKTVSTQVAVESCAGGLQHAIAALCSVAEQAVRDGAQVLVLSDRVGGTGAA
FT                   APLTPTTVAMPALLAVGAVHHHLLRQKLRLQCSLVVDTAQCWSTHHMACLIGYGASAVC
FT                   PWLTWETTRHWLDHPKTKKRIEQGKLPALDANQAQANVRESLENGLRKILSKIGISLLA
FT                   SYHGAQIFEAIGLGADVVETAFAGTTSRVAGMTLAELANETLSMHAKAFPELNRSKLEF
FT                   MGFVQYRSGAEYHRNNPELSKALHKAVAQGPGYDHFSTYQDLLENRPVMALRDLLEFKL
FT                   APNPVPLDQVESVESICTRFCTGGMSLGALSREAHEVLAVAMNRIGGKSNSGEGGEDPA
FT                   RFQILKDVDGEGRSASFPSIGGLRNGDTACSAIKQVASGRFGVTAEYLRSGKQLEIKVA
FT                   QGAKPGEGGQLPGPKVDKYIAWLRNSKPGVALISPPPHHDIYSIEDLAQLIHDLHQVHP
FT                   AAPVSVKLVAEIGIGTIAAGVAKANADVIQISGHDGGTGASPLSSIKHAGSPWELGLTE
FT                   VHRSLVENGLRDRVLLRADGGLKTGWDVMIAALLGAEEYGFGSIAMIAEGCVMARVCHT
FT                   NNCPVGVATQKENLRKRFTGVPEHVVNFFWYVAEEVRQLMSLLGVSRLEELIGRTDLLQ
FT                   ARSVDLAKTKGVDLSSLRAPISGAEDRSWLRHSDEAHGNGPILEDQLLADAELMAALEN
FT                   HGSLSRSIEIINTDRSVCARLAGEIAQRHGNRGFNGQLDLTFRGAAGQSFGAFLVQGMQ
FT                   VRLEGEANDYVGKGINSGCITLVPSDGCASPGDQVILGNTCLYGATGGELFANGRAGER
FT                   FGVRNSGARAVVEGAGDHCCEYMTGGVVVVLGSTGRNVGAGMTGGVTFLLDEEGHVAPR
FT                   VNPEIVEVCTITTHEQESLLKGLLERHVALTGSEKAAALLADWSAAKGRFKVLVPPSER
FT                   ESMGLADKQAVAA"
FT   gene            335306..335614
FT                   /locus_tag="Syncc9605_0327"
FT   CDS_pept        335306..335614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34103"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34103.1"
FT                   /translation="MAWFVKTETFTAVASALPVEQRRPSLEAHRRWVADEAAAGRRVRS
FT                   GYLVDGDRRPGGGGLLIFEASSYADALAWVQNDPMIIAGLVDWQVQEWIPVSGDGWP"
FT   gene            complement(335592..336461)
FT                   /locus_tag="Syncc9605_0328"
FT   CDS_pept        complement(335592..336461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0328"
FT                   /product="lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34104"
FT                   /db_xref="GOA:Q3AMS8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34104.1"
FT                   /translation="MLKPEWLRVKAPQRERIGAVADLLLDLNLNTVCQEASCPNIGECF
FT                   AGGTATFLIMGPGCTRACPYCDIDFDKRVRELDPTEPQRLGEAVARLGLKHVVITSVNR
FT                   DDLADGGASQFVACIEQVKQRSPLTTIELLIPDFCGNWDALATVMAAAPHVLNHNIETV
FT                   PRMYRLARPQGIYERSLELLQRVREQWPKAYSKSGLMVGLGETDEEIIETLRDLRKHKV
FT                   DIVTIGQYLSPGPKHLAVDRFVSPAQFETYRTVGEEELGFLQVVSTPLTRSSYHAGEVQ
FT                   RLMASHPR"
FT   gene            336548..336621
FT                   /gene="tRNA-Pro2"
FT                   /locus_tag="Syncc9605_R0009"
FT   tRNA            336548..336621
FT                   /gene="tRNA-Pro2"
FT                   /locus_tag="Syncc9605_R0009"
FT                   /product="tRNA-Pro"
FT   gene            complement(336689..338428)
FT                   /locus_tag="Syncc9605_0329"
FT   CDS_pept        complement(336689..338428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0329"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34105"
FT                   /db_xref="GOA:Q3AMS7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34105.1"
FT                   /translation="MPLLERLLLRGHIDRIKPADQDISTALDGHWTAESVVLFVGAVGA
FT                   VTRLIAARIQGKEKDPAVLVLDPKGEFIIPLLGGHSAGAEQRAREIAMDLGGQAVITGA
FT                   CAHEGRLPLDAFGESWGWKRRGSVVHWRDLMVRQSQGSSISVHQSSGSTAWRGPEGHPL
FT                   LHNIDPKGGPDAADLVIGARRQGDCQWHPATLWIGIGCERNTSVSLVEKAIAEALATAG
FT                   LAEEAVAGMVSAARKSDEPALQHLSQTRAWPFRTFAEHALASIDVPNPSEVVRKEMGTA
FT                   SVAEAAALLAAGEQGHLIQPKRINRPETGEQGAVTVAIAEAALPYAPERGELHLVGSGP
FT                   GDLSLLSGDAKAALSRCCAWVGYSLYLDLLEPLRRLDQVRFDGQLTREWDRCAEALRLA
FT                   QQGAKVALISSGDSGIYGMAGLALELLLQQPEQDRPSFAVHPGISAFQLAAARAGAPLM
FT                   HDFCCVSLSDRLTPWAVIEKRLEAAAAGDFVLALYNPRSKGRDWQLGHAKEILLKHRPP
FT                   TTPVTLARQLGRAEESRELTSLERLEPESVDMLTLVLIGNSSSRADGDWVVTPRGYSGA
FT                   SLQ"
FT   gene            complement(338498..339805)
FT                   /locus_tag="Syncc9605_0330"
FT   CDS_pept        complement(338498..339805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34106"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34106.1"
FT                   /translation="MRRPGLKSIWAVLLVAVLFLGAGLPVHARPGFFNRDSGSAAKPLS
FT                   ISAPSGKLQEVAPPGAVQQLRQNLQQHRPSLRLIDPSNDSIVSSDDLELRLEIDDWPLS
FT                   SDPELGLGPHVVLQIDNRAPLRLSESDGNRLKVRIDDLEAGSHRFSAWAAYPWGEALQA
FT                   PGASVQGRVHLWQKLQGTQPERDAPWLVPVSPAGEQGLQPLLVDWLIWNAPLQNLREGD
FT                   GRWRLRISIDGDSFLVDHKEALWLKGSNGSGSHDIQMELLNGLGEPITPVFNNQLIHLK
FT                   AASGAKPGWMRSRLTDSQLARLSGSPEPEVLEVVEYSPEPPQKTEEKQQKQIEQLRDLS
FT                   QAELKVEDEVDTQTTAAPQPTAPVEKEEREPEPPIAEQQPAEQPSKAETARPTPAPEKQ
FT                   AEPHQPADEEPKLKPSSSLGGSARELLNSDGRLRKP"
FT   sig_peptide     complement(339719..339805)
FT                   /locus_tag="Syncc9605_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            340210..342513
FT                   /locus_tag="Syncc9605_0331"
FT   CDS_pept        340210..342513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0331"
FT                   /product="photosystem I core protein PsaA"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34107"
FT                   /db_xref="GOA:Q3AMS5"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006243"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34107.1"
FT                   /translation="MTISPPERGSDAKSQVEKVDNPATFELFGKPGHFDRALAKGPKTT
FT                   TWVWNLHANAHDFDAHTSDLQEVSRRIFSAHFGHLAVIFIWLSGAFFHGARFSNYSGWL
FT                   ADPTHVKPSAQQVWAVFGQEVLNGDMGAGFQGIQITSGLFQMWRAWGITSETQLMALAI
FT                   GALVMAGLMLNAGVFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWAGHVIHVSAP
FT                   VTKLMDAIDAGQPLVLNGKTIASAADIPLPHEFFNQDLLAQLYPGFSAGVGAFFSGNWA
FT                   AYSDFLTFKGGLNPVTGSLWMTDIAHHHVAIAVMFIVAGHMYRTNWGIGHSIKEIHEGQ
FT                   KGDPLLFPATNGHDGLYDFMTNSWHAQLAVNLAIGGSVSIIVAQHMYAMPPYPYQAIDY
FT                   PTQIGLFTHHIWIGGFLIVGAGAHAAIAMVRDYDPAKHIDNVLDRVLKARDAIISHLNW
FT                   VCIWLGAHSFGLYIHNDTMRALGRPQDMFSDSAISIQPIFAQWIQNVHAAAAGSTAPNA
FT                   LAGVSEVFNGSVVAVGGKVAAAPMPLGTADFMVHHIHAFTIHVTVLILLKGVLYARSSR
FT                   LIPDKANLGFRFSCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDIWG
FT                   TVNADGSVAHITNGNFAQSAITINGWLRDYLWAQAVQVINSYGSNTAAYGIMFLGAHFV
FT                   FAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIA
FT                   TTWAFFHAHILVVG"
FT   gene            342536..344749
FT                   /locus_tag="Syncc9605_0332"
FT   CDS_pept        342536..344749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0332"
FT                   /product="photosystem I core protein PsaB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34108"
FT                   /db_xref="GOA:Q3AMS4"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34108.1"
FT                   /translation="MATKFPSFSQGLAQDPTTRRIWYGIATAHDFESHDGMTEERLYQK
FT                   LFSTHFGHLAIIGLWVSGNLFHIAWQGNFEQWVADPLHVRPIAHAIWDPHFGQGAIDAF
FT                   TQAGASSPVNIAYSGLYHWFYTIGMKTNAELYQGSIFMMILSAWALFAGWLHLQPKFRP
FT                   SLAWFKNAESRLNHHLAVLFGFSSIAWTGHLVHVAIPEARGQHVGWDNFLNVLPHPAGL
FT                   GPFFTGNWGVYAENPDSLNQVFGSSEGAGTAILTFLGGFHPQTEALWLTDIAHHHLAIG
FT                   CIFVIAGHMYRTNFGIGHSIKEILETHNPPKGTPGDLGAGHKGLYDTINNSLHFQLGLA
FT                   LASLGVVTSLVAQHMYSMPSYAFIAKDYTTQAALYTHHQYIAIALMCGAFAHGAIFFIR
FT                   DYDPEANKDNVLARMLEHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILV
FT                   EPVFAQFVQAASGKAMYGMDVLLSNASSSASLAAQNIPGEHYWLDAINGNTDVFLPIGP
FT                   GDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAW
FT                   DAFYLAVFWALNTVGWLTFYWHWKHLAIWSGNVAQFNESSTYLMGWFRDYLWLNSSQLI
FT                   NGYNPFGSNNLAVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHQRSPIANMM
FT                   GYRDKPVALSIVQARVVGLAHFTVGYVLTYAAFLIASTSGKFG"
FT   gene            344815..345645
FT                   /locus_tag="Syncc9605_0333"
FT   CDS_pept        344815..345645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34109"
FT                   /db_xref="GOA:Q3AMS3"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022017"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34109.1"
FT                   /translation="MGIFVVFASEWFCWTALFFSSWPGPCLASSLDGIWLNVGDWEHLQ
FT                   RNVGEWRGWFDSLDRTLQRTKRQPSLLTLEPAPPGVPLNLTLLFWPEEAGLSSPHQPPA
FT                   GEPEKRIVQSFTRLDPDMGVFGTGSFSRGTLYRSTWTKLYAEFGFLHHQRRHRLVLLWD
FT                   GVGQLDRIVLIREFLSGSSAVERPSLEADQLIGDWRCDLPSPGDNICFSAGDLDRWIFL
FT                   PDGGAFLAPAQIDSHQPFSIEALWLSSATRLERISRRYSEHGALMSVDHQLLTR"
FT   gene            complement(345657..346613)
FT                   /locus_tag="Syncc9605_0334"
FT   CDS_pept        complement(345657..346613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34110"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34110.1"
FT                   /translation="MTVTPQASTPTSAQAQFFDYSAAANPLQKGLISRIPYRSFPASFF
FT                   DGSGNELMPLDLSPELDCEGPATGPSLCGNFIRLDQGSLRTHADATSQLFFVARGHGQT
FT                   EACGQIFHWSEGDTFVLPAGGEAIHSSDSHAGLYWVHDAPLLRYLGVSTVKPVFEPCFY
FT                   SHQDARAQLDAIASNPRGANANRVSVLLSNNAFPQTRTITHTLWAMLGILPAGQVQPPH
FT                   RHQSIALDFAVACQPGCYTMIGTELDENGMIRNGHREDWAAGAAFVTPPGYWHSHHNES
FT                   GADAYVLPIQDAGLHTYLRTLDIAFSNRGRANLSNTP"
FT   gene            complement(346703..347827)
FT                   /locus_tag="Syncc9605_0335"
FT   CDS_pept        complement(346703..347827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34111"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34111.1"
FT                   /translation="MSDPPAMARTRRLILHAGTHKTASSDIQCRLRRSASLLADQKIIY
FT                   QFPDEDQWDFKQLVKAMSKERWGPWHSYLKRWSKTDADVLISAEQFGPQLTCVGAVSAL
FT                   QTIAREHGFKLTIVIFIRSQLDYINSRYGYSLKRFYHSKTFAEYVQDVLDGERMIKGKA
FT                   VEIDNRRSDIFDFWNYFSSLLNERNCGLDVRFIPFRQTHPDPFIQFLHSLELDPSLPWA
FT                   EHRESSLNSGTGPRGTWLARELSQRLRHHGISPRAISGSTTIIPKETAFRGWDDGKFWG
FT                   FNAALAHRVQDHFKANNNFFAQAAWGRPWNDVFVHDNGLLNRPENSFVPSGPEETVQMH
FT                   RIADHLLLRIHRRQTHRRLHWLREPIERLMSRVF"
FT   gene            complement(347824..350934)
FT                   /locus_tag="Syncc9605_0336"
FT   CDS_pept        complement(347824..350934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0336"
FT                   /product="putative RND family multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34112"
FT                   /db_xref="GOA:Q3AMS0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34112.1"
FT                   /translation="MRSISQPFLRRPVLTVVCSLLILLAGCTALFGLGLEDLPPLAPTR
FT                   VSVSANFPAASPEVVEQSVTRVLEQQLNGLEGVESISSTSRQGGASISLHFKTGDPELN
FT                   AIKVQNEVNLASRRLPQAVTRQGLQVRRSSEDLLMILGFSHPLDQYVPTFLTGWLDQTL
FT                   RDELLTTPGIGDVQIFGSSELSFRLWLDPQRLEQTNLTLGEVSRALAEQNVLAAIGSIG
FT                   AAPVPAGQVLSLPVEAEGRLRSQSDFENLVLRRLDNGGLLRLKDVGRVALGQRNYGREA
FT                   MNLAGERSVAVGVYQRDGANALDVSRAIKRKLQQLEASFPPGIELSMIVDVADTVQANL
FT                   DRTFITLRDAVLLVLVVLVLFLGRWRLALIPGLAVPVALVGSLSLVKLSGSNLNSLILF
FT                   GLVLATGIVVDDAIVVSEDIAGRIERGTPPEQAAEDAMAELATAVVATSLVLAAVFLPV
FT                   LLIPGSIGRLYQPIALAISGAILFSTLNALSFTPMACARVLGPGGGRLPGAIGKLSRWL
FT                   RHGMQTLQSQYSKQLEHWLQRRRRIALVLLSGLVITASGLAVMPTAFIPDDDQGQIRGY
FT                   FTLPDGASLERSMAVMDDIRRVVSEEPQVRTGNFYAGSSFGQSGEDRGSFYLRLQPLKD
FT                   RPGKEQSSNAIKGRLNRKIQQRIGDARVVLITPPTVRGFSSESGLSLELLDRSGGQFSL
FT                   EQFGQVAQDFIQTAKATERFERVSTRFDASFPRWRLELNRDQLAALDLDYGATLREIGT
FT                   AFGGSYIDDTYDDGRIRSIVLQLDGRERRRPEDLTGLMVRNRSGELVSVASVASLTREE
FT                   GVNNIRHFGLNRAIRITAIPAPTVSSGEAIDALTQAGDRIGGSNIDLAFTGLALEEQRA
FT                   GQVTWVLFALGVTVVYLLLAALYESFIDPLIILLTVPLALLGALIGLKLRGLPLDVYGQ
FT                   MGLLVLVSLAAKNGILIVEFANQRIAAGLPLHEATVVAAVNRMRPILLTAITSLAGFLP
FT                   LLFAQGTGAASRISIGTVVFSGLLVASLLSLYVVPTVYLLLKRWRSA"
FT   sig_peptide     complement(350836..350934)
FT                   /locus_tag="Syncc9605_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.767 at
FT                   residue 33"
FT   gene            complement(351043..351534)
FT                   /locus_tag="Syncc9605_0337"
FT   CDS_pept        complement(351043..351534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0337"
FT                   /product="putative photosystem I reaction center subunit XI
FT                   (PsaL)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34113"
FT                   /db_xref="GOA:Q3AMR9"
FT                   /db_xref="InterPro:IPR003757"
FT                   /db_xref="InterPro:IPR022980"
FT                   /db_xref="InterPro:IPR036592"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34113.1"
FT                   /translation="MTVTPAADPCVGNLATPVNSGYFIKGLINNLPLYRPGISPNFRGL
FT                   ETGAAFGYLLYGPFTICGPLRATEYQQTAGLLAAIGAVHILSLLFLLYNQPGKQPNIPP
FT                   ADVTVENPPADLFTRTGWADFTSGFWLGGCGGAVFAWFLCNTVHVQELFKIAAGVWSVG
FT                   "
FT   gene            351785..352252
FT                   /locus_tag="Syncc9605_0338"
FT   CDS_pept        351785..352252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34114"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34114.1"
FT                   /translation="MQNVLLPGAVVLLTVVLWLRRKPVKPMLSSTDASRVAQINRAQLE
FT                   LVIEPAADGESADDSLESWTAPTTPLERLALERRLKADMEAGPEERLRAVRLAARWGHR
FT                   SALPLLRQALRDSDARVVEEAAAAIAPFRGAPAAAPIRQPARPPRNVSRMR"
FT   gene            complement(352210..353172)
FT                   /locus_tag="Syncc9605_0339"
FT   CDS_pept        complement(352210..353172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0339"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34115"
FT                   /db_xref="GOA:Q3AMR7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34115.1"
FT                   /translation="MSAPLNLSVVVPLYNEEESLPHLVEQLLSALRPTDETFELVLVDD
FT                   GSSDRTAKVLAEVSAEVPEVVAVLLRKNYGQTAAMAAGFDVAGGEVIVSLDGDLQNDPA
FT                   DIPMLLAKLREGYDLVSGWRHQRQDAALQRKLPSQIANRLIGRVTGVRLHDYGCSLKAY
FT                   RREVLSDMRLYGELHRFLPALAFIEGARITEVKVNHQARQFGSSKYGIDRTFRVLMDLL
FT                   TVWFMKRFLTRPMYVFGFGGLLAIAASLVTSTYLFVIKVMGGDIANRPLLTLAVVLGLA
FT                   GIQLFCFGLLGELLIRTYHESQDRPIYRIRETLRGGRAG"
FT   gene            complement(353233..353961)
FT                   /locus_tag="Syncc9605_0340"
FT   CDS_pept        complement(353233..353961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34116"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34116.1"
FT                   /translation="MATLGTLLAPDLIETDSCWQLCTDVNGYSRSDGESLTTQACSGRR
FT                   FRILERQRRRIAVQLLEDGYRCWLALESVLGRAELCAPWRPSPLNVADIERRLPGVLAW
FT                   SETAQKRPNVYLWGGTTEPDMDCSGLMQMAFASQGIWIPRDAYQQERFCKPIAALPNDH
FT                   SLLLPGDLLFFGTRRRCTHVGLHLGDGRYRHSSGQDHGRNGIGVDNLHSSDQHPVACHY
FT                   RAEFRGAGRVVRCHDGSHLS"
FT   gene            353979..354893
FT                   /locus_tag="Syncc9605_0341"
FT   CDS_pept        353979..354893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34117"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34117.1"
FT                   /translation="MAFYRPDPAMAARLEAALDGLDAAGRPGLRNSLAITWVRYDDAAP
FT                   EAGQGSGAFWNQDRILYPASVVKLFYAVAVEQWLQRDLIPESDELQRAVRDMIADSSND
FT                   ATGLVVDLLTGTTSGPALHGERWELWTQQRRLINGWLQSLAWPELEAVNCCQKTWGDGP
FT                   YGREKMFYGADNSNRNGLSTAATARILEAVMTRAVVSPPACHRLQGLLRRSLDQDQRRA
FT                   DPENQVDGFLGEGLPDDALLWSKAGWMSQARHDAAWFQASEQQPPTLLVVFTTGADRAR
FT                   DASLLPELARQLNQFSSSEEPAD"
FT   gene            complement(354910..354998)
FT                   /gene="tRNA-Ser3"
FT                   /locus_tag="Syncc9605_R0010"
FT   tRNA            complement(354910..354998)
FT                   /gene="tRNA-Ser3"
FT                   /locus_tag="Syncc9605_R0010"
FT                   /product="tRNA-Ser"
FT   gene            complement(355477..357396)
FT                   /locus_tag="Syncc9605_0342"
FT   CDS_pept        complement(355477..357396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34118"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34118.1"
FT                   /translation="MNIIIQAGGQGRRLQKYTTNIPKCLISVNENILLYHTINALDKSF
FT                   PGSNFYVVCDYKSEVVSNYFESYPHHLSPQLITPKGIGTCSGINDALSTLNNEPLLIVW
FT                   CDLYFDESSFDNFDITNGENIIGLSSEFTCRWSLNEEGKLLEKSSSTSGVAGVFFFKEP
FT                   IKILENLPPSGEFVRWLSLKNDFKFSGQYIKNTLELGDIKQYEALKTTKQSRCRFFNNV
FT                   IFEDNHVIKECIDSDFEKLIDNEINWYNYVSDQGFKYSPGIFSDSPLTMERIIGDHPDD
FT                   LESNEKILSSCLQSLSTLHKLEKRPADSNDTSSVYIQKTLERVKKVSSLLPIKEKNIII
FT                   NDITYENPFHESCIAYEFDLIKEYLLSTQDDFVPIHGDPTFSNIIYSSRNNKAYFIDPR
FT                   GVFGNSQIFGDRYYDIAKLLYSAEGSYDHFNKKDFELISYSGKEFYLTLPQSKFKQHSH
FT                   IIYGQVERPERLVLIHSLIWFSLCGYVKDHINSIVGAFLKGIMVYNQYKSLLESTERSI
FT                   KLSNLPKTWIFDIDGTLVLHNGHISNENEDFLVGVESFLAENIEKDDVILLTTSRTKEE
FT                   SSLILEKVKQICNCDVRVISSLPFGERLLFNDDKPSGLKTAHAINLQRDSGLENVIIRV
FT                   DQSI"
FT   gene            complement(357498..358118)
FT                   /locus_tag="Syncc9605_0343"
FT   CDS_pept        complement(357498..358118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34119.1"
FT                   /translation="MDKFHQDMKRHPLTLAYANCINELSPCKEPMNIDSIRAMENEILN
FT                   IFTQQNTDLKKDFIDYSSLSSTQEVDHIGLNTIGMLADRLSILCIRLYMNSENILTSEG
FT                   LSDNQIIDIERALTVAKAGTSSTFNKMTIMQDTYMPRSFSEAVMRLAATNLLLWLAQDV
FT                   LYLRGPESLPDEELRKYIIYFAEKNIARNKMIALSNNLFWDIG"
FT   gene            complement(358256..359398)
FT                   /locus_tag="Syncc9605_0344"
FT   CDS_pept        complement(358256..359398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0344"
FT                   /product="Capsular polysaccharide biosynthesis
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34120"
FT                   /db_xref="GOA:Q3AMR2"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34120.1"
FT                   /translation="MNLMKYSNLMEWAIKNHAIFTTNDKHPDSPELKTNFQTIVSGTEV
FT                   TQGILNVNEMPYGLARVKNAVVDGTTGLILTENNDLVYPGLLSDGQIKGPRFIKEQKEA
FT                   NEKITINTPEVEIEDGIIACFGSKYFGHMIVYTVGIVNALIDCPTKDIPFYFISPASKK
FT                   FISEILDTAGIKTNQIRALNKRDRLKFKNLWCPIMPVSYGKGTHHTSTDFLTRFREIAN
FT                   IPQGLPEISSERQRIYIARGDASYRKVLNEKEIIKALEKYSFQTIEASKYSFSELRNIL
FT                   GSAEIIISALGSNMFNCIFAPAHAQVGEFVPDFYKCDPSNMNCVSTVVAGCGQDYWRIN
FT                   CDVIKEEGTKYSKWNFHVPIENVTACVDRMLGNLSPPTTK"
FT   gene            complement(359693..360823)
FT                   /locus_tag="Syncc9605_0345"
FT   CDS_pept        complement(359693..360823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0345"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34121"
FT                   /db_xref="GOA:Q3AMR1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34121.1"
FT                   /translation="MIPELNPRQRAWVEVSPAAIRANARALCQHLGPRTQLMAVVKADG
FT                   YGHGAETVARAALQGGATSLGVATLQEGLELRRAGLEAPVLLLSNLNEPDDLRTCLHWR
FT                   LMPTLSSLRDAQLCNALAADSGRCFDVQLKIDTGMARLGCSLSEGHQTAAVLQSLEHLN
FT                   LEGIYSHLACADEPDDALTSLQQERFVSMLSALPRGGAGITRHLANSAGTLLNRELHHD
FT                   LVRVGLALYGHAPASHLNNVIPLQPALAVRARVSLIRDVIAGTGVSYGHRFITQRPTRL
FT                   AVVGIGYADGVLRSLSGHIHALHSNRQLPQVGAITMDQLLLDATDAAGLEPGDIVTLLG
FT                   QDGDLELSPQNWSDHCGSIPWEILCGFKRRLPRVDV"
FT   gene            360869..361393
FT                   /locus_tag="Syncc9605_0346"
FT   CDS_pept        360869..361393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0346"
FT                   /product="HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34122"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34122.1"
FT                   /translation="MIIIEWAGMGQVLVLNASYEPLNITTWRRAVVMMLKGKAESLEHD
FT                   PCRQLRQGTHLPTVIRLRQYVRVPFRQLPLTRRNLFQRDNHTCQYCGSRDNQLSIDHVI
FT                   PRSRGGGDTWENVTTACLSCNVRKGNRTPKEASMPLSHVPRRPASSLSFEARRQIHSGH
FT                   HQEWAKYVIGA"
FT   gene            complement(361397..362494)
FT                   /locus_tag="Syncc9605_0347"
FT   CDS_pept        complement(361397..362494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0347"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34123"
FT                   /db_xref="GOA:Q3AMQ9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34123.1"
FT                   /translation="MDASTLFTRLETATASFRNLERQLADPDVAADPKRLESIARERSR
FT                   LEPLVLDFEELQRLESERDSARQLLKDSRGDAAMEELAQDELASLQEQHATLTERLTLA
FT                   LLPRDPRDERSVMLEIRAGAGGDEACLWAGDLARMYERYSQKVGWAVQSISCTEADLGG
FT                   FRELILSVRGDSVYSQLKFEAGVHRVQRVPATESQGRVHTSTATVAVMPEADAVEVQLD
FT                   PKDLDISTARSGGAGGQNVNKVETAVDLLHKPTGIRVFCTQERSQLQNRERALEILRAK
FT                   LLEREQAAAAERESSDRRAQVGSGDRSEKIRTYNYKDNRTTDHRLGRNFTLEPVLEGQL
FT                   EDLIGACIAEEQRQKLEALSDQAEA"
FT   gene            complement(362510..362761)
FT                   /locus_tag="Syncc9605_0348"
FT   CDS_pept        complement(362510..362761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0348"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34124"
FT                   /db_xref="GOA:Q3AMQ8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34124.1"
FT                   /translation="MPKPDIHPTWYPDAKVICNGEVVMTTGATQPEIHVDVWSGNHPFF
FT                   TGTQKILDTEGRVDRFMKKYGMGTKKKGADSAKAESKA"
FT   gene            complement(362773..363174)
FT                   /locus_tag="Syncc9605_0349"
FT   CDS_pept        complement(362773..363174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0349"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34125"
FT                   /db_xref="GOA:Q3AMQ7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34125.1"
FT                   /translation="MSNNSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNP
FT                   SYIAAVKAPLETLGLSSEYDILVNVHGGGLTGQSGAIKQGAARALCELSADNRKPLKTE
FT                   GHLSRDPRAKERRKYGLKKARKAPQFSKR"
FT   gene            complement(363171..363623)
FT                   /locus_tag="Syncc9605_0350"
FT   CDS_pept        complement(363171..363623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0350"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34126"
FT                   /db_xref="GOA:Q3AMQ6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34126.1"
FT                   /translation="MNKTSLPPIDSIDRQWYVVDAENQTLGRLATEVAAVLRGKTNPSF
FT                   TPHLDTGDFVVVVNAEKIKVSGRKPQQKLYRRHSGRPGGMKVETFEALQERIPERIVEK
FT                   AIKGMLPHNALGRQMFRKLKVYKGTEHPHAAQKPQPLQLNPSASAQ"
FT   gene            complement(363780..364661)
FT                   /locus_tag="Syncc9605_0351"
FT   CDS_pept        complement(363780..364661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0351"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34127"
FT                   /db_xref="GOA:Q3AMQ5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34127.1"
FT                   /translation="MNTEPSSAGPEPASLQRIALSLQYDGSSFCGWQRQRNGRSVQAVL
FT                   EDAIAQLDPHRPVQTFAAGRTDAGVHAAGQVVHFDCSGPIPARKWAPALNGRLPSTIRV
FT                   RESVARPLDWHACYSATYRRYRYTIHNGRRPNLFLSPWSWHCYQHRLDESRMRDALSSM
FT                   LGLHDFSAFMKAGSRRAHARTTVQEVLVERQGDLLRVEIQASGFLYGMVRLLMAQLVAV
FT                   GEHRLSVAAFEQRWRERRRHEVKEAAPAAGLCLLRAGYAKPIFTKAGWYDSQPWFFLAE
FT                   SDPPTDPPSTPG"
FT   gene            complement(364687..365037)
FT                   /locus_tag="Syncc9605_0352"
FT   CDS_pept        complement(364687..365037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0352"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34128"
FT                   /db_xref="GOA:Q3AMQ4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34128.1"
FT                   /translation="MRHQCRVPQLGRPADQRKAMLRALTTQLIREGRVTTTKARAKALR
FT                   DEAERMITLAKDGSLASRRRAMGYIYDKQLVHALFDKAPNRYSDRKGGYTRITRTVPRR
FT                   GDNAEMAIIELV"
FT   gene            complement(365087..366025)
FT                   /locus_tag="Syncc9605_0353"
FT   CDS_pept        complement(365087..366025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0353"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34129"
FT                   /db_xref="GOA:Q3AMQ3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34129.1"
FT                   /translation="MLQYQIDRIEHQVADDRAQSGVFLIGPLERGQATTLGNALRRVLM
FT                   GGLEGSAVTAIRIAGVNHEYATVPGVREDVLDILLNCKELTVNSRSAELEIGRLVVAGP
FT                   AEVKAGDLQFSSQVQVVDTDRPIATVADGHSLELELHVERGVGYRPVDRHNEETSAIDL
FT                   LQIDAVFMPVTRVNFTIDETAVAEGGSARERLRMEIVTDGSITPDEALAQSANQLIELF
FT                   QPLATVTLVEEVPAEPEPSAEAQIPLEELNLSVRAYNCLKRAQVNSVSDLMGFSYEDLL
FT                   EIKNFGSKSADEVIEALERIGISIPQSRTSA"
FT   gene            complement(366073..366465)
FT                   /locus_tag="Syncc9605_0354"
FT   CDS_pept        complement(366073..366465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0354"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34130"
FT                   /db_xref="GOA:Q3AMQ2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34130.1"
FT                   /translation="MAKTVKKSGPKKAKRNVPNGVAHIQSTFNNTIVSITDTAGEVISW
FT                   SSAGASGFKGARKGTPFAAQTAAEAAARRALDQGMRQIEVLVRGPGSGRETAIRALQVA
FT                   GLEITLIRDVTPLPHNGCRRPKRRRV"
FT   gene            complement(366502..366867)
FT                   /locus_tag="Syncc9605_0355"
FT   CDS_pept        complement(366502..366867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0355"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34131"
FT                   /db_xref="GOA:Q3AMQ1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34131.1"
FT                   /translation="MARIAGVDIPRDKRIEVSLTYIYGVGLTRSQAILAKTGVNPDIRV
FT                   KDLEDGDLQKLRGALENYTVEGDLRRQEGMALKRLQDIGCLRGRRHRMSLPVRGQRTRT
FT                   NARTRRGARKTVAGKKK"
FT   gene            complement(366939..367052)
FT                   /locus_tag="Syncc9605_0356"
FT   CDS_pept        complement(366939..367052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0356"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34132"
FT                   /db_xref="GOA:Q3AMQ0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34132.1"
FT                   /translation="MKVRSSVKKMCDKCRVIRRHGKVMVICANPKHKQRQG"
FT   gene            complement(367099..367650)
FT                   /locus_tag="Syncc9605_0357"
FT   CDS_pept        complement(367099..367650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0357"
FT                   /product="adenylate kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34133"
FT                   /db_xref="GOA:Q3AMP9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34133.1"
FT                   /translation="MKNRLLFLGPPGAGKGTQAARLCDANSMKHLSTGDLLRSEVAAGS
FT                   DLGKEAEAVMNRGELVSDALVLAIVESQMKALTTDGWLLDGFPRTVPQAEALEPLLAEL
FT                   QQPIQAVVLLELDDAVLIERLLARCRADDNEAVIRNRLEVYREKTSPLIRFYSDKGLLV
FT                   SVPAQGTVEEITKRIDSILG"
FT   gene            complement(367703..369022)
FT                   /locus_tag="Syncc9605_0358"
FT   CDS_pept        complement(367703..369022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0358"
FT                   /product="SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34134"
FT                   /db_xref="GOA:Q3AMP8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34134.1"
FT                   /translation="MLVSRGRNPNASEVIGQLITNPGLRSRVLTTLGLLLLVRLGIYIP
FT                   MPGIDREAFKQFIDQGGQLIGFLDIFTGGGISTLGIFALGILPFINASIILQLLTAALP
FT                   QLEDLQKNEGEAGRRKIAQITRYVALGWGLVQSVVFAMILRQYAVEGLSEVTFVVQTAL
FT                   ALVTGSMVVMWLSEVITERGIGQGASLVIFLNIVATLPRTLGATIEAAQTGDRDTVLGI
FT                   IVLVLVFLATIVGIIFVQEGARRIPIVSAKRQVGGPGVLPTRQSYLPLKLNAGGVMPII
FT                   FASALIFLPVTIANLTKSEWLIRAASALNPGAANPWPYALTFFALILGFSYFYSSLTVN
FT                   PSDIATNLKRGGVAIPGVRPGSATATYLSGVQNRLTLLGGLFLGAVAIIPAAVERATNV
FT                   QTFQGLGATSLLILVGVAIDTAKQVQTYVISQRYEGLVRQ"
FT   gene            complement(369127..369582)
FT                   /locus_tag="Syncc9605_0359"
FT   CDS_pept        complement(369127..369582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0359"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34135"
FT                   /db_xref="GOA:Q3AMP7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34135.1"
FT                   /translation="MTLRLDSLKSNKGARRRKLRKGRGIAAGQGASCGFGMRGQKSRSG
FT                   RPTRPGFEGGQMPLYRRVPKLKHFPLVNPKHFTVLNVSALNDLKDGSTVNLDSLVKDGI
FT                   VTSPKHPLKMLGNGELTAKKLTVQAAAFTSSALTKIEAAGGTCDILH"
FT   gene            complement(369589..370233)
FT                   /locus_tag="Syncc9605_0360"
FT   CDS_pept        complement(369589..370233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0360"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34136"
FT                   /db_xref="GOA:Q3AMP6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34136.1"
FT                   /translation="MTDSSPQSNPNAVPGAADVPAAAEGQQQQEQRRGRGDRDGRRGDR
FT                   RGGRRGQERDSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGNEKGQVGVGVGKAGDVI
FT                   GAVRKGVADGKKHLVKVPLTRHNSIPTLSNGRDGAASVLIRPAAPGTGVIAGGSIRTVL
FT                   ELAGIKNVLAKRLGSKTPLNNARAAMVALSLLRTHKETAKERGISLEQIYS"
FT   gene            complement(370248..370616)
FT                   /locus_tag="Syncc9605_0361"
FT   CDS_pept        complement(370248..370616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0361"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34137"
FT                   /db_xref="GOA:Q3AMP5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34137.1"
FT                   /translation="MSQISRKQQTQKRHRRLRRHITGTSDRPRLAVFRSNNHIYAQVID
FT                   DAAQSTLCSASTVDKELRTGLKAPAGSCDASVAVGELVAKRAMAKGIQQVVFDRGGNLY
FT                   HGRIKALADAAREAGLQF"
FT   gene            complement(370650..371195)
FT                   /locus_tag="Syncc9605_0362"
FT   CDS_pept        complement(370650..371195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0362"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34138"
FT                   /db_xref="GOA:Q3AMP4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34138.1"
FT                   /translation="MSRIGKNPVPVPEKVTVSLDGLTVKVKGPKGELERTLPEGVSVSV
FT                   SQDNNTIVVSPTSTKRISRERHGLSRTLVANMIEGVSNGYSKALEIVGVGSRAQVKGKT
FT                   LVVSAGYSHPVEMEAPEGITFKVENNTRVIVSGIDKELVGNEAAKVRAIRPPEPYKGKG
FT                   IKYEGERILRKAGKSGKK"
FT   gene            complement(371210..371611)
FT                   /locus_tag="Syncc9605_0363"
FT   CDS_pept        complement(371210..371611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0363"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34139"
FT                   /db_xref="GOA:Q3AMP3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34139.1"
FT                   /translation="MANHDPISDMLTRIRNASEKRHETTKIPASRMTRSIAKVLQQEGF
FT                   ISEISEQGEGIRTELVLALKYSGKHRLPTIRSMQRVSKPGLRIYKNTRGLPKVLGGLGV
FT                   AIISTSKGVMSDRDARREGVGGEVLCYVY"
FT   gene            complement(371631..372170)
FT                   /locus_tag="Syncc9605_0364"
FT   CDS_pept        complement(371631..372170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0364"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34140"
FT                   /db_xref="GOA:Q3AMP2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34140.1"
FT                   /translation="MSLKKRYRETIQPKLQKDLSLTNIHEVPKVLKVTVNRGLGEAAAN
FT                   AKSLEASVNELAQITGQKVVVTRAKKAIAGFKIRQGMPIGCAVTLRGDRMYAFLERLIN
FT                   LALPRIRDFRGVSPKSFDGRGNYTLGVREQIIFPEISFDKIDAIRGMDITIVTTARSDE
FT                   EGRALLREMGMPFQSN"
FT   gene            complement(372211..372567)
FT                   /locus_tag="Syncc9605_0365"
FT   CDS_pept        complement(372211..372567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0365"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34141"
FT                   /db_xref="GOA:Q3AMP1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34141.1"
FT                   /translation="MATATTKAKATERIKMRIRKGDTVQVIAGKDKGKTGAVLRTLPNE
FT                   NRVVVEGVNMRTRHEKPTQEGETGRIVTEEASLHASNVMLYSTDKKVASRVEIVVEKDG
FT                   TKKRRLKKTGEVLD"
FT   gene            complement(372570..372935)
FT                   /locus_tag="Syncc9605_0366"
FT   CDS_pept        complement(372570..372935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0366"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34142"
FT                   /db_xref="GOA:Q3AMP0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34142.1"
FT                   /translation="MIQQESYLTVADNSGAKRIQCIRVLGTNRRYAHVGDVIVAAVKDA
FT                   APNMGVKKSDVVKAVVVRTKATMRRETGNSIRFDDNAAVIINDDKNPKGTRVFGPVARE
FT                   LRERSFTKIVSLAPEVI"
FT   gene            complement(372932..373228)
FT                   /locus_tag="Syncc9605_0367"
FT   CDS_pept        complement(372932..373228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0367"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34143"
FT                   /db_xref="GOA:Q3AMN9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34143.1"
FT                   /translation="MAVKERIGTVVSDKMEKTVVVAVESRFPHPIYQKTVSRTTRYKAH
FT                   DEDNTCRVGDRVRITETRPMSRQKRWAIAEVLSHSPKAAAEEANKAEAQEVKQ"
FT   gene            complement(373246..373455)
FT                   /locus_tag="Syncc9605_0368"
FT   CDS_pept        complement(373246..373455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0368"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34144"
FT                   /db_xref="GOA:Q3AMN8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34144.1"
FT                   /translation="MARPNAADVRSLSDSDINEQIDGLRRELFQLRFQQATRQLANTHR
FT                   FKEARIKLAQLMTVQSERQRSTAS"
FT   gene            complement(373458..373934)
FT                   /locus_tag="Syncc9605_0369"
FT   CDS_pept        complement(373458..373934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0369"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34145"
FT                   /db_xref="GOA:Q3AMN7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34145.1"
FT                   /translation="MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSR
FT                   QIEASRRAMTRYVKRGGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILF
FT                   EMGGDEITPEIAKEAMRLAQYKLPVKTKFIQLDEQEKSAGAKAPAASEAITVES"
FT   gene            complement(373951..374679)
FT                   /locus_tag="Syncc9605_0370"
FT   CDS_pept        complement(373951..374679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0370"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34146"
FT                   /db_xref="GOA:Q3AMN6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34146.1"
FT                   /translation="MGHKINPTGLRLGITQEHRSRWYASSKNYPALLQEDDRIRKFIHK
FT                   KYGSAGISDVLIARKADQLEVELKTARPGVLVGRQGSGIEELRSGIQKTIGDSSRQVRI
FT                   NVVEVERVDGDAFLLAEYIAQQLEKRVAFRRTIRMAVQRAQRAGVLGLKIQVSGRLNGA
FT                   EIARTEWTREGRVPLHTLRADIDYATKVASTTYGVLGIKVWVFKGEVLSEQAQPMPVGA
FT                   APRRRASRRPQQFEDRSNEG"
FT   gene            complement(374700..375065)
FT                   /locus_tag="Syncc9605_0371"
FT   CDS_pept        complement(374700..375065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0371"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34147"
FT                   /db_xref="GOA:Q3AMN5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34147.1"
FT                   /translation="MTSSTPTAPTAQAHGRFIRGSVSKVRRVLDQIRGRTYRDALIMLE
FT                   FMPYRSTGPITKVLRSAVANAEHNLGLDPSSLVISSATADMGPSMKRYRPRAQGRAYQI
FT                   KKQTCHISIAVAAQTDS"
FT   gene            complement(375069..375344)
FT                   /locus_tag="Syncc9605_0372"
FT   CDS_pept        complement(375069..375344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0372"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34148"
FT                   /db_xref="GOA:Q3AMN4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34148.1"
FT                   /translation="MGRSLKKGPFIADSLLRKVEKQNDNDDKSVIKTWSRASTILPMMI
FT                   GHTIAVHNGRTHVPVFITEQMVGHKLGEFAPTRTFKGHIRDKKGGR"
FT   gene            complement(375380..376243)
FT                   /locus_tag="Syncc9605_0373"
FT   CDS_pept        complement(375380..376243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0373"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34149"
FT                   /db_xref="GOA:Q3AMN3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34149.1"
FT                   /translation="MAIRNFRPYTPGTRTRVVTDFSEITSRKPERTLVVAKHRRKGRNN
FT                   RGVITCRHRGGGHKRLYRVVDFRRNKHGVPAKVAAIHYDPHRNARLALLFYADGEKRYI
FT                   LAPAGVQVGQTVVSGPDAPIENGNAMPLSSVPLGSAVHCVELYAGRGGQMVRTAGASAQ
FT                   VMAKEGDYVALKLPSTEVRLVRRECYATLGEVGNSEMRNTSLGKAGRRRWLGRRPQVRG
FT                   SVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNQYVLRKRRKTSKRS
FT                   RGGRDS"
FT   gene            complement(376259..376561)
FT                   /locus_tag="Syncc9605_0374"
FT   CDS_pept        complement(376259..376561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0374"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34150"
FT                   /db_xref="GOA:Q3AMN2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34150.1"
FT                   /translation="MTERFQGRLADVIRRPLITEKATRALEINQYTFEVDHRAAKPDIK
FT                   AAIEQLFDVKVTGISTMNPPRRSRRMGRFAGKRAQVKKAVVRLAEGNSIQLFPES"
FT   gene            complement(376554..377189)
FT                   /locus_tag="Syncc9605_0375"
FT   CDS_pept        complement(376554..377189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0375"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34151"
FT                   /db_xref="GOA:Q3AMN1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34151.1"
FT                   /translation="MASCVVRDWQGKEAGKATLDLKVAKETTAVDLMHRAVLRQQAHAR
FT                   QGTASTLTRSEVRGGGRKPYKQKGTGRARQGSIRTPLKPGGGIIFGPKPRTYNLAMNRK
FT                   ERRLALRTALMARIDDVTVVQDFGASLEAPKTREITDALGRLGVAAGSKVLIVLTNPSD
FT                   VVRRSVRNLEKVKLISADQLNVFDLLHANALVLGEEALATIQEVYGDD"
FT   gene            complement(377189..377845)
FT                   /locus_tag="Syncc9605_0376"
FT   CDS_pept        complement(377189..377845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0376"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34152"
FT                   /db_xref="GOA:Q3AMN0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34152.1"
FT                   /translation="MSIGILGKKLGMSQFFDEQGRAVPVTLIEAGPCRITQLKNDDTDG
FT                   YSAVQIGFGETREKLINKPAQGHLNKSGEGLLRHLREYRVDSVEGLELGGAITVGDFEA
FT                   GQKVDVSGDTVGRGFAGYQKRHGFSRGPMTHGSKNHREPGSTGAGTTPGRIYPGKRMAG
FT                   RYGGKKITTRGLTILKVDSEHNLLVVKGSVPGKPGALLNIRPALRVGAKPANGGK"
FT   gene            378227..378688
FT                   /locus_tag="Syncc9605_0377"
FT   CDS_pept        378227..378688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0377"
FT                   /product="NADH dehydrogenase I subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34153"
FT                   /db_xref="GOA:Q3AMM9"
FT                   /db_xref="InterPro:IPR020874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34153.1"
FT                   /translation="MPLLLTGQAFRRDLEANGCLAVQAPLEGGAETRLLRRLRGAGYST
FT                   RMTSARGLGDPEVFLTQKHGIRPPHLGHQSVGRGAAVGEVQEVAPQLGDLFESDAPVAL
FT                   WLLEGQVLSRSELLSLCDLCKREPRLRIIVEMGGARSLKWEPMTTYLKA"
FT   gene            378655..379686
FT                   /locus_tag="Syncc9605_0378"
FT   CDS_pept        378655..379686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0378"
FT                   /product="putative LdpA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34154"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34154.1"
FT                   /translation="MGTDDHISEGLTPDDALAQGLWVKLICGASNQDLPAIADLTAVFA
FT                   AVGVHCVDVAADPAVALAARRGLDWAEAQTGRRPWLMVSLSDGTDAHFRKAWFDPGRCP
FT                   VDCPRPCERICPAAAIPPGAGIDQQRCYGCGRCLPACPHGLIEERDHRLAPEQVISLLQ
FT                   SIQPDALEIHTASGHDEGFATLIQSLQQHKVPLRRLAVSSGLEGHGVKADQLADLLWRR
FT                   YSRLRQAGYRPLWQLDGRPMSGDVGAGTARAAVQLWRAMRSLAPPGPLQLAGGTNAATL
FT                   EFLRPTERPAGIAFGGVARRLLMPVLDEAQTRRLALWQWPEGWERALSLARPLVAPWLQ
FT                   RSC"
FT   gene            379709..381349
FT                   /locus_tag="Syncc9605_0379"
FT   CDS_pept        379709..381349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0379"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34155"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34155.1"
FT                   /translation="MGTQRVTDDLDRLLELLPEAVREQLRPVEARQQLLEVVLDLGRVP
FT                   EARYPGRALALGSTPLSREDLAVVVARLGQFGGDNRAGIERTLHRISAIRNRQGDVVGL
FT                   TCRVGRAVFGTVAMVRDLLDGGQSLLLMGRPGVGKTTALREIARVLADELERRVVVIDT
FT                   SNEIAGDGDIPHPAIGRARRMQVARPELQHQTMIEAVENHMPEVIVIDEIGTELEAQAA
FT                   RTIAERGVVLVATAHGNALANLIKNPTLSDLVGGIQAVTLGDEEARRRRSQKTVLERAA
FT                   EPTFPVAVEMHSRQRWAVHTDVAATVDQLLRGLKPRVQERELTPEGGVQLVDPPQSSGL
FT                   LRPPSQRSFADQPVSVPVPMPAASDREVSAAEKPASPETSAEHLQVLCCGVPPRVVEEA
FT                   IRSHGWKARVVEDLSEADVVLSVRLGLSRQPSLRRQVRDLGIPILVIKSDTLPQVTRAM
FT                   ARLLRRQATETAPEVTPPDQASQDDELAALEECRLAVEQVVMPQGRPVELLPRSERVLR
FT                   MQADLVRRYRLRSDVFGEAEMSRLRVFPR"
FT   gene            381452..381523
FT                   /gene="tRNA-Gln1"
FT                   /locus_tag="Syncc9605_R0011"
FT   tRNA            381452..381523
FT                   /gene="tRNA-Gln1"
FT                   /locus_tag="Syncc9605_R0011"
FT                   /product="tRNA-Gln"
FT   gene            381533..382282
FT                   /locus_tag="Syncc9605_0380"
FT   CDS_pept        381533..382282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34156"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34156.1"
FT                   /translation="MNDRPLLVFDFDGVIVDGMAEYWWSAWHACLRLEAAPEGLTPDQV
FT                   PDAFRQLRPWVHQGWEMVLLAAELPVLNLPVWLQSYGEAQASALQRRGWQPEQLQTALD
FT                   ASRDQAVRQNRSAWLALHRPFPGLVERLQQLEAEGVDWSVLTTKTQAFTAELLNGLGLN
FT                   PWRLDGREAGAKPQVLLQLQQQRRLSGFVEDRRATLEAVRLTPGLEQLPCFLVSWGYLR
FT                   PQDQSGLPPGIALLHPDRFRAPLAQWP"
FT   gene            382369..383493
FT                   /locus_tag="Syncc9605_0381"
FT   CDS_pept        382369..383493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0381"
FT                   /product="recA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34157"
FT                   /db_xref="GOA:Q3AMM5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34157.1"
FT                   /translation="MPADMKSGASDPRPSGERDKALNLVLGQIERNFGKGSIMRLGDAS
FT                   RMRVETISTGALTLDLALGGGYPKGRVVEIYGPESSGKTTLTLHAIAEVQKRGGVAAFV
FT                   DAEHALDPVYAASLGVDVENLLVSQPDTGEMALEIVDQLVRSAAVDLVVVDSVAALTPR
FT                   AEIEGEMGDLAVGAQARLMSQAMRKITGNIGKSGCTVIFLNQLRLKIGVTYGNPETTTG
FT                   GNALKFYASVRLDIRRIQTLKKGTEEFGIRAKVKVAKNKVAPPFRIAEFDILFGRGIST
FT                   LGCLLDLAEETGVVVRKGAWYSYEGDNIGQGRDNTISWMEENPDATATIETLVRQKLTE
FT                   GSEVKANSMRPLAAAAKTAAADKSAPAKASEAAA"
FT   gene            complement(383496..383840)
FT                   /locus_tag="Syncc9605_0382"
FT   CDS_pept        complement(383496..383840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34158"
FT                   /db_xref="InterPro:IPR014943"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34158.1"
FT                   /translation="MFPRLAEHYRSVVEDLVMSLQALASSLQSAGFTATCYSCGDGRDG
FT                   HGASFVADIGDGHMVRFLVSDFGISWVESRNGRELVKLEGAEAIQELQRMADLAQEGQV
FT                   RVMQPLAQTA"
FT   gene            complement(383910..384158)
FT                   /locus_tag="Syncc9605_0383"
FT   CDS_pept        complement(383910..384158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34159"
FT                   /db_xref="GOA:Q3AMM3"
FT                   /db_xref="InterPro:IPR021262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34159.1"
FT                   /translation="MGEARRRAAQGLPPRQSKASTKTVDTSPRVVSWLPLTRNQTQQFM
FT                   AVTTRGAWIGIGGMVVLWITVRFIGPAAGWWTLADTP"
FT   gene            complement(384194..385639)
FT                   /locus_tag="Syncc9605_0384"
FT   CDS_pept        complement(384194..385639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34160"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34160.1"
FT                   /translation="MLEAQAHHQIKTLLRQEESDWPHHLTLSRLVARSLRRRDTTLVQL
FT                   PPSSSERWWLGLLVPLCLAPEAGALVLTPPQRRRLLQLELPRLRNQGLRLPCWQGSTPP
FT                   EGPQLWLMDVGELIQAHRDGHLGTRQLLIPEMDQLSRRMRNALTFEIEHQHWDELRQAS
FT                   PQAESGLLELHDRMSRQLFADATRPGGAVRLEGSAGQALRDLLQLLPASPEPWNTLRSI
FT                   NPAEWSQWAELDHRLLQWRWKLAPLEPLQLLRGVLLDHPCLMFSSNGDNARLDLEFEQA
FT                   GVVPDVRASLRERELNEPLPLYAPRRQPLPNTRIYAQHLLEESRRLILGQAGLTLVLIN
FT                   DDQLRRQLTSSLAAEFGRRVLHESTAPESNGVVTCNWDWWLEHQEQLPAPAQLIVAMLP
FT                   IASLDNPLTSARVERLKQQGEDWFRTLLLPEALSLIPAAIAPLRRSGGRLAILDGRLRG
FT                   RSWGDQVLHRLEPWIPLQRLLPD"
FT   gene            385678..386604
FT                   /locus_tag="Syncc9605_0385"
FT   CDS_pept        385678..386604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0385"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34161"
FT                   /db_xref="GOA:Q3AMM1"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34161.1"
FT                   /translation="MAIHPSTWLHDPAGGMAVQPGRVGIVGLGMIGGSLGLDLQARGWT
FT                   VQGLVHRQATADRAMARGLVGAVSTDPSCLSDCDVVILALPIPLLLNPPDELIEALPEA
FT                   AVVTDVGSVKQPVLEAWRQRHPRFVASHPMAGTAQAGVEAGVVDLFRGRPWIATPDAAT
FT                   DPAALAKVRDLAVSVGGHWLTSTAFQHDQAVALISHMPVLVSAALLRAVGDERDPEIRQ
FT                   LAMVLASSGFADTSRVGGGNPELGVAMASTNRDAVLRGLAAYRWSLEQLEDAVLQQSWS
FT                   QLALELRRTQTLRPDFLRAPGEVSSES"
FT   gene            complement(386588..388090)
FT                   /locus_tag="Syncc9605_0386"
FT   CDS_pept        complement(386588..388090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0386"
FT                   /product="phytoene dehydrogenase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34162"
FT                   /db_xref="GOA:Q3AMM0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014104"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34162.1"
FT                   /translation="MRDSSVIVVGGGIAGLTAAALLARDGVDVTLLEAHQQPGGCAGTF
FT                   RRGPWVFDVGATQVAGLEPGGSHARLLKHLNMPLPSAELLDPGCVVDLGDGSPPISLWH
FT                   DPEAWAAERERQFPGSHRFWSLCHQLHSSNWQFASEDPVVTPRSLWDLGTLLRALRPAT
FT                   LASGLFTGLTIADLLRLCGCGDDQRLRRFLDLQLKLYSQEPADRTAALYGATVLHMAQA
FT                   PLGLWHLEGSMQVLSNQLVAAIERDGGTVLMQHRVTKLQPSSSGWQVTISTGKGAEHQR
FT                   SSRDVVCSLPPQCLLELIEPDQLPNGYRKRLDNLHAPSGALVLYGAVRRDALPHPCPGH
FT                   LQRGCASPGPLFVSISREGDGRAPQGQATLIASVFTPTGDWCRLPEPEYQQRKIGMLKL
FT                   IQAELNRWLSLEDDAWLHAELATPRGFAGWTGRPNGMVGGLGQHPSRFGPFGLAGRTPM
FT                   PGLWLCGDSLHPGEGTAGVSLSALNACRQLRAERGQPLSFRS"
FT   sig_peptide     complement(388019..388090)
FT                   /locus_tag="Syncc9605_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.850 at
FT                   residue 24"
FT   gene            388141..389028
FT                   /locus_tag="Syncc9605_0387"
FT   CDS_pept        388141..389028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34163"
FT                   /db_xref="GOA:Q3AML9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34163.1"
FT                   /translation="MNSELRRDLTAEDGPLAGAVITDVSPVGGGFIHQAWKLCLSDGQL
FT                   LFAKSGGASALPLFEVEAEALETLHAQADASFLVVPQPIALAALRHGAVLLLPWLDCGG
FT                   NDQTALGRGLALLHQSSMSSSPARFGWHRDGFIGAGPQLGGWRDDWGSAFVELRLRPQL
FT                   EALDGLQQDSTDLNPLLLRLAEHLNEHQPHPALVHGDLWGGNAASLSDGRGSIFDPASW
FT                   WADREVDLAMTRLFGGFGEAFRSGYRDVLPDAPGADGRVEIYNLYHLLNHANLFGGSYL
FT                   SQCRASLRELARRF"
FT   gene            complement(389032..389418)
FT                   /locus_tag="Syncc9605_0388"
FT   CDS_pept        complement(389032..389418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34164"
FT                   /db_xref="GOA:Q3AML8"
FT                   /db_xref="InterPro:IPR025564"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34164.1"
FT                   /translation="MSDATTEVKDAATTVTTPVDAPSQEDTTSFAERYSDVLGKVNDTL
FT                   DQVDWSQMGRIGKIVGIFAAVIIAQILIKGILDTINLLPIVPGLLELLGVVVVGQWSWK
FT                   NLTTSDKRNALVQRVQTLRKEYLG"
FT   gene            389483..389935
FT                   /locus_tag="Syncc9605_0389"
FT   CDS_pept        389483..389935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34165"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34165.1"
FT                   /translation="MLQIDHRCHTDLRRILLAPHPEEGCALLLGQRTNSGCLRVTTTWP
FT                   CCNVWGRGASGQRPVHDRCRRFLVDPREQLAAQRWARNRHQYCLGVAHSHPASEPVPSP
FT                   HDRQWGEAESVMLILSASLGLRAWWLHGDRSVDEIPIQLWDTHKNA"
FT   gene            389928..391064
FT                   /locus_tag="Syncc9605_0390"
FT   CDS_pept        389928..391064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0390"
FT                   /product="Rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34166"
FT                   /db_xref="GOA:Q3AML6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34166.1"
FT                   /translation="MHDQPMLSADERGRYARHLILPEVGPAGQLRLKEASVLCVGSGGL
FT                   GSPLLLYLAAAGVGRIGIVDGDVVELSNLQRQVIYSSSGVGGSKARSAAARIHDLNPHC
FT                   QVEVHEHMLDVGNALDLIADYDLVCDGTDNFPSRYLINDACVLLGKPLVYGSVQRFDGQ
FT                   VSVFNRTPTSPNYRDLLPEPPPPDAVPSCSEAGVMGVMPGLIGLLQATEAIKLITGIGE
FT                   CLDGRLLVVDALAMRFRELTLRVDPDRAKVESLIDYRQFCRPASSEMEAITVTELKALL
FT                   DSAPDEIALVDVRNPAEAEMASIEGSHLVPLASLESGEAIDRVRALAEGRRLLVHCKLG
FT                   GRSARAVELLAQQGIAATNVTGGIDAWSQQVDPAIPRY"
FT   gene            complement(391074..392222)
FT                   /locus_tag="Syncc9605_0391"
FT   CDS_pept        complement(391074..392222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34167"
FT                   /db_xref="GOA:Q3AML5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34167.1"
FT                   /translation="MPRSIGIVTAADSRERSHGQLHIYDGEGKGKSQAALGVVLRTIGL
FT                   GICEQRQTRVLLLRFLKGPGRAYDEDAAIEALQQGFPHLIDHLRTGRADHFTAEEATRF
FT                   DRDEAQRGWVIAKGAIASALYSVVVLDELNPVLDLGLLDLEDVVRTLSNRPEGMEIIIT
FT                   GRAAPAPLVREADLHSEMRAHRRPGMNDNRVVPLNVSSGIEIYTGEGKGKSTSALGKAL
FT                   QAIGRGISQDKSHRVLILQWLKGGSGYTEDAAIAALRESYPHLVDHLRSGRDAIVWRGQ
FT                   QEPIDYVEAERAWEIARAAISSGLYKTVILDELNPTVDLELLPVEPILQTLLRKPAETE
FT                   VIITGRCKNPPAYFDLASIHSEMVCHKHYAEQGVDLKRGVDY"
FT   gene            392276..393103
FT                   /locus_tag="Syncc9605_0392"
FT   CDS_pept        392276..393103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34168"
FT                   /db_xref="GOA:Q3AML4"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34168.1"
FT                   /translation="MFRLQEPLADRERQLLADLRHWMAAQSALCVAYSGGVDSTLVAAM
FT                   AYEAKGDAALAVTGVSPALAPHLLREARNQASWIGIAHRECATAELNDPDYSSNPVDRC
FT                   FACKRELHHHLQPIAAAAGDALVIDGVNLDDLGDHRPGIDAAREAGVRSPLAELSIDKA
FT                   AIRALSRALGFPWWDKPAQPCLASRFPYGESISADRLKRVGQAEAWLIARGFSTVRVRS
FT                   HGLAARIEVPSEQIRAVLALAESEPLVEAFRSLGFTSVNLDLEGLISGKLNRR"
FT   gene            complement(393120..393587)
FT                   /locus_tag="Syncc9605_0393"
FT   CDS_pept        complement(393120..393587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0393"
FT                   /product="Adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34169"
FT                   /db_xref="GOA:Q3AML3"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34169.1"
FT                   /translation="MEQTLSELHPNPGWGAPEIHATDMVGKHCILELYDCDPSRLDDEA
FT                   FIRTTITSAAKGASATLLNLITHQFQPQGVTGLALLAESHISIHTWPESGYAAVDVFTC
FT                   GDHTMPEQACAIFCSELQAKRHALKSFLRETPAAIATGVREPVETPSQLAS"
FT   gene            complement(393619..394713)
FT                   /locus_tag="Syncc9605_0394"
FT   CDS_pept        complement(393619..394713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0394"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34170"
FT                   /db_xref="GOA:Q3AML2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AML2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34170.1"
FT                   /translation="MQGFRNHTVLQLELTQPRLLVIGPNGIGKSNLLEAVELLGSLRSH
FT                   RCSNDRDLIQWDTPQALIRADVGDGDRLELELRRQGGRQARRNGKLLDRQLDLIGPLRC
FT                   IGFSALDLDLVRGEPALRRQWLDRVVLQLEPVYADLMARLNRLLRQRSQLWRQRQISSG
FT                   ERHALLEAFDVQMALVSTRIHRRRQRALHRLEPIAQRWQTHLSGGTETLELHYKPGSRL
FT                   DGEDAEEPWRLAIEEQLRQQREEEERLGSCRVGPHRDEIALLLGGSPARRFGSAGQQRS
FT                   LVLGLKLAELELVTQLCGEPPLLLLDDVLAELDPTRQQLLLEAVGESHQCLVSATHLEG
FT                   FGGGWQQQAQILGARELRPDLKIG"
FT   gene            394817..394890
FT                   /gene="tRNA-Arg4"
FT                   /locus_tag="Syncc9605_R0012"
FT   tRNA            394817..394890
FT                   /gene="tRNA-Arg4"
FT                   /locus_tag="Syncc9605_R0012"
FT                   /product="tRNA-Arg"
FT   gene            complement(394907..395362)
FT                   /locus_tag="Syncc9605_0395"
FT   CDS_pept        complement(394907..395362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34171.1"
FT                   /translation="MLSFLQQPSIPPLPEGTRLETSTPPTSQQLNTLLMSCGESTHPEE
FT                   RWELALQRSLWQISILEESTGELIGFVRATSDLALNANLWNLAAKPGPNQGALFAVLVH
FT                   RALQILRRDLPGCSLSISAPAAALEALKQQGFLIDPNGIRAMGLSLN"
FT   gene            complement(395369..398362)
FT                   /locus_tag="Syncc9605_0396"
FT   CDS_pept        complement(395369..398362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0396"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34172"
FT                   /db_xref="GOA:Q3AML0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AML0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34172.1"
FT                   /translation="MPESTTPVSEQETARMSGGGSGAGQLLQHRLDLIEDLWKSVLRSE
FT                   CPPEQSERLLRLKQLSDPVSLEGRDGNSTSEAIVELIKAMDLSEAISAARAFSLYFQLI
FT                   NILEQRIEEDSYLDSLRPNPSADAAHRDAFDPFAPPLANQTDPATFGEVFERLRRMNVP
FT                   PAQVEHLLRELDIRLVFTAHPTEIVRHTVRHKIRRVANLLQQLQSDAPLAHQMREECRG
FT                   QLEEEIRLWWRTDELHQFKPTVIDEVDSTLHYFQQVLFDAMPTLRRRLITALHRHYPDV
FT                   QVPQASFCTFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLELYISSVQSLRQQLSISM
FT                   QWSQVAPSLLESLEMDRLRFPEIYERRAARYRLEPYRLKLCYVLEKLERTLARNNQLSE
FT                   AGWQMPCEALADPQAGLSGAEVLHYTSVDQFRSDLELVRNSLVSTELSCEQLDTLLHQV
FT                   HIFGFSLASLDIRQESTRHSDAIDELTRNLDLPQAYGDMDEAERMAWLLQELQTRRPLI
FT                   PPAASWSAATAETLAVFRMLQRLQEEFGPRICNSYVISMSHTASDLLEVLLLAKEAGLV
FT                   DPPNKRASLLVVPLFETVEDLQRAPEVMEGLFKTPLYRELLPVVGQQKQPLQELMLGYS
FT                   DSNKDSGFLSSNWEIHQAQIALQELASRQDVALRLFHGRGGSVSRGGGPAYQAILAQPS
FT                   GTLQGRIKITEQGEVLASKYSLPELALYNLETVTTAVVQNSLVTNQLDATPSWNQLMSR
FT                   LATRSRDHYRALVHDNPDLVAFFQQVTPIEEISKLQISSRPARRKTGAKDLSSLRAIPW
FT                   VFGWTQSRFLLPSWFGFGTALTEEVGGDSEQLDLLRRLHQRWPFFRMLISKVEMTLSKV
FT                   DLDLAHHYMNSLGHPEQREAFEAIFQVIAKEYELTRKLVLEITGQNRLLGADQGLQLSV
FT                   DLRNRTIVPLGFLQVALLKRLRDQNRQPPMSETPGAPEDTRTYSRSELLRGALLTLNGI
FT                   AAGMRNTG"
FT   gene            complement(398395..399555)
FT                   /locus_tag="Syncc9605_0397"
FT   CDS_pept        complement(398395..399555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0397"
FT                   /product="Glutamate--cysteine ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34173"
FT                   /db_xref="GOA:Q3AMK9"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34173.1"
FT                   /translation="MPESAGMTAQPLLLKGFEVELFTGRTNGANVGVASDVARDLPGFV
FT                   TEPDCRNLEYVTDPIRDYAALPEALLAPRRTLRQWLQKRDLTLLPGSTMSLGDSSRFER
FT                   SDPDNAYHALIEQLYGTRVVTASIHINLGITDLNWLFAAVRLVRCEAALLLALSASSPF
FT                   LDGRNTSHHSQRWHQFPLTPPAVPLFRDHEHYIQWVEEQLATGGMRNERHLWTSVRPNG
FT                   PRRPYDLNRLELRICDLVTNPDELLAITCLLELRLLALKTNIESLDPLRSSSLSADELV
FT                   QLADSNDAAVARSSLNAELRHWQDGRAINCRDWLMELLDQLAPLAESLQLSACLKPLDS
FT                   LLVHGNQAMRWETAHGQGQSIEDLLQKGIQRMEEEERISTGEACLG"
FT   gene            complement(399534..401051)
FT                   /locus_tag="Syncc9605_0398"
FT   CDS_pept        complement(399534..401051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0398"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34174"
FT                   /db_xref="GOA:Q3AMK8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34174.1"
FT                   /translation="MFSPDRDAFHQAVCSGANLIPLAQSWPADLETPLTTWIKVGDGRP
FT                   PGVLLESVEGGETLGRWSVIACDPLWTASARNDCLTRTWRDGREEQFSGNPFESLRDCL
FT                   APYSCVNLPGLPPLGQLYGVWGYELIQWIEPTVAVHPRVAADPPDGIWMLMDAILIFDQ
FT                   VKRQITAVAFGDLSNRVDEEQAWETAIGRIEALRQRMNAPLPAVKPLTWDARSKELPAV
FT                   RSNRSRDEFEAAVDTAKEHIAAGDVFQLVISQRLETEVPQSPLELYRSLRMVNPSPYMA
FT                   FFDFGDWQLIGSSPEVMVQAEPAADGIHASLRPIAGTRPRGATPLEDRELEADLLADPK
FT                   ERAEHVMLVDLGRNDLGRVCQPGSVAVQDLMVIERYSHVMHIVSQVEGRLGPAHDVWDL
FT                   LMAAFPAGTVSGAPKIRAMQLIHELEPDARGPYSGVYGSVDLAGALNTAITIRTMVVQP
FT                   RDGGGCRVKVQAGAGVVADSQPTAEFEETLNKARGMLTALACLNPPE"
FT   gene            complement(401112..401543)
FT                   /locus_tag="Syncc9605_0399"
FT   CDS_pept        complement(401112..401543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0399"
FT                   /product="photosystem I reaction center subunit II (PsaD)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34175"
FT                   /db_xref="GOA:Q3AMK7"
FT                   /db_xref="InterPro:IPR003685"
FT                   /db_xref="InterPro:IPR036579"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34175.1"
FT                   /translation="MAATALNGQLPQHIASTGGLLNSAETEEKYAITWTSKTEQAFELP
FT                   TGGAALMNSGENLMYFARKEQCLALGTQLRTKFKPRIEDYKIYRIYPGGDTEFLHPKDG
FT                   VFSEKVNEGRPMVGHNPRRIGQNVNPANIKFSGRNTFDA"
FT   gene            complement(401646..402995)
FT                   /locus_tag="Syncc9605_0400"
FT   CDS_pept        complement(401646..402995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34176"
FT                   /db_xref="GOA:Q3AMK6"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34176.1"
FT                   /translation="MTGPSFTALRQRLAQDVPQGRCDEIGVRRLWWAALETLQQDLLER
FT                   GLERGIWLAAPLPALYEPELLQHLQGWVWAPDQLDQLSPHPTALPGRSSSDEPGSLRGF
FT                   QRLSLGPDDGDDPLLLVITPEVQVALALHGPAQKRQLLMRCDPATLSDVLVQLGGRLEH
FT                   QSPAQAEQLRKALESIGSLQSNAAWSEQFWPRLTERLTGTAPGLMLQPIQAERPPEAPS
FT                   HGDLNLLEAITHEVRTPLATIRTLIRSLLRRKDLADVVVNRLRQIDVECSEQIDRFGLI
FT                   FHAAELQREPNEANLARTDLQAMLSALAPSWTEQLDRRGIALELDLSADLPAILSDSRR
FT                   LEPMLGGLIDRSTRGLPSGSQLTLHLQAAGPRVKLQLHVEHPDRSQATEAGSEPQRENV
FT                   GTVLSWDPSTGSLQLSQDATRQMMASLGGRYQPKRDRDITVFFPVHTPGE"
FT   gene            complement(402992..404230)
FT                   /locus_tag="Syncc9605_0401"
FT   CDS_pept        complement(402992..404230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0401"
FT                   /product="cell division protein possibly involved in shape
FT                   determination"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34177"
FT                   /db_xref="GOA:Q3AMK5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34177.1"
FT                   /translation="MFSRRDRRRSHREWVLWGVPLGMIAIAGVLIASTQRQADYADWYH
FT                   HWITAAFGVLLALGLERLPLQRLRPLLVPVYALTLISLIAVRVIGTTALGAQRWISIGG
FT                   VHVQPSEFAKIAAILLVAAVLSRHPVERPIDLMRPLGVIAVPWLLVFIQPDLGTSLVFG
FT                   ALMLTMLYWSGMPVEWVILLLSPLVTALLSGLLPWAMALWILLMGVLAYRSLPWKRLAA
FT                   TATLAIHGAMAAVTPWLWMHGLKDYQRDRLVLFLDPSQDPLGGGYHLLQSTVGIGSGGV
FT                   LGTGLLQGQLTKLRFIPEQHTDFIFSALGEETGFVGCLLVVLGFAALMARLLQIARNAR
FT                   TDFESLVVIGIGTMLMFQVVVNIFMTIGLGPVTGIPLPFLSYGRSAMVVNFIALGLCLS
FT                   VVRQSRRSLAQLR"
FT   sig_peptide     complement(404114..404230)
FT                   /locus_tag="Syncc9605_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.540 at
FT                   residue 39"
FT   gene            complement(404233..405309)
FT                   /locus_tag="Syncc9605_0402"
FT   CDS_pept        complement(404233..405309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0402"
FT                   /product="MRP protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34178"
FT                   /db_xref="GOA:Q3AMK4"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34178.1"
FT                   /translation="MTPVEQANKALQQVKDAGSGKTALELGWIEQIRITPPRAVFRLSL
FT                   PGFAQSQRDRIVAEARGALMALDGIEDVQIEIGQPPSQGGIGQAGHGQPAERQSIPGVR
FT                   QVIAVSSGKGGVGKSTVAVNLACALAQTGLRVGLLDADIYGPNAPTMLGVADQTPEVQG
FT                   SGDQQRIVPIETCGIAMVSMGLLIDDHQPVIWRGPMLNGIIRQFLYQAEWGERDVLIVD
FT                   LPPGTGDAQLSLAQAVPMAGVVIVTTPQQVSLQDARRGLAMFRQMGIPVLGVVENMSAF
FT                   IPPDRPDCRYALFGSGGGAQLASDYDVPLLAQIPMEMPVQEGGDTGRPIVINRSDSASA
FT                   AEFKGLAEAVLKAVTQTV"
FT   gene            405425..406513
FT                   /locus_tag="Syncc9605_0403"
FT   CDS_pept        405425..406513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0403"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34179"
FT                   /db_xref="GOA:Q3AMK3"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34179.1"
FT                   /translation="MVRSLIRRVLGRQDVGVSNAPLELPPSDSRERARAMVMGLQDQIC
FT                   AGLEALDGEGRFVEESWVRHEGGGGRSRVMREGRVFEQGGVNFSEVQGEELPPSILKQR
FT                   PEAKGHPWFATGTSMVLHPRNPYIPTVHLNYRYFEAGPVWWFGGGADLTPYYPFLDDAR
FT                   HFHRTHQAACDSVHPDLHKVFKPWCDEYFYLKHRGETRGVGGIFYDYQDANGTLYKGQD
FT                   PSGPAAQVSASLGARPLSWEQLFSLGQANGRAFLPAYAPIVEKRHPMAYGDRERDFQLY
FT                   RRGRYVEFNLVWDRGTIFGLQTNGRTESILMSLPPLVRWEYGYTAEAGSREALLTELFT
FT                   KPQDWLGDASLDERCRPHGAIN"
FT   gene            complement(406510..407355)
FT                   /locus_tag="Syncc9605_0404"
FT   CDS_pept        complement(406510..407355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34180"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34180.1"
FT                   /translation="MHLPGWMRRRRVASGLAITGLSLATLAMTKAAEQHNWLGTAEPSN
FT                   EPAEQPAPEPPEPCPEPATPDPLLGPRTKKPGSWVGRSPVQSNLPIVVMAGHADSQGTA
FT                   SPGTPGYAVDQQKRAPMQPGIRDELFWNRQVQAAVVSQGQARGLNIRAYTPPSISISND
FT                   DDPATNWSKAKVFSERGEYVLEIHFDAYRPHGFGSGLIPVLANVRELNVADESLALAFG
FT                   RYPRLFRGGLGGPRRGIGILEIAMLEPPLETKLRDPSSREHTVNCLAERVVNALVQGVS
FT                   "
FT   sig_peptide     complement(407272..407355)
FT                   /locus_tag="Syncc9605_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.511 at
FT                   residue 28"
FT   gene            complement(407359..407913)
FT                   /locus_tag="Syncc9605_0405"
FT   CDS_pept        complement(407359..407913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34181"
FT                   /db_xref="GOA:Q3AMK1"
FT                   /db_xref="InterPro:IPR021919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34181.1"
FT                   /translation="MPAGFQSTLLLTVLLAIGLVFFLRAASKDRTTVVDVMSPQPPITV
FT                   LDGLSTWLEDRGWSRDGGDAERQVLRFKGKVASSQPLAILLSVLAAIGSACFGLVLRQL
FT                   APQLHWWPLLLIGLGPLAGAVYTRRAARTEALELQLLPATEGDGSAIRLRAHRDELIAI
FT                   ELELAETLQLASDGSLLSSPI"
FT   sig_peptide     complement(407836..407913)
FT                   /locus_tag="Syncc9605_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.782 at
FT                   residue 26"
FT   gene            complement(407964..408347)
FT                   /locus_tag="Syncc9605_0406"
FT   CDS_pept        complement(407964..408347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0406"
FT                   /product="possible Pex protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34182"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34182.1"
FT                   /translation="MFSRRKPSRTCLADIEQYFHQPPPQFLDLELAVCWILECLLKDDN
FT                   YPSGLLQKLIREEPQLRLSETVLQQALEFLEQHGSISSYTQRCPSRGRPRRMLHLESDA
FT                   RGEAERLMQPWRSWLDSHRFALN"
FT   gene            408463..409107
FT                   /locus_tag="Syncc9605_0407"
FT   CDS_pept        408463..409107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0407"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34183"
FT                   /db_xref="GOA:Q3AMJ9"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34183.1"
FT                   /translation="MAEKSSSPAEFAVFDRDLDAAWTERYLQSPRLAVDTEAMGLIHGR
FT                   DRLCLVQIADAEDRVACVRIGLGQTEAPNLKRLFEAPTVEKVFHFARFDVAALAAGLSI
FT                   EVNPVFCTKVGSRLGRTYTPRHGLKDLVMELVGVELDKGAQSSDWGRVDELTDAQLAYA
FT                   ANDVRYLLPARERLEQMLRREGRWDLAQRCFQCVPVVAELDRLRFHQIFEH"
FT   gene            complement(409117..409374)
FT                   /locus_tag="Syncc9605_0408"
FT   CDS_pept        complement(409117..409374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34184.1"
FT                   /translation="MAAIQDPTLVKLCAQLASRLSISLASARRQVEQAAAREGHRDVEG
FT                   RRAMAESMLAALDKDNGDHARQLDALLENSEGDGNFILED"
FT   gene            complement(409394..410581)
FT                   /locus_tag="Syncc9605_0409"
FT   CDS_pept        complement(409394..410581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34185"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34185.1"
FT                   /translation="MITLRIIQAVHRRAPRRPLTVLPLVGAGRVFDSAVQQGWLTCLGP
FT                   KAALPSGGFSNQSLRGLLADVRAGLPSLSWSQWRLVCRLGHERQPIVAVGDLLPLLMAW
FT                   SSGAPFGFIGTPKSDYTWLSGPGGAKSDCYHRLKGSEWDPWEWRLMRSRRCQLVAMRDR
FT                   LTARGLQRKGVGALAPGNPMMDGLQIQPLPSALERCRRVLLLCGSRMPEAQRNLQRLVR
FT                   SAMALTGRVPMALLVAVGAQPDAEVLSDSLEQLGFRRSLPPSDLLGAEACWVKGACLVL
FT                   IGRGCFDQWAGWAEAGIANAGTATEQLVGLGIPALSLPGPGPQFKPGFARRQSRLLGGA
FT                   VRPCSDESELTRRLEVLLAEPELRSHLGRIGSQRMGPAGGSDQLARLILDRFNGY"
FT   gene            410669..410739
FT                   /gene="tRNA-Cys1"
FT                   /locus_tag="Syncc9605_R0013"
FT   tRNA            410669..410739
FT                   /gene="tRNA-Cys1"
FT                   /locus_tag="Syncc9605_R0013"
FT                   /product="tRNA-Cys"
FT   gene            complement(410751..411248)
FT                   /locus_tag="Syncc9605_0410"
FT   CDS_pept        complement(410751..411248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34186"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34186.1"
FT                   /translation="MRRRQRLLMIQLWMAPLLLAVPAAAEPKLSFGRLEQSPAHCRIVV
FT                   GGRSLACERLQISANGSSGLRLRFIGDDQTTGGSYQLSFVSLDEDHGNPLSCDNSGCRV
FT                   DSRRWSGSLLSTSWVRFDARGLPTGLPATRMAEGRCWIAAGTVSCESHSRNVAEMSAEA
FT                   QL"
FT   sig_peptide     complement(411171..411248)
FT                   /locus_tag="Syncc9605_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(411224..411382)
FT                   /locus_tag="Syncc9605_0411"
FT   CDS_pept        complement(411224..411382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34187.1"
FT                   /translation="MTASPAQEPARSTDQAVEGSNLEEERILCNHCRRTASNGIRCLGM
FT                   CVADSDY"
FT   gene            411411..412397
FT                   /locus_tag="Syncc9605_0412"
FT   CDS_pept        411411..412397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34188"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34188.1"
FT                   /translation="MAGSSIAPLNGIGFGTWAWGNKAVWGYDAQRDDNRLRATFRQALS
FT                   SGLNLIDTADSYGTGSLSGRSEALLGDFIAELPALRRSQLTVATKLAPFPWRWGRRGFD
FT                   AAFESSRIRLKGQLRRVQLHWSTARYAPWQETGLLDGLAELVLAGRVDELGVSNLGPQR
FT                   LVLLHRRLLERGVSLRSIQVQCSLLAPADDQLRELIAVSRDLGVEVLAYSPLAFGVLGC
FT                   APGAEEKRSATWLRRRLFQRLLPASLELRSAVQAIASERGASMVQVALNWCRALGTTPI
FT                   PGLRTPEQARDVSTALEWSMSQHELQTLDAARLRCSERMPANPFQSR"
FT   gene            complement(412407..413039)
FT                   /locus_tag="Syncc9605_0413"
FT   CDS_pept        complement(412407..413039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34189"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34189.1"
FT                   /translation="MPFDKPQRITRRRSSAGPIPPRRPLPSGQVRQQGYRQGARPTFLT
FT                   LRDHGKVFVADMPHLSDGQLAHIGKEAQEVLESLERRIQDMEQELSHGPQERDTLIKAS
FT                   TKRDVTRRFIRAIQDEQEHRQNNPALRSAAGESLPRTFLEVARHRLPGATFDSLLQEAL
FT                   AACAQQQDTPPAPTRLELSQDKVIPIRNDGDSLPVVVSPAPESASEA"
FT   gene            complement(413159..414265)
FT                   /locus_tag="Syncc9605_0414"
FT   CDS_pept        complement(413159..414265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0414"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34190"
FT                   /db_xref="GOA:Q3AMJ2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34190.1"
FT                   /translation="MLCRRNNQHRLRGIAGSMHRIHSMDYKSAGVDVEAGRAFVQRIKA
FT                   SVEATHRPEVIGGLGGFGGLMSLPAGMRKPLLVSGTDGVGTKLELAQEHGSHHGVGIDL
FT                   VAMCVNDVITSGAAPLFFLDYMATGALAPSAMAEVVEGIADGCRQSGCALLGGETAEMP
FT                   GFYPQGRYDIAGFCVAVVEEDELIDGQRIQPGDSVIGVASSGVHSNGFSLVRKVLEKAN
FT                   ADANTVYGDNQRPLIGDLLAPTTLYADLVQHLMQSGCELHGMAHITGGGLPENLPRCLP
FT                   EGCSARIDASSWTRPTLFRWLQEAGNIPERDLWHTFNLGIGFCLVVPARSEDAVIEHCR
FT                   GKNHQAWLIGNVTSNTPGNAAVLEGVPA"
FT   gene            414517..415056
FT                   /locus_tag="Syncc9605_0415"
FT   CDS_pept        414517..415056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0415"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34191"
FT                   /db_xref="GOA:Q3AMJ1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34191.1"
FT                   /translation="MRVLLTLATLSGAISGSAALLPVVACDFLSVNGAEPLDPLDLVVE
FT                   PQAPELQATLPSAEVKPVLAPPSSELPKPKLKVVPEVVKVITGEASWYGPGFYGNRTAN
FT                   GEVYRRGTMTAAHRALPFGTKVRVTNLWNGRTAVIRINDRGPFIDHRVIDLGHGAASDL
FT                   GLTASGIAQVKLEVLR"
FT   sig_peptide     414517..414594
FT                   /locus_tag="Syncc9605_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.919 at
FT                   residue 26"
FT   gene            415128..416570
FT                   /locus_tag="Syncc9605_0416"
FT   CDS_pept        415128..416570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0416"
FT                   /product="pantoate-beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34192"
FT                   /db_xref="GOA:Q3AMJ0"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34192.1"
FT                   /translation="MPTMGGLHQGHGELIRRASEQGPVLVSVFVNPLQFGPAEDFDRYP
FT                   RTLEADRGLAECCGAHALWAPSVDAIYPSGLPSAVSRSAPAGLQTHLCGASRPGHFDGV
FT                   VTVVARLLQLVEPSCLWLGEKDWQQLVILRRLVVDLDLGVVVKGVPTVRESDGLALSSR
FT                   NQYLFPADRARAAALPAALRHADPSDPESSVRQSLAKAGLEVEYVERVDPRTLQPCGPE
FT                   TAISLLAAAVRCGTTRLIDHVFLMTRQPLVAIDGPAGAGKSTVTRAFAERMGLVYLDTG
FT                   AMYRSVTWLVQQNGVDHQDAVSIAPLLNDLDLQLKSLPGGGQQVLVNGQDVSDAIRSPE
FT                   VTASVSAVAAHRCVRQALTAQQKAMGAKGGLVAEGRDIGTAVFPDADLKVFLTATVGER
FT                   ARRRALDLEQRGFPVPERSELEAQIAERDHLDSTREEAPLVQADDALELVTDGMSIEAV
FT                   IDALVGQFRSRVGEEAWPTPAG"
FT   gene            complement(416554..417030)
FT                   /locus_tag="Syncc9605_0417"
FT   CDS_pept        complement(416554..417030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0417"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34193"
FT                   /db_xref="GOA:Q3AMI9"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34193.1"
FT                   /translation="MIKVLFVCLGNICRSPAAEGVFLHLLEERGLSDQFVVDSAGTGGW
FT                   HVGNPADRRMQAAANRRGINLPSRARQISLDDFSSFDLVLTMDDDNLTAVQGLAREAGP
FT                   RATASIKPMLSYARGFSETEVPDPYYGGEAGFEHVLDLLEDACANLLDELSPLA"
FT   gene            complement(417023..418501)
FT                   /locus_tag="Syncc9605_0418"
FT   CDS_pept        complement(417023..418501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0418"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34194"
FT                   /db_xref="GOA:Q3AMI8"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34194.1"
FT                   /translation="MPETVGQAYRMQRKFFLNKTTLIPIDSVTSALEALDHQDAGVRYH
FT                   GAWWLGKNRSVEGVPRLVECLLDERDKTCTGGYPLRRQAARSLGMIKDSRCLPELLKTL
FT                   ETNDVQLHEATLRALIEIKSDQCSSSLISYLDRDIPNKPIEALIEALTEQKLWDVAEKI
FT                   QPFLKDKSERIVGSAAAFFYSYTGEMTYLNKVISLLDHQNRFIRQSAAFDLARIGPIKA
FT                   ADPILIAKIPNNVKMFAVKAILNKSLSFCNQADSTPENDLESIHFSLFKALDNLARDNF
FT                   SGNLLIEEDNQIPETYAGGDSTQGDLLSDALENLRSPSLTRRKTGIKQLILGADHFKID
FT                   LLDLYFSESDQDITMGLIKAMAELKNPHYANALVNAIGVEIGNHCQGNIRRVAACALGD
FT                   INWDEWLSSHSLHTVFNKLEWTLHSPEDWGLRYSACLALEGIGNANSIEILSEAKAKET
FT                   DPVLSARLDKAILKSKGKTSIHQVEHNKISKGND"
FT   gene            complement(418543..419169)
FT                   /locus_tag="Syncc9605_0419"
FT   CDS_pept        complement(418543..419169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34195"
FT                   /db_xref="GOA:Q3AMI7"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34195.1"
FT                   /translation="MGGFFIVQTAWARILKMTPTEQNFLSLLCGEYSNQQQALDNPPFF
FT                   AHIFLRYRPLEHLQEGSILLEQSYAVDPKHPYRLRMIRAEEQSPGIIKLWNHTFREPSR
FT                   FSGATFDKYCRQTIQKSDLICLDQCHYQVEYKSGGYYGSIEPGCRCMVTRNGQETVLAS
FT                   TFHLQEDTLKTLDRGHDPKTNERVWGAIAGEFKFRRTKSWEAKWE"
FT   gene            complement(419201..419689)
FT                   /locus_tag="Syncc9605_0420"
FT   CDS_pept        complement(419201..419689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0420"
FT                   /product="phycocyanin, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34196"
FT                   /db_xref="GOA:Q3AMI6"
FT                   /db_xref="InterPro:IPR006246"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34196.1"
FT                   /translation="MKTPLTEAVAAADSQGRFLSNTEVQAASGRFNRAKASLEAAKALT
FT                   GKADSLVNGAAQAVYTKFPYTTQMAGPNYSATPEGKAKCSRDVGYYLRMITYCLVAGGT
FT                   GPMDDYLIAGLAEINRTFELSPSWYVEALKHIKANHGLSGDAATEANSYIDYAINALT"
FT   gene            complement(419727..420245)
FT                   /locus_tag="Syncc9605_0421"
FT   CDS_pept        complement(419727..420245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0421"
FT                   /product="phycocyanin, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34197"
FT                   /db_xref="GOA:Q3AMI5"
FT                   /db_xref="InterPro:IPR006247"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34197.1"
FT                   /translation="MFDAFTKVVAQADARGQFISTSEIDALAAMVSDSNKRLDAVNRIS
FT                   SNASSIVASAARQLFAQQPSLISPGGNAYTSRRMAACLRDMEIILRYVTYSAFTGDSSV
FT                   MEDRCLNGLRETYLALGTPGASVAAGVNLMKEAALALVNDKAGISAGDCASLNSEIGTY
FT                   FDKAAASVA"
FT   gene            complement(420382..421197)
FT                   /locus_tag="Syncc9605_0422"
FT   CDS_pept        complement(420382..421197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0422"
FT                   /product="phycoerythrobilin:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34198"
FT                   /db_xref="GOA:Q3AMI4"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR022827"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34198.1"
FT                   /translation="MTLPLRTTSLDPVQIPGWRWQPFLDTAVAALSSLQPDPYPIAERF
FT                   LQKEGSTGSKAKPVPVRTATWACSTEKLRQVRCACVEAGAAASVLNFVINPSSRFDLPF
FT                   FGADLVTLPNGHLLALDLQPVDKTDPDHTGPVWQRLMPLFERWRAQLPDGGPIPEEAQP
FT                   YFSPAFLWTRIPLGEEGDALIDRVIRPAFADYLQLYLALVEEAQPVDHERAAHLLLGQK
FT                   RYTAYRAEKDPARGMLTRFYGSEWTESYIHGVLFDLEEATATSLSPQGS"
FT   gene            complement(421194..421901)
FT                   /locus_tag="Syncc9605_0423"
FT   CDS_pept        complement(421194..421901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0423"
FT                   /product="15,16 dihydrobiliverdin:ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34199"
FT                   /db_xref="GOA:Q3AMI3"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR023658"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34199.1"
FT                   /translation="MFDPFLEELLSGIKARGAVPVEVPHGLEHNQSSKRSSTIKSWLWD
FT                   VPGFRRWRVTRLDAGDSLQVLNSVAYPDYTYDHPLMGVDLLWFGAKQKLVAVLDFQPLV
FT                   QDKDYLERYFDGLKSLNAQFPDLNGEETMRSFDPNQYFSSWLLFCRGGAEQATSSLPTA
FT                   FSAFLKTYWDLHDKAVKIPSSINPIEVAQLQKNYDIYSAERDPAHGLFTSHFGSEWSDR
FT                   FLHEFLFPASQPK"
FT   gene            complement(421907..422518)
FT                   /locus_tag="Syncc9605_0424"
FT   CDS_pept        complement(421907..422518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34200"
FT                   /db_xref="GOA:Q3AMI2"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34200.1"
FT                   /translation="MVQTLSPPMTMADFFEASRGTWLNRRAVHHHDYQDDEAADSNLVI
FT                   EPFNADDPVVTKICNSLNIKTEDSSGGARFWWESNIKKGVRNDDYAAVVIDVPDHKDSR
FT                   KGFLLRDVGYVEKQSVLSTYNFADDGVVTITTRYDTNIGIERCWFVTDQIRMRVSSVQC
FT                   LDGVAMTTYCTEFRCPTDAEISDITQRAQQLAMASSTGNN"
FT   gene            complement(422581..422898)
FT                   /locus_tag="Syncc9605_0425"
FT   CDS_pept        complement(422581..422898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34201"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34201.1"
FT                   /translation="MTQTRAKVHKSLGQASDRLRIFWLNQNFMDNAASDLPTLEELQES
FT                   IDELAAYRERLFQDVVGLGKKLRLSQKKIDTTVAAHPELQRLDEVMSQLVAQRNAQQSK
FT                   P"
FT   gene            423124..423678
FT                   /locus_tag="Syncc9605_0426"
FT   CDS_pept        423124..423678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0426"
FT                   /product="C-phycoerythrin class I beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34202"
FT                   /db_xref="GOA:Q3AMI0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34202.1"
FT                   /translation="MLDAFSRTVVSADAKTAPVGGSDLASLRSYVQDGNKRLDAVNAIT
FT                   SNAYCIVSDAVTGMICENTGLIQAGGNCYPTRRMAACLRDGEIVLRYISYALLAGDASV
FT                   LDDRCLNGLKETYIALGVPTQSAARAVAIMKSAATALIGQTNSPASGGAKYRKMETTQG
FT                   DCSALVAEAGSYFDRVIGAIS"
FT   gene            423740..424234
FT                   /locus_tag="Syncc9605_0427"
FT   CDS_pept        423740..424234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0427"
FT                   /product="C-phycoerythrin class I alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34203"
FT                   /db_xref="GOA:Q3AMH9"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34203.1"
FT                   /translation="MKSVVTTVVTAADAAGRFPSQNDLEAVQGNIQRAAARLEAAEKLA
FT                   AGLDNVTREAGDACFNKYAYLRQPGEAGDSQVKVDKCYRDLGHYLRLINYCLIVGGTGP
FT                   LDEWGIAGAREVYRTLGLPTNAYIEALTYTRDRACAPRDMSPQALNEFKSYLDYAINAL
FT                   S"
FT   gene            424369..424803
FT                   /locus_tag="Syncc9605_0428"
FT   CDS_pept        424369..424803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34204"
FT                   /db_xref="InterPro:IPR020325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34204.1"
FT                   /translation="MTTFVLSHNLQVQSDLVPALNFELLAQKLKSLSKKISSTEVLGHP
FT                   HWKLSISSDLSPQDMAVDLVQTWSECRRQLGHDMNHVVLALGGRKDSQASPGAPLQEGY
FT                   WGVDLVETPDESTFLQAINWEALKAGRPEDAIFEVSSRAS"
FT   gene            425302..426627
FT                   /locus_tag="Syncc9605_0429"
FT   CDS_pept        425302..426627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0429"
FT                   /product="putative bilin biosynthesis protein (CpeY)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34205"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34205.1"
FT                   /translation="MTGLFDNIHAGLDQQGAVDILSKEVDNIESESDYYMAVSHLINFP
FT                   GSITSQALLAFLDKCSEDVPVGLAQRKAVEVLARLGVAEATPKIASFLGSSDVYMVENA
FT                   AWALSHLNCQDPEVHQHMIDLLDDASQNQRVLIQSLSKLSVKSAISTISVHTAHEKTSV
FT                   RGAAIAAMIHLSGDQSHLADLSDHLYGSNQMDRQSAVQDVIDANAVELLSDLMEAPISP
FT                   AFRMRAVRSLLNNPSNKLSDNDSLSAVDQVLLDDPRLITVLHHYGDPLPTELLIDGLFH
FT                   PDFSRCYLAMQALIKRDAQEIWSAIENCWQDKAQNDYGAHYFLMRLFGLVEGWTDEALL
FT                   DIRKILSDAITDKRPQFRKSPPAALLSFALLFPGQCDCFLDKCLSLENNLSWGMRYAGL
FT                   LLIQSDQTEHFHLRYQRQLQQLIESDGDRLLRLKAQSILDRG"
FT   gene            426701..427339
FT                   /locus_tag="Syncc9605_0430"
FT   CDS_pept        426701..427339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0430"
FT                   /product="putative bilin biosynthesis protein cpeZ"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34206.1"
FT                   /translation="MNWDSSIPSVDALFEDLMHPNPRIQEEACLILSENYREEALPRLL
FT                   DLFCHHDPKVYRAAVKGVGFFGSSAFDPLIALYATTENQTARRCCPKAFVQVFKNFPDQ
FT                   PFPDSVMEMLEQGIDDSDMVVVQGALMCLGQIGKQQFKSEEAIRILTKSLGSQNVALIF
FT                   SASQALADIPNPLAEDALRALQNNNADPLIQEAAQSALARLQNLLNSKS"
FT   gene            complement(427349..427693)
FT                   /locus_tag="Syncc9605_0431"
FT   CDS_pept        complement(427349..427693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34207"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34207.1"
FT                   /translation="MSRAEFIRFLGVLEEDTTFRSLFREAEPEEILKLADQHGFIFSDE
FT                   IKGRFLNRWAGVYFCPFANDVGRLCPKMVPEGFSTLLHYSQTTCAKDDKVERFDFRAGG
FT                   YYKGVETVAR"
FT   gene            complement(427804..428703)
FT                   /locus_tag="Syncc9605_0432"
FT   CDS_pept        complement(427804..428703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0432"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34208"
FT                   /db_xref="GOA:Q3AMH4"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34208.1"
FT                   /translation="MLQDLTNISSISDSQLTAEEALQLADELSGKLSEGEIPRSDAESL
FT                   KRMVAGLGDARGALRLTFAKSLGAVGDEALPILCKALRQHQNVIVRRASAKTLNLIGNK
FT                   EALPYLLEAFLEDDDPVVLGSSAGAMATIGPDAMDSLLGILKNPDCTPFQVGLINLALS
FT                   FIGSKAPEALLKAADSDVAEVRVAAISALGDQIQKSDDLRAKNRVFQALEDVSADVRAE
FT                   AVTLIGKSCDAEDVETLLLNKLSDEDTQVRKNTALSLMKLDALGAINQLKIAEQNEIDT
FT                   DVKAVLRVAINILSAKTS"
FT   gene            complement(428840..429706)
FT                   /locus_tag="Syncc9605_0433"
FT   CDS_pept        complement(428840..429706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0433"
FT                   /product="C-phycoerythrin class II gamma chain, linker
FT                   polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34209"
FT                   /db_xref="GOA:Q3AMH3"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34209.1"
FT                   /translation="MLSTQTSPAGMASASRTKPASYAMPSKAGKNTVHRTVAGSIAEFK
FT                   RNTCSQMGLGIGPRLHSECPFGAVFDEYHPSDSWALERTINDAYRQVYGNLPPTENERY
FT                   TSLEARLMNGEITVRDFVNGLAKSPFYKDNYFHSVAPQRGIELNFKHLLGRAPLNQEEV
FT                   QNSIKLQAEEGFDALIDSLTDCAEYAEVFGSDIVPYMRAGDSYAGMMTSSFNMMRELAG
FT                   TKVAVSDNAQGSRSRTNTQLAAASISMMKPIFKGAPTLPQQKYGAQQPPKRTGAVPFRP
FT                   FGVKPFA"
FT   gene            complement(430045..430542)
FT                   /locus_tag="Syncc9605_0434"
FT   CDS_pept        complement(430045..430542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0434"
FT                   /product="C-phycoerythrin class II alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34210"
FT                   /db_xref="GOA:Q3AMH2"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34210.1"
FT                   /translation="MKSVITTVVGAADSASRFPTASDMESVQGSIQRASARLEAAEKLA
FT                   SNYDQVAQEAVDAVYAQYPNGATGRQPRKCATEGKEKCKRDFVHYLRLINYCLVTGGTG
FT                   PLDELAINGQKEVYKALSIDAGTYVAGFSHLRSRGCAPRDMSAQALTAYNQLLDYVINS
FT                   LG"
FT   gene            complement(430589..431170)
FT                   /locus_tag="Syncc9605_0435"
FT   CDS_pept        complement(430589..431170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0435"
FT                   /product="C-phycoerythrin class II beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34211"
FT                   /db_xref="GOA:Q3AMH1"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34211.1"
FT                   /translation="MMRNASPQTTYSTTPMLDAFSRAAVSADSSGSFIGGGELASLKSF
FT                   IADGNKRLDAVNAITSNASCIVSDAVAGICCENTGLTAPNGGVYTNRKMAACLRDGEIV
FT                   LRYVSYALLAGDASVLQDRCLNGLRETYAALGVPTGSAARAVAIMKAAASALITNTNSQ
FT                   PKKMALTSGDCASLSGEAASYFDMVISAIS"
FT   gene            complement(431307..432503)
FT                   /locus_tag="Syncc9605_0436"
FT   CDS_pept        complement(431307..432503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0436"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34212"
FT                   /db_xref="GOA:Q3AMH0"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34212.1"
FT                   /translation="MAERFDNLVEGLTEERAMAVILADPDSLERPVDKYMAATRLGASN
FT                   SEESLDVLIQAAELDPEHLFNRITRRKAIDALGRRKSPKALPSLFKALKCSDEAAVINS
FT                   VEAITKIDAPLTEADHRKLLEALEGEDIQKRAVIQAFCRLGVPGVINSISPLQNDSNPL
FT                   VAGAARAYMSKVAQQPNGLEVLIPQLVDPIAGRRRSAVIDLGDAGDVTRLEALVTAPVS
FT                   MSLRARSAFQLVDPDKKCQVPEKYAELITQLLQDNPQQLKLRKEWICDIEPTEIENNLQ
FT                   HRDEARQYGGASSLMGMPKAERMILINEIKEKLWSDYVTHYYLTSVVGLQGLEERSDLI
FT                   RLALAETIPQYTKSRIAAAWGCLRLGLVDQKPLLEELSASAFWLPLKWTCQRVLKQLS"
FT   gene            432753..433073
FT                   /locus_tag="Syncc9605_0437"
FT   CDS_pept        432753..433073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34213"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34213.1"
FT                   /translation="MPVSPELEQALPRFVEAVQKSTDVQDQLNLVVDLEQLKAIVNDVE
FT                   PSLTGSALIPYEQATSPPKITIDSGVLEKNIPWRLLRCPGGPLVLQMICEKVNFALWIE
FT                   SC"
FT   gene            433055..433357
FT                   /locus_tag="Syncc9605_0438"
FT   CDS_pept        433055..433357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34214"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34214.1"
FT                   /translation="MDRKLLTMSDSVIADFVQMVIYDHSVATGLKSCQSDQDIVDFAAS
FT                   RDYLFSITAWLQYVESDSAGLSDSEAMAIQAIATDHWSWAFRQIAPWRAMLMDGA"
FT   gene            complement(433661..433966)
FT                   /locus_tag="Syncc9605_0439"
FT   CDS_pept        complement(433661..433966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0439"
FT                   /product="CpeR-like, phycoerythrin linker-proteins region"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34215"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34215.1"
FT                   /translation="MEDVKKQMKSWIRSQHLICVGTDFIFETVDQTQLDKFEASVQAIG
FT                   GRIRTVKAIGNWPMGPRRSFKILQATASVPRPGGEDIVTYWAKKGSKTTRYSEINS"
FT   gene            complement(433968..434582)
FT                   /locus_tag="Syncc9605_0440"
FT   CDS_pept        complement(433968..434582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0440"
FT                   /product="CpeT-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34216"
FT                   /db_xref="GOA:Q3AMG6"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34216.1"
FT                   /translation="MDKNLALAEFAKTLAGVYDNIEQSQKDPKDFARINIFFRPLPWHI
FT                   FEGPGFYSEQCYDYAPWDPYRQGIHRLTTHEDTFVVENYGFTNPRRLAGAGRDPQIMNA
FT                   INSTTLKERCGCAMHFHRKEKGHYIGKVEPGKNCLVPRDGKLTYLVSEVEVDQENWISR
FT                   DRGFDPNTDEQIWGSEHGLLRFKRTQSFSAEINEEWLNSKT"
FT   gene            complement(434592..435086)
FT                   /locus_tag="Syncc9605_0441"
FT   CDS_pept        complement(434592..435086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0441"
FT                   /product="conserved hypothetical protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34217"
FT                   /db_xref="GOA:Q3AMG5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34217.1"
FT                   /translation="MRSGHSLAFQQFEEVLSEVTIEEISREDSVVKELLESSLVNQYNL
FT                   DTISSPFKMEWRAESDWEPDDPSEVSSGSCIIVPFAKDISSGTLIRSVGYAEAEAAISE
FT                   YKFSNDGTFTLTTNYEQSIAEEKIWFVSENVRCRSSVLRTSAGSGVLQTSFASEVRRIN
FT                   A"
FT   gene            complement(435423..436157)
FT                   /locus_tag="Syncc9605_0442"
FT   CDS_pept        complement(435423..436157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0442"
FT                   /product="possible phycobilisome linker polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34218"
FT                   /db_xref="GOA:Q3AMG4"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34218.1"
FT                   /translation="MTGPTTLSSAANVDTSHASDVVRQAYRQVFGNRHLMELDLNPSIE
FT                   ALFMNGDLTVQGLVTALAQSETYKKLFLESNSPYRFVELNFKHLLGRPPRDQAELMSHV
FT                   RLLQEEGYEAEIASYTYSDEYLSAFGIDQVPYNRATQTVVGGSTLYFTRAKALDAGYAG
FT                   YDNAETDSKLLSSLCTDSSPEAQDRRSVGNAKALTINWTSRRQVGANRRAVQKSVVNQT
FT                   SMSATIKSILSQGGQILSIAKA"
FT   gene            complement(436233..437882)
FT                   /locus_tag="Syncc9605_0443"
FT   CDS_pept        complement(436233..437882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0443"
FT                   /product="phycobilisome linker polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34219"
FT                   /db_xref="GOA:Q3AMG3"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34219.1"
FT                   /translation="MASTQSSLGFGATTKWNDPVRFQRKGGAEQSAALTIGEFLKQSCD
FT                   QMAIGVGPRSHADCPHRVTSECYSPEDDASLETVISASYRQVFGNAHVMDFERCSELEA
FT                   QLRDGRLTVRDFVRGLAKSSFYKDRFFRSVAPQRGVELNFKHLLGRAPETQAEISAKIS
FT                   LLAEHGHDGLVDSIVDSAEYLEVFGSDVVPYARSWSSPADLSTAAFPMLAALQKSFAGS
FT                   DSARGAGPALTRSLANGVAPRISLPSQPVGLRPSSGSFTAKKFSSKAPGITSGKDSAPM
FT                   RGDMYVTFGLGQREQETFQRCPGDGPDQLAALIRSTYKQVMGNPHLMEFERVISAESKF
FT                   IDGYLSTREFVRAVGLSAEYKRRFFETSAPYRFIELNFKHFLGRAPRSQAEISEHTKIL
FT                   AEGGYEAEISSYVDSQEYQNTFGEDTVPFARILTESGRSQVDFNRQLSLAEGYAASDTV
FT                   LGSSALVSSVATGLAPSGWSKTTSRANRTGTQSGAADPTKKRYRIVVASQAARSRQRTA
FT                   GNSYVVSGKDMSSQMKYIHARGGKIVSITEVM"
FT   gene            complement(437938..438822)
FT                   /locus_tag="Syncc9605_0444"
FT   CDS_pept        complement(437938..438822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0444"
FT                   /product="phycobilisome linker polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34220"
FT                   /db_xref="GOA:Q3AMG2"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34220.1"
FT                   /translation="MPFGPASLLGVERFSEESEAPLELIPGDEDARKEQIIRAVYKQVL
FT                   GNAYVMDSERQIVEESQFKLGEISVRELVGRIAKSDLYRSRFFDNCSRYRYIELAFRHL
FT                   LGRAPADYAEMREHADRLDSQGYEADIDSFLNSEEYQNTFGEWTVPYQRGWKTESCATL
FT                   QEFTWSFQLLRGNSSSSLKGDLAGNRSKLGGSAYLNRPLAVVPPSSKETAGWSFRPSTN
FT                   LQDAPTRLGVGAGDQGITYRVEVTAYKANNVRRISRYTRSNRIFYVPFDKLSEQFKRIH
FT                   NEGGKIASITPVT"
FT   gene            complement(438995..439714)
FT                   /locus_tag="Syncc9605_0445"
FT   CDS_pept        complement(438995..439714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34221"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34221.1"
FT                   /translation="MSMPKSGALNLREWKAPETCGATSSAKNPVDARGADWSGQDLGVL
FT                   DLRDAKLCRCDLRGTNLSQCQLEGADLRLARYDQTTLVPEGFALHTSGAVGPGAKLNGA
FT                   FLNSTDLRGMDLRGSVLMGAYLSGSDLSGALLDGVSLAGADLRSATFRGAMCRGTRFGT
FT                   CEMDMADFRGANLEGAALETVTSIRGADFSLCTGLEDQIGALLSRSVQELDCWNPMTRS
FT                   TTRASLESLFKGQGQDA"
FT   gene            complement(439716..440474)
FT                   /locus_tag="Syncc9605_0446"
FT   CDS_pept        complement(439716..440474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0446"
FT                   /product="possible phycobilisome rod-core linker
FT                   polypeptide (L-RC 28.5)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34222"
FT                   /db_xref="GOA:Q3AMG0"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34222.1"
FT                   /translation="MAIPLLGYPLNTQNGRVSNLAGDNSTIKPQTYASSAAGDDSARTE
FT                   MDSLIEQAYRQVFFHAMRSDREPFLESQLRSGNITVRDFIRGLLLSERFQQGYYQCNSN
FT                   YRMVDQVVGRVLGRPTHGDGERRAWSIVIGEKGSTAFVDALLDSPEYMNCFGYDLVPQQ
FT                   RSRMLPGRPLGEIPIYQQFPRYGTDWRDALQDRAPIHQGAPSERLEVAATWVKEEPPAF
FT                   ALKLWLGLFAIGGFEIVRVLLTIVVAMLRN"
FT   gene            complement(440546..441121)
FT                   /locus_tag="Syncc9605_0447"
FT   CDS_pept        complement(440546..441121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0447"
FT                   /product="possible phycobilisome polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34223"
FT                   /db_xref="GOA:Q3AMF9"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34223.1"
FT                   /translation="MNLENTDFKTLVHTAQVQGLSLNQDLPQATRRILERADHARRQLS
FT                   SDELTTICQVSGIDGSLADNLINRSDHLVNQARAHLLEAQPHLVQPGGALHPEDRAEAC
FT                   WRDCWNFLRVITYAVACNQSCFTNPSGMAALRELYRRMNVPIEGMNIALDQLKEKALEG
FT                   VSRSNDRQLIRDCFQHLHDELNKSAVKS"
FT   gene            complement(441118..441543)
FT                   /locus_tag="Syncc9605_0448"
FT   CDS_pept        complement(441118..441543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34224"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34224.1"
FT                   /translation="MSALADPRIATLQNQAGSSGELDLPVGDGCFRINLRDENIALWQE
FT                   TFDQHTTAANLLLACEESNGDLKDTRLTWVVGSAIRTATASSPDAVGWLLTQLGVPTEL
FT                   TEAAISRCPGLGNDLVWAFYLERHGWLIATPVASVNP"
FT   gene            complement(441653..442309)
FT                   /locus_tag="Syncc9605_0449"
FT   CDS_pept        complement(441653..442309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34225"
FT                   /db_xref="GOA:Q3AMF7"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34225.1"
FT                   /translation="MSRLKTGLKVSAWVAIFIVAVVYLQRYGIAPLQSAVNDMGIWAPL
FT                   GLFLLRGVSIILPALPSSVYSLLAGSLLGFKAGYLTIILSDLVFCSAAFFIARRWGRGP
FT                   VSRLVGASAMKRIDGFSKNQLEGNFFLMTGLLMTGLFDFLSYSIGISRTHWRLFAPALL
FT                   ISVLISDSILVAVGAGAAQGASLTLGLALLAMFALATITGVLKKKSSEAPSNNDS"
FT   gene            442351..442857
FT                   /locus_tag="Syncc9605_0450"
FT   CDS_pept        442351..442857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34226"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34226.1"
FT                   /translation="MAFPRAVDTKLSIDTISEISQHEASPVTTTSPRTAFEQQLCTHLL
FT                   SLSEVVETLADRLMELETRLAAVEGQQQEDAEIAAVSDDAGELLLASEEKVRMLRDRLS
FT                   PGEVVELHPDSHAEEAPADEDHDISEALEMARDDDRVEDEAFSDETLSDDTEYVDDPQI
FT                   DLLSA"
FT   gene            complement(442858..443097)
FT                   /locus_tag="Syncc9605_0451"
FT   CDS_pept        complement(442858..443097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34227.1"
FT                   /translation="MSFISPDAGTDRVFDNADSFAMVFDRTWKQLRDRNKTELSQEEHL
FT                   EAVLQAMADHPFLISSPDMARQVAAFRIRLLELA"
FT   gene            complement(443117..443192)
FT                   /gene="tRNA-Phe1"
FT                   /locus_tag="Syncc9605_R0014"
FT   tRNA            complement(443117..443192)
FT                   /gene="tRNA-Phe1"
FT                   /locus_tag="Syncc9605_R0014"
FT                   /product="tRNA-Phe"
FT   gene            444590..445108
FT                   /locus_tag="Syncc9605_0452"
FT   CDS_pept        444590..445108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34228"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34228.1"
FT                   /translation="MTKTEIELLVKAFQVAGIDASKIAPANLFEKSGKVADMLQVAVAE
FT                   IDPLQAAEWRIAADGGLSVATLAELESGQELSQQAQRDLWNHYPQFVADRQQEAARVEA
FT                   QQLAWLDKEADKARRAREGDEAVDFQNAKAQAAAEARAASAKHAADMQRRIDEKRSADA
FT                   RMAGVMTNG"
FT   gene            445101..446183
FT                   /locus_tag="Syncc9605_0453"
FT   CDS_pept        445101..446183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34229.1"
FT                   /translation="MVDAALARARKRALGGVQKVDATASARPAGSSPTTVSGETVRLQT
FT                   GETVPVEFYDLAPTDQRRMLEIVRGQETKKADGNAALTAVNTLLDLRAQDNKRVRSLEA
FT                   QLSTALAVIEAMQKRMDSMDLQVQADKSTALLEQEAGIAAAVTGLSAIRAEAGQEAAQH
FT                   QAEREAAAVEHRQQLEAQAVAIEALQGSVKSTTELMGERSNAVVAAVADAEGRQARLGV
FT                   QLQELEGKTNAWTDPITRSEVTAMATDLVWWPSNGVIRCRRLLMRCWRSWPINSLRGSA
FT                   PRELTQYVRGNFDLTRPISPIALREGLPDDGRRAAGGAGSGQGSAAGDDLGLLERGCER
FT                   RHGQLQPPADQGRTAPDRAE"
FT   gene            446208..446645
FT                   /locus_tag="Syncc9605_0454"
FT   CDS_pept        446208..446645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34230"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34230.1"
FT                   /translation="MSWLPVHGCALPLPKRNHAKCGVRQHGLKPSPLFKALGSRPHLMW
FT                   IYRSAPIDGGAEAVADFLLAQLEIGVRPHELKPALTMIRQCQAWMSGRPGGKTSMADLL
FT                   KAVERQLKEQEKAAEDEWAKRRAAIVARDEERRRGPVRVQL"
FT   gene            446726..447163
FT                   /locus_tag="Syncc9605_0455"
FT   CDS_pept        446726..447163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34231.1"
FT                   /translation="MEKTPLFDRRVMSMRSRLTPEELQLSGDPPAEVGAGALPSQPVPV
FT                   AGLGGGTTEATPMELELRGTAWQLVAGTDHHEHGEVESLEHLQHLLETSPEVAGSMLLG
FT                   SIVRLRAALKQIPRDADADHPIFITATDAVLLSRSVMRGLR"
FT   gene            447402..448646
FT                   /locus_tag="Syncc9605_0456"
FT   CDS_pept        447402..448646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34232"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34232.1"
FT                   /translation="MTVATLELKPAAAEILRSPAKVKVVNSGRRFGKTRMALTWLLEGA
FT                   LLTSGSRMWFLAPTRVQAKQIAWRDLKEMVPGSWASQVRESTLTIELRNGSHIQLAGAD
FT                   YADSLRGQRADRFAIDEYCYIRDLQEMWQAALLPMLGTSDDGSVIFSSTPAGGGTFSAE
FT                   LWERAETAEGWARWNFPSVAGGWVKPEYVEQARQTMDPSLWRQEFFGSIESLLGAVYPA
FT                   FNQQNISDTVDNGGPLLVGCDFNRSPFCGCVLQVQGDVVVVLEEIVLIEADTREFALAV
FT                   RERYPQRMIHCAPDPTGSRKQTSSLGLSDHKILQESGGFKICTPRAPWAIKDKVNATRL
FT                   MVLDAAGRRRLQVDPSCKRLIRSMKNLEFKPGMAVPDPHSDHGHMCDALGYAALALTKG
FT                   LTPWRVGSSETIKVW"
FT   gene            448643..448867
FT                   /locus_tag="Syncc9605_0457"
FT   CDS_pept        448643..448867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34233"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34233.1"
FT                   /translation="MTTTARRRKKPVRANVEEEILERGRWSGLKEQHRLERQNQSEVEN
FT                   EMARIQMQQFLVGGTSAITPDGHGGWPGG"
FT   gene            complement(448966..449283)
FT                   /locus_tag="Syncc9605_0458"
FT   CDS_pept        complement(448966..449283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34234"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34234.1"
FT                   /translation="MVNVNFYRLMSKGLIVAQGVVRNPEGMQAYYERTPAVIEQFGGRV
FT                   IAFTTDADCREGDGFPVWAVLEFPSLDAASSYYNSEDYQQNCKPLRLPHSTFSVSLLEG
FT                   I"
FT   gene            450236..450577
FT                   /locus_tag="Syncc9605_0459"
FT   CDS_pept        450236..450577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34235.1"
FT                   /translation="MASKFFHVHHEFRAGKAQQWWETAQAAMAPGGGWDEAVAKNLKSG
FT                   FFNHSFCPIGPEGPAFCIWEVREGITAEEFQEFIDGPDGVNFGLGAWMNICREINVEMA
FT                   GTPPYSRKF"
FT   gene            complement(450579..451010)
FT                   /locus_tag="Syncc9605_0460"
FT   CDS_pept        complement(450579..451010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34236"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34236.1"
FT                   /translation="MKCSGHGNSRGPKSSSPVASKTRARSRFSAQVIDIGVRWQRSSLA
FT                   TVLARLRPMTNKDRATNPPPEKPGGEGWLVSPEQQLVCQFKPDSATVHAHWVATRTYRW
FT                   VPPRPPVPQTRRRMLRHNAIDAWNKMLKTGWRRCPPPVR"
FT   gene            complement(451049..452470)
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0461"
FT   gene            complement(452371..452682)
FT                   /pseudo
FT                   /locus_tag="Syncc9605_0462"
FT   gene            complement(452622..453272)
FT                   /locus_tag="Syncc9605_0463"
FT   CDS_pept        complement(452622..453272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34237"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34237.1"
FT                   /translation="MHRALLSFAQTLLIEPRCPICNGAWDSPLPPTAPCTTCLDALPLP
FT                   GQGLKGLLPLQWCALGPYAGPLRQLLLKLRQPRQGKALVALVQLLSERFTLPATAVLVP
FT                   IPSWKRQRSNPLPQPIALGLGRPTVDLLRRSSAGVSQHHLNRLQRQTNLRGAFQASPLN
FT                   KQGAHSSVWLVDDILTGLSQMYLASIVVQLHTPEWRLSSAMRVSQRSSRPGAR"
FT   gene            complement(453327..453602)
FT                   /locus_tag="Syncc9605_0464"
FT   CDS_pept        complement(453327..453602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34238"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34238.1"
FT                   /translation="MPADPLTDAVSTRICKHMNDDHAEAVLAYAKHYGGVSNPAAARMV
FT                   SVKAETMELEVDGASVSIAFDHTLTDSEDAHRTLVAMLRAMPKEGA"
FT   gene            complement(453783..455021)
FT                   /locus_tag="Syncc9605_0465"
FT   CDS_pept        complement(453783..455021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0465"
FT                   /product="carbohydrate kinase, FGGY family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34239"
FT                   /db_xref="GOA:Q3AME3"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34239.1"
FT                   /translation="MTDSPLVLGIDLGTSGIRTAVVAANGAVLDSRSQAYGGDFANPHS
FT                   WREGCGDLIRAIPAQLRCQLKALAVDGTSGTLLACDRDGSPHGKALAYSQSCPELQSAL
FT                   QPLVDPSSPAASCSGSLARALRLLNCHGEAILLRHQADWISGWLLNDWRWGEEGNNLRL
FT                   GWDLITSSWPARFAEQPWRKALPEIRPSGSILGTIAPEQAKALGLADDLIIVAGTTDSN
FT                   AAVLAADPGPGDGITVLGTTLVMKCFTETPLHAPGVTSHRVGGRWLCGGASNAGAGVLR
FT                   RFYSDDQLNELSRQINPDTDSGLRLRPLPAPGERFPVDDQELLPVLEPRPVSDALYLHG
FT                   LLEGLAEIEAQGWHRLNELGAATPRRIISIGGGARNPQWRRLRERRLGCGVTSCQTPPA
FT                   AGVARLAQQALVG"
FT   gene            complement(455026..456261)
FT                   /locus_tag="Syncc9605_0466"
FT   CDS_pept        complement(455026..456261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0466"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34240"
FT                   /db_xref="GOA:Q3AME2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AME2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34240.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETV
FT                   VNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDI
FT                   AQGVNEADDHAGDPLDLVGAGDQGIMFGYACNETPELMPLPISLAHRLSRRLAEVRHNG
FT                   TLGYLLPDGKTQVSVVYENDKPVSIDTILISTQHTAEVDGISDEQGIRERITEDLWTHV
FT                   VEPATADLALKPSREATKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARYVAKCLVAAGLAERAEVQLSYAIGVAKPVSILVESFGTSALA
FT                   NDALTALVQEHFDLRPGAIIETFGLRNLPQQRGGCFYQDTAAYGHFGRNDLNAPWEDVT
FT                   AKSQELKQVAAA"
FT   gene            complement(456285..457058)
FT                   /locus_tag="Syncc9605_0467"
FT   CDS_pept        complement(456285..457058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0467"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34241"
FT                   /db_xref="GOA:Q3AME1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34241.1"
FT                   /translation="MAQLLLKGHPIGNFQGVLFDKDGTLSHSEPHLLVLADARINKAVK
FT                   VAQEKAHALKPSELRHTLRRAFGVDQGMLDPGGTLAVASRQDNIASTATVFCLLGCSWP
FT                   QALSLAQTCFDAVDQDGLIDTTPSPLINGAGQLLRNLHQQGVTAAVISNDTHSGIEDFL
FT                   AHHQLSAGVAGIWSADDHPRKPDPQAVLELCKRLGLPPHRCALVGDAETDLQMALEAGI
FT                   GGVIGFTGGWKRAPELPSAQHLLHSWTDLALSTDA"
FT   gene            complement(457064..458224)
FT                   /locus_tag="Syncc9605_0468"
FT   CDS_pept        complement(457064..458224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0468"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34242"
FT                   /db_xref="GOA:Q3AME0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AME0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34242.1"
FT                   /translation="MKRRRAFHAIFSNYPPEVDRQPPMSATPTEEQIQHQVQDANATEA
FT                   SAETVAADQAFEGEDLTIPEDVPTADDPSSRAASRSLDDAGFTIDEFAALLSKYDYNFK
FT                   PGDIVNGTVFALESKGAMIDIGAKTAAFMPLQEVSINRVEGLSDVLQPGEIREFFIMSE
FT                   ENEDGQLALSIRRIEYQRAWERVRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGS
FT                   HISTRKPKEELVADFLPLKFLEVDEERNRLVLSHRRALVERKMNRLEVGEVVVGTVRGI
FT                   KPYGAFIDIGGVSGLLHISEISHEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKA
FT                   LEPEPGDMLTDPQKVFEKAEEMAARYKQMLMEQAEEGEDPISSMMI"
FT   gene            complement(458312..458806)
FT                   /locus_tag="Syncc9605_0469"
FT   CDS_pept        complement(458312..458806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0469"
FT                   /product="Protein of unknown function DUF193"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34243"
FT                   /db_xref="GOA:Q3AMD9"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34243.1"
FT                   /translation="MPSGMQCPSCQNTDSRVLESRAADGGRSVRRRRECLNCEFRFTTY
FT                   ERVETVPITVIKRNGNREIFSRSKLLHGLNRACEKTGLDTSRLESLVEELELRLQQRTG
FT                   KEVSSTEIGEFVLRDLKQISEVAYIRFASVYRQFRGIDDFVSTLETLNADQEQNHLATV
FT                   R"
FT   gene            complement(459125..460684)
FT                   /locus_tag="Syncc9605_0470"
FT   CDS_pept        complement(459125..460684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0470"
FT                   /product="photosystem II chlorophyll-binding protein CP47"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34244"
FT                   /db_xref="GOA:Q3AMD8"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34244.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALVAGWAGSMALYELAIF
FT                   DPSDPVLNPMWRQGMFVMPFMSRLGVTGSWGGWSITGETGVDPGFWSFEGVAAAHIVFS
FT                   GLMMLAAIWHWTYWDLEIWQDPRTGEPALDLPKIFGIHLLLAGLGCFGFGAFHLTGVFG
FT                   PGMWISDPYALTGHLEAVQPSWGPEGFNPFNPGGIVAHHIAAGIVGIIAGIFHITTRPP
FT                   ERLYKALRMGNIETVLASAIAAVFFAAFIVAGTMWYGSAATPVELFGPTRYQWDQNYFK
FT                   TEINRRVQTAMDDGATQEEAFEAIPEKLAFYDYVGNSPAKGGLFRVGPMVNGDGLATAW
FT                   VGHIAFSDNEGRNLEVRRLPNFFENFPVVLEDEQGIVRADIPYRRAEAKFSFEQQGVTA
FT                   KVFGGALDGQTFTDPADVKRLARKAQLGEAFDFDRETYNSDGTFRSSPRGWFTFGHATF
FT                   ALLFFFGHIWHGARTLYRDVFAGIDPDLGDQVEFGLFAKLGDKTTRRLPEGYVPPAGTP
FT                   LN"
FT   gene            460867..461343
FT                   /locus_tag="Syncc9605_0471"
FT   CDS_pept        460867..461343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0471"
FT                   /product="possible ferredoxin (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34245"
FT                   /db_xref="GOA:Q3AMD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34245.1"
FT                   /translation="MPVIRFVREGRDVECYPGENLREVARREGIELYGLKGQLGNCGGC
FT                   GQCITCFVSVVDEDNADALTARTAVEDSKLRRRPQEWRLACQALVEKSVMVLTRPQVRL
FT                   ANADSRLAAARQAPLPAGPTAWPAPPASELDEEDQDGVDGDSRDAKAATAGEEA"
FT   gene            461403..461507
FT                   /locus_tag="Syncc9605_0472"
FT   CDS_pept        461403..461507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0472"
FT                   /product="possible photosystem II reaction center M
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34246"
FT                   /db_xref="GOA:Q3AMD6"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34246.1"
FT                   /translation="METNDLGFVASLMFILVPAIFLIVLYIGTQNNEA"
FT   gene            complement(461509..462357)
FT                   /locus_tag="Syncc9605_0473"
FT   CDS_pept        complement(461509..462357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34247"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34247.1"
FT                   /translation="MFRNLLIADSGKGHVEEMIRMLQDIPSLKAAKINLLHVVSEQSKS
FT                   QSDGHRDEAANLLNSAITRMGLSPSSVSTLIREGDTKQTVLKVADEVQADLIVMGSRGL
FT                   GRLQSILANSTSQYVFQLSTRPMLLVRDDLYVKHVNRVMVTIDGTGVGDDALRTACELV
FT                   REIPGGTLTGVHVVRQESAPSRGGRTKVIEVLDSAVQRARGFGVDMKAINTKGKDIGRS
FT                   VCLAASECNADLVVIASQDRRPLVARGLVDLDKLLGGSVSDYIRVHAPAPVLLVREPEQ
FT                   G"
FT   gene            462440..462844
FT                   /locus_tag="Syncc9605_0474"
FT   CDS_pept        462440..462844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34248"
FT                   /db_xref="GOA:Q3AMD4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34248.1"
FT                   /translation="MFTLTKRVLPQHTDYAGVMWHGAYVQWLEEARVEALQAAGLGYAA
FT                   MTAMGVDMPVVSLQLDYRHPLRHGDEVCVESRCPAQQGVRWPWVSRFVCRNTVVAEASV
FT                   NLVMVREGRVLRRVPAQLQEVMDQLVRQAL"
FT   gene            462955..463971
FT                   /locus_tag="Syncc9605_0475"
FT   CDS_pept        462955..463971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0475"
FT                   /product="putative DNA processing protein (Smf family)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34249"
FT                   /db_xref="GOA:Q3AMD3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34249.1"
FT                   /translation="MDDMRRLCRDQAVGPDQLWGWPIERFGETLAWPAHCLRDVERYRR
FT                   EHGASPTLDVPACALLPGDPAWPSCLDQMHLPPSGLYVEGDRSLLRHINARTAIAVVGT
FT                   RSASDHGLAMAEELGRALAEAGWPVFSGLAEGVDAAAHRGCLARNGAPIGVLGTPLDRV
FT                   YPAHHRSLQQQVGRQGLLVSPSRSGCRVRPGHFAARNRWLVAFAQALVVVECQQRSGAL
FT                   ISARWASRMHYPVWVVPGDARRWSCRGSNALLRDGATALIHPEDLLASIGEGPLRSEES
FT                   RGKHQRLMEAIGSGATFDQLVLCLQCSPAELAPQLLALECRRELLCESGLHWRKPRP"
FT   gene            463950..464855
FT                   /locus_tag="Syncc9605_0476"
FT   CDS_pept        463950..464855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0476"
FT                   /product="modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34250"
FT                   /db_xref="GOA:Q3AMD2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34250.1"
FT                   /translation="MAQASALRDCTTVAGTDVLHWRRQQLARGGTAADLDWLLDLAGGL
FT                   RWASLKRLLLDPTRSVDLEQSLEMLSGLWERHLHGNVPLQHLVGLCPWRDVLLESSPAA
FT                   LIPRQETELLVDLALSQFKATPPARWADLGTGSGAIAVALARAWPTAPGHGVDLSSDAL
FT                   QLAERNLERCAPHHSCSLHLGSWWSPLKSWWGSLDLVVSNPPYIPGAVVDGLEAVVRDH
FT                   EPHLALLGGADGLDAIRAVVDGAPTGLSPGGWLLLEHHHDQSAQVMQLLRDAGLVEGRA
FT                   AADLEGTLRFALARKPAESS"
FT   gene            464884..465483
FT                   /locus_tag="Syncc9605_0477"
FT   CDS_pept        464884..465483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34251"
FT                   /db_xref="GOA:Q3AMD1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34251.1"
FT                   /translation="MPAPVLAASDLALRLRAGEAAIIPTDTLPGLAVCPDQAQTLWRLK
FT                   RRPADKPLILMGASVNDLLHEVAVPCHREVEALAERYWPGALTLVLPARDGGAGRYLNP
FT                   GGTTLGCRIPACEQTRALLQISGPLATTSANRSGEPASMTAAEAALVFPDVSQLGPQPW
FT                   PQPSGQASTVLVWVDDGRWRLVRRGAVIPAGVEVLE"
FT   gene            465480..465653
FT                   /locus_tag="Syncc9605_0478"
FT   CDS_pept        465480..465653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34252"
FT                   /db_xref="GOA:Q3AMD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34252.1"
FT                   /translation="MISLVGLCLLVMALLHWVLEPLELVFTWTLQLNFLPWMLGLFFIW
FT                   LLAGESDRSTSP"
FT   gene            complement(465663..465734)
FT                   /gene="tRNA-Thr2"
FT                   /locus_tag="Syncc9605_R0015"
FT   tRNA            complement(465663..465734)
FT                   /gene="tRNA-Thr2"
FT                   /locus_tag="Syncc9605_R0015"
FT                   /product="tRNA-Thr"
FT   gene            complement(465725..465925)
FT                   /locus_tag="Syncc9605_0479"
FT   CDS_pept        complement(465725..465925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0479"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34253"
FT                   /db_xref="GOA:Q3AMC9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34253.1"
FT                   /translation="MLLEGLNNRAIAQRLVISHRTVECHISRALRKNGCRNQLELVLWL
FT                   ISDQDPALNRLAAGTMQPMPA"
FT   gene            complement(465976..466284)
FT                   /locus_tag="Syncc9605_0480"
FT   CDS_pept        complement(465976..466284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0480"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34254"
FT                   /db_xref="GOA:Q3AMC8"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34254.1"
FT                   /translation="MTLKEFIDKLLRRQPASAETAKERLQLVLAHDRSDLNPELLEQMR
FT                   REILEVVARYVEIDLAQGDVSLETEDRVTALVANLPIRRPIAQTAKVEPSEQQPAQA"
FT   gene            complement(466289..467101)
FT                   /locus_tag="Syncc9605_0481"
FT   CDS_pept        complement(466289..467101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0481"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34255"
FT                   /db_xref="GOA:Q3AMC7"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34255.1"
FT                   /translation="MSTTRTILICSGKGGVGKTTTTANLGIALARQGAKTVVLDADFGL
FT                   RNLDLLLGLENRIVYTAQEVLAETCRLEQALVKHKQEPNLALLPAGNPRMLEWLKPKDM
FT                   QAIVALLERQFDYVLIDCPAGIEDGFKNAAAAAREAVVITTPEVAAVRDADRVIGLLNT
FT                   QGVQPVQLVLNRVRPKMMSNQEMLSVDDVTDILALPLLGLVFEDEQVIVSTNRGEPLTL
FT                   SDSSSPAAHAYGNIAQRLQGEDIPLMDPSQARRGLRARMRKLMQTRIF"
FT   gene            complement(467157..467795)
FT                   /locus_tag="Syncc9605_0482"
FT   CDS_pept        complement(467157..467795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0482"
FT                   /product="possible septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34256"
FT                   /db_xref="GOA:Q3AMC6"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34256.1"
FT                   /translation="MTLRLPDQRLDHWRDRLPDLLSRCSQPIVDLDCRDWVLNCSDLTD
FT                   LCAAVSGAGHQLGRITGRVPETIVSASALGLDASRSNTPSSRELQPNPVTTAPSELLFH
FT                   HGTLRSGDHLQSERTILLYGDVNPGARISSTADVLVWGRLRGVAHAGCEGSTSAKIVAL
FT                   QLRPLQLRIADVVARGPEDLPQAGLAEQAKLKDGVIAIEPAVIQSFQKR"
FT   gene            complement(467803..469068)
FT                   /locus_tag="Syncc9605_0483"
FT   CDS_pept        complement(467803..469068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0483"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34257"
FT                   /db_xref="GOA:Q3AMC5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34257.1"
FT                   /translation="MSQRTYHDPLHRGIGLDRQAPAEGMVMDLVDTAPFQRLRRIRQLG
FT                   PAYLTFHSAESSRFTHSLGVFHLARRAFERMLPLAPELETYRGLLYGAALLHDIGHGPL
FT                   SHTGEEMFGLRHEAWSARVIRHHPEIRDCLESHESGTAEAVANLLEHGRSPHPLIKHLV
FT                   SSQLDCDRLDYLLRDSYSTGTRYGQLDLDRILGALTLAPDGDMAIHPKGLMAVEHYLVV
FT                   RNLMYRSVYNHRLNVVCNWLLEKLIQTARQLGPEQVWADEVMASWLWQPDQIGLEDFLA
FT                   NDDQRTGYHLQRWQAEAPAALAELSGRFLDRRLLKATAVEHLSPADQLQLLAAARRLAD
FT                   RHGHDPELCCGLRHQQLRGYHPYRGGLRLWDGQQLQALEKASPLVASLATPAATSWLIH
FT                   PRDISAELRQEMDVEWPRAAAA"
FT   gene            complement(469065..470249)
FT                   /locus_tag="Syncc9605_0484"
FT   CDS_pept        complement(469065..470249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0484"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34258"
FT                   /db_xref="GOA:Q3AMC4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34258.1"
FT                   /translation="MVLGSACTAVALSDTQQLVVDSWRLVNQGFWNPEQLDAVRWRRQR
FT                   QKAMERSIESSDDAYAAIESMLAQLGDPYTRLLRPADYTALKNSTNGSLSGVGLQLGPD
FT                   ESSNGIVVISALEGSPAGEAEITSGTQLLSVDGRPVVDLGLEGTVAALRGDVGSQVVLT
FT                   LDNGSGETTELTLERRSVDLRPVRTRRLRTGSHTLGYLRITQFSDGVPEQVKEALTELQ
FT                   NKEIEGLVLDLRNNSGGLVSAGLAVADDFLSGDAIVETRNRDGINDTIQASLQTVYDGP
FT                   MVTLVNGGTASASEILAGALQDNERATLLGGQTFGKGLIQTLTNLSDGSGLAVTVAGYV
FT                   TPSGRDIQGEGIAPDRGLSDPEPLNPGGDGDRWLSEAEQWMEALLEQPADDTEA"
FT   gene            470410..471066
FT                   /locus_tag="Syncc9605_0485"
FT   CDS_pept        470410..471066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0485"
FT                   /product="apocytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34259"
FT                   /db_xref="GOA:Q3AMC3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34259.1"
FT                   /translation="MANSSPVYDWFQERLEIQDIADDIGSKYVPPHVNIFYCLGGITLV
FT                   CFLIQFATGFAMTFYYKPTVAEAYKSVEYLMTDVSFGWLIRSVHRWSASMMVLMLILHV
FT                   FRVYLTGGFKRPRELTWVTGVTMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPV
FT                   VGDFMVELLRGGESVGQATLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL"
FT   gene            471106..471588
FT                   /locus_tag="Syncc9605_0486"
FT   CDS_pept        471106..471588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0486"
FT                   /product="cytochrome b6-f complex subunit 4 (17 kd
FT                   polypeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34260"
FT                   /db_xref="GOA:Q3AMC2"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34260.1"
FT                   /translation="MHILKKPDLSDPKMRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACVVGLAVLDPAMLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLV
FT                   PLGLMLVPFIESFNKFQNPFRRPVAMTVFLTGTLVTIYLGIGAALPIDKSLTLGLF"
FT   gene            complement(471664..473121)
FT                   /locus_tag="Syncc9605_0487"
FT   CDS_pept        complement(471664..473121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0487"
FT                   /product="putative neutral invertase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34261"
FT                   /db_xref="GOA:Q3AMC1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34261.1"
FT                   /translation="MPTRFTEQSQRFRPNSNEGQVLQKAREHFEATLIGVQGELAGSVA
FT                   AMEHRRSDDALNYGEIFLRDNVPVMIYLMLEGRFAIVKQFLSVSLQLQSTNVQTRGVFP
FT                   TSFVEEEGELVADYGQRSIGRITSVDASLWWPILCWIYVKRSGDVDFGRSPEVQRGLQL
FT                   LLDLVLHPSFEGTPVLFVPDCAFMIDRPMDVWGAPLEVEVLLFAALRSCVGLMELCQRH
FT                   ENSVLLAERLRLSRQWTHDLRQFLLKHYWVTSKTMQVLRRRPTEQYGENQHHNEFNVQP
FT                   QVIPDWLQDWLENRGGYMIGNMRTGRPDFRFYSLGNSLASLFGLLTAPQQRALFRLVLH
FT                   NRDHLMAQMPMRICHPPMEGVEWENKTGSDPKNWPWSYHNGGHWPSLLWFFGASILLHE
FT                   RLNPQADVLLMGQMKTLMDECYWSHLNQLPRQQWAEYFDGPTGTWVGQQSRTYQTWTIV
FT                   GFLLMHHFLHINPDDVLMLNLDESMGH"
FT   gene            complement(473134..473469)
FT                   /locus_tag="Syncc9605_0488"
FT   CDS_pept        complement(473134..473469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34262.1"
FT                   /translation="MKASVPKLFNCPGATKLLFTPFQEIGWLVIAASRDRLKNLQHRGI
FT                   APSWSRKPPQTHQDFRLKRFGLHSSLSAPAQDKTITPHLPTRNGDAGWRSEGLLPLAKP
FT                   VARTTFQ"
FT   gene            473828..475267
FT                   /locus_tag="Syncc9605_R0016"
FT   rRNA            473828..475267
FT                   /locus_tag="Syncc9605_R0016"
FT                   /product="16S ribosomal RNA"
FT   gene            475473..475546
FT                   /gene="tRNA-Ile2"
FT                   /locus_tag="Syncc9605_R0017"
FT   tRNA            475473..475546
FT                   /gene="tRNA-Ile2"
FT                   /locus_tag="Syncc9605_R0017"
FT                   /product="tRNA-Ile"
FT   gene            475556..475628
FT                   /gene="tRNA-Ala3"
FT                   /locus_tag="Syncc9605_R0018"
FT   tRNA            475556..475628
FT                   /gene="tRNA-Ala3"
FT                   /locus_tag="Syncc9605_R0018"
FT                   /product="tRNA-Ala"
FT   gene            476063..478928
FT                   /locus_tag="Syncc9605_R0019"
FT   rRNA            476063..478928
FT                   /locus_tag="Syncc9605_R0019"
FT                   /product="23S ribosomal RNA"
FT   gene            479041..479154
FT                   /locus_tag="Syncc9605_R0020"
FT   rRNA            479041..479154
FT                   /locus_tag="Syncc9605_R0020"
FT                   /product="5S ribosomal RNA"
FT                   /note="prediction based on Data from Rfam and Infernal"
FT   gene            complement(479259..480011)
FT                   /locus_tag="Syncc9605_0489"
FT   CDS_pept        complement(479259..480011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0489"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34263"
FT                   /db_xref="GOA:Q3AMB9"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34263.1"
FT                   /translation="MMNQQHLLLDIEGTTCPVRFVSDTLFPFAKKELSRYITQNWDKRP
FT                   HSKSIRAAWKEWMDDQSAESMIIKQQVTQCEIEEVEGLIQYLKHLISIDRKSTALKDLQ
FT                   GKIWEYGYGNGELKSQLFPETAVCLRQWHEQGLTLSVYSSGSIQAQKLLYRHSLNGNLE
FT                   DLFSHWFDTHTGPKKSAESYTTIAKQLQSSPNKIWFVSDNGDECNSARLAGMHTLFSLR
FT                   EGNPDRDPRDHKVVHSLREVSALLIAEQ"
FT   gene            complement(480008..480595)
FT                   /locus_tag="Syncc9605_0490"
FT   CDS_pept        complement(480008..480595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0490"
FT                   /product="putative sugar aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34264"
FT                   /db_xref="GOA:Q3AMB8"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34264.1"
FT                   /translation="MTEVMRGFHRRGWCDGTGGNFSVVLQHQPLELLMAPSGVDKGQVP
FT                   ADQLIVVDGQGKVLTGKGKASAETELHLRIVEATQAGAVLHTHSVPGTVLSRHYETTGG
FT                   IALEGWEMLKGLVGINTHACCITIPVISNSQSMDELCDAIAPFLETAPCGFLVAGHGLY
FT                   AWGADLDASKRHLEILEFLLKVNLNQMQIGDQ"
FT   gene            480676..481689
FT                   /locus_tag="Syncc9605_0491"
FT   CDS_pept        480676..481689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0491"
FT                   /product="Initiation factor 2B alpha/beta/delta"
FT                   /EC_number="5.3.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34265"
FT                   /db_xref="GOA:Q3AMB7"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34265.1"
FT                   /translation="MTLPPSCRWSGDHLELLDQRQLPGAVVFMQLRRWQQVAEAISSMA
FT                   VRGAPAIGIAAAWGVVLAARSGDDLLTAFRGLRASRPTAVNLRWALNRMQAAMGSSASV
FT                   DVEALTDAAAALQREDCVLTQRLVDHGVSLLAQGCRVLHHCHTGAIATGGVGTALGVIA
FT                   AAHARGLLRHAWLDETRPRLQGAALSAWELGCLGVPCTVIVDGASGLLMRRGEVDAVMV
FT                   GCDRVSANGDVANKIGTYNLALVARAHGIPFYVCAPGSSIDRATVDGEAITIEERDAEE
FT                   ITHVRGMDVAAPGAQVWNPAFDITPAHLVTGFITEFGVLRPPYREVLSELPLPNQL"
FT   gene            complement(481680..482516)
FT                   /locus_tag="Syncc9605_0492"
FT   CDS_pept        complement(481680..482516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0492"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34266"
FT                   /db_xref="GOA:Q3AMB6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34266.1"
FT                   /translation="MPELPEVETVRRGLADRLVDFKIAQVEVCRPRAIASPGGPDEFVA
FT                   GLCGTTVGQWHRRGKYLMTALEPESGVWGVHLRMTGQFQWHEQPSEPCKHTRVRLWNSK
FT                   EEELRFVDVRSFGEMWWVPPGQAIEEVITGLTRLGPEPFSADFSASYLKQKLKGSSRPI
FT                   KTALLDQALVAGAGNIYADESLFASGIAPFTPAGQLNLQQLERLRDALVNVLTISIGAG
FT                   GTTFSDFRDLEGVNGNYGGQAWVYRRGGEPCRNCGTTIQREKLSGRSTHWCPTCQS"
FT   gene            complement(482522..482731)
FT                   /locus_tag="Syncc9605_0493"
FT   CDS_pept        complement(482522..482731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0493"
FT                   /product="photosystem I subunit IV (PsaE)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34267"
FT                   /db_xref="GOA:Q3AMB5"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34267.1"
FT                   /translation="MAITRGAKVRIKRPESYWFNEVGTVASIDTSGIRYPVVVRFEKVN
FT                   YSGLQGVDGGINTNNFAEAELEPA"
FT   gene            482773..483876
FT                   /locus_tag="Syncc9605_0494"
FT   CDS_pept        482773..483876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34268"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34268.1"
FT                   /translation="MDGDDRCVTECRPFVVSVPLTSSIALDPDPSLLQLDLPDPEQDDI
FT                   STMEFLARLEQAWAVCDRFDLQTEIWRGRILRAVRDKEKRGGEARGAGFLQWLREREIS
FT                   KTRAYGLIQLAESADSMLSDGTLEESSVNQFSKRAFMETAQAVPEVQLMISEAANEGQE
FT                   ITRKQVRRLTDEFTAATSPLLPEEIRQRTQENLLPPRAVAPLVRELAKLPEPQQEDLRK
FT                   VLRDEPELDRIKDVTSTARWITKATESGVAVRAFQQGELDLDRAMQEAQRLDALGLLAD
FT                   AVGQAQALESAVLKLHTSWRRLGGLQERLWVESGSSTPYLRDVLNALQTLSGATLRVSL
FT                   GELAGGKRVRLQLVEESPDQLDPPPLA"
FT   gene            483994..485406
FT                   /locus_tag="Syncc9605_0495"
FT   CDS_pept        483994..485406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0495"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34269"
FT                   /db_xref="GOA:Q3AMB3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34269.1"
FT                   /translation="MVDAVLAGRDALAVLPTGGGKSLCYQLPALVREGLVVVISPLVAL
FT                   MEDQVMALQRRGIAAACLHAGLEPARRQQALEQLRDATLRLLYIAPERLQGEQTRLMLE
FT                   RHATQGRLVALAVDEAHCISAWGHDFRPDYRRLGQIRSLCPGVPMLALSATAAPRVRAD
FT                   IIRLLDLRRPLVQVSSARRDNLHYTMQRRPRDPMPQLLEALEMSRGAALIYARTRRSVE
FT                   QWAERLSDQGVAATPYHAGLDPETRQQALKLFLEHERPVLVATVAFGMGVDRGDVGLVL
FT                   HLDLPATPEGYLQESGRAGRDGKPAHCQVLFSPGDRTSLGWAMQASARGSNALEDRRRL
FT                   DLAQQQLRRMEAVAEGEMCREQALLLAVGELVGPCGRCDRCMESPKRRDWSAQVETLLA
FT                   HLAEQDGTEMRRLGEHLDLHEPGRYDRWTWLARRLVQEELIQESNDGAQRLYLRESGRR
FT                   FLDSPWPLDYAA"
FT   gene            complement(485413..486426)
FT                   /locus_tag="Syncc9605_0496"
FT   CDS_pept        complement(485413..486426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0496"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34270"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34270.1"
FT                   /translation="MRRTALAALLLTAWFPLSAMAASVTVRSGETLSDIANRYGVSVGM
FT                   LMRMNGIRNPDLVQAGSRLRVPGPTVTAGPGRHRVNSGETLSSIANRYQVRSRDLMALN
FT                   NLRNANHVEVGQTLRLPSNAVMPRPAFKPVAVTPIPGATEHTVAKGQTLTQIAKAYKLP
FT                   VASLISINQLIDPNKVEVGTRLYLTDPSLQKPITTQVQPATTKPVQAKAEPVQTKAVQT
FT                   KAVQTKKVQTKPVQAKKPVVKAKPVEAAKPKQTLAKSADWRTYGPLQVDWGNWQAMGGS
FT                   QVVPTLNAQGQALYLAVNCSAKKINATGANGSWKTWEAPKSRFEKDLVKDRCQLKA"
FT   sig_peptide     complement(486361..486426)
FT                   /locus_tag="Syncc9605_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(486526..487905)
FT                   /locus_tag="Syncc9605_0497"
FT   CDS_pept        complement(486526..487905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0497"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34271"
FT                   /db_xref="GOA:Q3AMB1"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34271.1"
FT                   /translation="MALTQTQLSRMKELVGAGLTRPLAWRREQLQRLSALVEEHESEVL
FT                   EALAADLGKPPTEAFFELVALRQELKLTGRQLERWMRPRRVAVPLSLRPGQAKVVPEPL
FT                   GCVLIIGPWNYPFQLTLRPLISALAAGNTAVLKPSEHASVIADLIARLIPQHFEPEVVQ
FT                   VVQGDGAVAANLVAMPFDHIFFTGGGSIGRKVLEGAAAHLTPVTLELGGKSPAIVLEGA
FT                   DLTVGARRLIWGKGINAGQTCIAPDHLLVAPALRSPLLKAMEEARTEMYGADPLNSNEL
FT                   GQIINERQFNRLEQLLETARADGRILIGGEISREQRRIAPTVIRVNDRNDPLMAEELFG
FT                   PLLPVLVLEDLTTALQEIRQGPKPLALYLFGGDEAQQQQVLTTTSSGGVCLNDVVMQAG
FT                   VPQLPFGGVGASGMGSYHGQSGFDTFSHHKAVLKRPFRFDFKLRYPPYQVDLNLLKRLA
FT                   G"
FT   gene            487960..489621
FT                   /locus_tag="Syncc9605_0498"
FT   CDS_pept        487960..489621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0498"
FT                   /product="Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34272"
FT                   /db_xref="GOA:Q3AMB0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34272.1"
FT                   /translation="MTPALTWWSGTVIYQLIVRSYSDGNGDGTGDFKGLAARLPYLRWL
FT                   GVNTLWLTPIYPSPLRDGGYDITDFTGIHPDLGDLSSFHRFLTAAHSQGMRVILDLVLN
FT                   HTSDLHPWFQRARWAPKGSPERDVYVWSDDPKRYAEAPVLFRHFEASNWEWDPVAEQYY
FT                   LHRFLRHQPDLNYENPWVQDTMLEVVDFWLDRGVDGFRLDAVPFLFESEGTRCEGLPET
FT                   HAFLTRLRERVDAHGRDVLLLGEAIQPVEEAAPYLADDELHGAFNFVLTAHLFAAIASG
FT                   RTQQLGECLMQAEQAVSGPRWALPLRNHDELWLGDGHLVSDEVIQTIRVGLPQGQGHWL
FT                   NWGINRRLAPLLNGDPRSNRLLHGLLYSLPGMPCLYYGDELGMGDWPGLRDRDPNRTPM
FT                   AWTPARNGGFSTAPDPLLVLPPITAPGYDYRVVNVEVQKQLPGSLLNWHRRMLTCRRLL
FT                   PALRHGSFRLLYSPHPGVLVYLRCTEAMTVLVAANVTAAGASLSLDLSEWTGERTREVM
FT                   WGCEFPPAAAEWFVNLPPYGFNWWLIGEVEPAATAA"
FT   gene            complement(489564..491141)
FT                   /locus_tag="Syncc9605_0499"
FT   CDS_pept        complement(489564..491141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0499"
FT                   /product="Glycerol-3-phosphate oxidase"
FT                   /EC_number="1.1.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34273"
FT                   /db_xref="GOA:Q3AMA9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34273.1"
FT                   /translation="MADHQVDLLVIGAGASGASVAYEATRRGLSVALLEAGDIGGGTSC
FT                   RSTKLLHGGVRYLELAFKSLDLAQLRLVREALLERSHWLTQAPFLARRLELALPTQQLW
FT                   GQAYYRVGLGVYDALAGQRSIGHSRLLSQQQMRQALPLLKACQGGVAYSDGQFDDARLN
FT                   LLLALTAEQQGATLRTRCRVVELETGGMGQLKAAISESATGQRERWCASAFVNATGIRA
FT                   DEIRQMAEADAPPRMLTSRGAHIVLEQNLCPKGVGLLVPSTADGRVLFMLPFHGRTLVG
FT                   TTDEACSKENATSPSPEEEAYLLNYVRDWFPQLQGPKVSSRWAGGRPLLKPADQGLDSS
FT                   RVVREHEVETLACGLVSVMGGKWTTCRPMAEDTLTAVERQLGRALPPPEPMPLRGATES
FT                   LQATLDGLQRQKHQLEALLPDTALRTAQVAHLQSTYGLDGLALIERAEPSRREPISPVI
FT                   PLCGAELDHAIQREHARSSSDVLARRCRLAMVDLNEAERLRPQVEALLDQAAVAAGSTS
FT                   PINHQLNP"
FT   gene            complement(491134..492639)
FT                   /locus_tag="Syncc9605_0500"
FT   CDS_pept        complement(491134..492639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0500"
FT                   /product="putative glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34274"
FT                   /db_xref="GOA:Q3AMA8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34274.1"
FT                   /translation="MAEQPLLLALDQGTSSSRAALFSSSGDLVISASAPLPISYPADGW
FT                   VEQDPMAIWTSQRQALVQLDSKLSEPQRKAVVSCGITNQRETTLLWRRSNGLPCGPALV
FT                   WQDGRTAAICEAWKQQGLEQEWCRRTGLLLDPYFSASKIRWMLDHYQDAQAAAASDDLC
FT                   FGTVESWLLWQLTGGQRHGSDMSNASRTLLMDLEQQRWVDDFRESTGLPANALPELLPC
FT                   RGEFGHITTDLPFAGLPIQAMLGDQQAATLGQLCLQPGEGKCTYGTGAFLVINTGDVIR
FT                   RSDAGLLSTLGWTDAAGTPSFCLEGSLFNAGTVIQWLRDGLQIIDQAPQVNELARSVPD
FT                   SGGVMLVPAFTGWGTPHWDPQARGVLVGLTRDSGRGHIARAALEGIALSVATLVELAEQ
FT                   ALGTGLGELAVDGGAAASDPLLQAQADCTGLTVRRPASLESTARGVALFAGLQAGVISD
FT                   LEQLAIARRDGAELFHPQMGASERHRWRSRWQDAVSRSLGWHG"
FT   gene            492691..494121
FT                   /locus_tag="Syncc9605_0501"
FT   CDS_pept        492691..494121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0501"
FT                   /product="Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34275"
FT                   /db_xref="GOA:Q3AMA7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34275.1"
FT                   /translation="MPATTPFRDPPAWVADAVLYQIFPDRFRRSGRVDAQRHLALKPWG
FT                   TDPREEGFQGGDLYGVIDALDGLQAMGITCLYLTPIFSSAANHRYHAYDYFEVDPMLGG
FT                   NAALRDLIDAVHRRGMKLVLDGVFNHCGRGFWAFHHVVENGADSPYRDWFHVHRWPLQP
FT                   YPAPGAYCGYDGWWALPDLPKFNHANPGVREHLLAVGRHWLEQGIDGWRLDVPAEVPAD
FT                   FWVEFRQMVRSTNPEAWIVGEVWGDATTWLQGDHFDGVMNYRLGWSSICWAAGEALRRD
FT                   YRNSEYPLDLLDGQALLTIWTTTTGSYREVVNRSQMNLLDSHDVPRALHSLNNDLAALK
FT                   LALLLLFLHPGAPCVYYGTEAALAGGPEPGPSSGPGPACREAYPWDVPWSADLRSFIQS
FT                   LAELRFAHGVLRREGLRWSAQGADVLEGVADGLRVVINRSRSNSVPLTIEQRRSCVWTL
FT                   GTVDSRAVGPQSAAVLRS"
FT   gene            complement(494153..494224)
FT                   /gene="tRNA-Thr1"
FT                   /locus_tag="Syncc9605_R0021"
FT   tRNA            complement(494153..494224)
FT                   /gene="tRNA-Thr1"
FT                   /locus_tag="Syncc9605_R0021"
FT                   /product="tRNA-Thr"
FT   gene            complement(494235..494316)
FT                   /gene="tRNA-Tyr1"
FT                   /locus_tag="Syncc9605_R0022"
FT   tRNA            complement(494235..494316)
FT                   /gene="tRNA-Tyr1"
FT                   /locus_tag="Syncc9605_R0022"
FT                   /product="tRNA-Tyr"
FT   gene            494401..494841
FT                   /locus_tag="Syncc9605_0502"
FT   CDS_pept        494401..494841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0502"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34276"
FT                   /db_xref="GOA:Q3AMA6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AMA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34276.1"
FT                   /translation="MHVLLLNGPNLNLLGQREPGIYGHSSLADIEAALTREAEQESVQL
FT                   DCFQSNFEGALVDRIHQAMGRCDGILINAGAYTHTSIAIRDALAGVAIPYVEVHLSNTH
FT                   ARENFRHHSFLAERAVGVICGFGPASYSFALNGLLSHLRRNA"
FT   gene            494838..495527
FT                   /locus_tag="Syncc9605_0503"
FT   CDS_pept        494838..495527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0503"
FT                   /product="tRNA-(MS(2)IO(6)A)-hydroxylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34277"
FT                   /db_xref="GOA:Q3AMA5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="PDB:5UX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34277.1"
FT                   /translation="MTTTAPPQTVPTKTVPSKTVASIRWLAAPTSWSWVEQANAHPMEV
FT                   LIDHAHCERKAAGAAVQMMFRYLCEPGLGEALSPLAREELEHFEQVLALIKARGRYLEP
FT                   LPSPGYGADLARQIRKGEPQRMLDSFLVAGLIEARSHERMALLAEHSPDPQLRELYSDL
FT                   LASEARHFGLYWVLCEQRYPRELIVERLEVLALAEVKALEGALTRPEDVRMHSCGVDVT
FT                   QISSQIS"
FT   gene            complement(495515..497191)
FT                   /locus_tag="Syncc9605_0504"
FT   CDS_pept        complement(495515..497191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0504"
FT                   /product="putative sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34278"
FT                   /db_xref="GOA:Q3AMA4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34278.1"
FT                   /translation="MALIHGLHQRNIRGDLLGGLTAAVVALPLALAFGNAALGPGGAIY
FT                   GLYGAIVTGFLAALLGGTPAQVSGPTGPMSVTVAGIISSLAAIGISRDLNAGEMLPLVM
FT                   AAVVIGGVFEALLGVLRLGRFITLVPYSVISGFMSGIGFIILVLQLGPFIGVSTGGGVV
FT                   ASLGSLIEAQSWNPAALAVGLMTLAVVFLTPLRIRQWVPTPLLALLLVTPLSLVLFNDN
FT                   RLLELGLEPIARIGAIPEGGLQLVVPDFSQHLPELVKAGMVLALLGAIDSLLTSLVADN
FT                   ITQTNHDSNRELIGQGIANTAAGFLSGLPGAGATMRTVINIKSGGQTPWSGMTHSLVLL
FT                   LVLLGAGPLAAQIPTALLAGILIKVGLDIIDWGFLLRAHRLSAKTAALMYAVLLMTVFW
FT                   DLIWGVLVGMFVANLLTVDAITRSQLEGMEEDNPSDATDARHANLSLQEEALILRCGKS
FT                   LMLFRLRGPLSFGAAKGISARMGLIQSYSVLILDLTDVPRIGVTATLAIERMVEEARSA
FT                   GRTLFIAGANKTLEQRLRQFGVEGVLRPSRLEALQEAAQLI"
FT   sig_peptide     complement(497093..497191)
FT                   /locus_tag="Syncc9605_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.621) with cleavage site probability 0.280 at
FT                   residue 33"
FT   gene            complement(497198..497602)
FT                   /locus_tag="Syncc9605_0505"
FT   CDS_pept        complement(497198..497602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34279.1"
FT                   /translation="MRSTASSLLASVLVAAGGAIGGPPVLAAPWTSTIGEPLRDSSPQA
FT                   LELTQHLMAIGAEFYGAWTCPACFKQMNLFGKQAGADLTYVECRKPEQLPDQADACIAA
FT                   EIRATPPGFSPMDAEKLGFSPWKPWAAGMA"
FT   sig_peptide     complement(497519..497602)
FT                   /locus_tag="Syncc9605_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 28"
FT   gene            497713..498705
FT                   /locus_tag="Syncc9605_0506"
FT   CDS_pept        497713..498705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0506"
FT                   /product="Heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34280"
FT                   /db_xref="GOA:Q3AMA2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34280.1"
FT                   /translation="MGMAGSGYKDYFQVLGVDRSADANAIKKAFRSLARQYHPDVNPGD
FT                   AQAEARFKEISEAYEVLSDPEKRRRYEQFGQYWNQAGGMGGGAAPGMDVDFGRYGNFDD
FT                   FINDLLGRFGGPGGGGFQGGGFPGGGFPGGGFAGGGFPRGAQASRAPVNLDAEASVNVT
FT                   FAEAFRGGERSLSVNNERVQVRIPAGVKNGSRLRLKGKGNLQPGTGRRGDLYLNLKIQD
FT                   HPIWRLESDQLRADLPVSLDELALGGMVSVMTPDGEAQVSIPAGTAPGRSLRLKGKGWP
FT                   SKTGRGDLLLTMTLAMPSSWSEEERRLLEQLRAKRTDHPRQEWLRSASL"
FT   gene            498745..499746
FT                   /locus_tag="Syncc9605_0507"
FT   CDS_pept        498745..499746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0507"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34281"
FT                   /db_xref="GOA:Q3AMA1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34281.1"
FT                   /translation="MELTYRPRRLRRTPALRAMVREHSLSAADFIYPLFVHEGAEVEPI
FT                   GAMPGASRWSLAALTGEVQRAYDLGVRCIVLFPKVSEGLKTEDGAECFNANGLIPRAIR
FT                   QIKEAIPEMAIMTDVALDPYSCDGHDGIVSQDGVVLNDETIELLCKQAVVQAEAGADLI
FT                   GPSDMMDGRVGAIREALDDEGFEHVGIISYTAKYSSAYYGPFRDALDSAPRAAGSKPIP
FT                   KNKDTYQMDPANAREAITEAQLDEQEGADIMMVKPGLAYLDIIHLLREESELPIAAYNV
FT                   SGEYSMVKAAAERGWIDEKAVVLETLLSFKRAGADLILTYHACDAAAWLKEA"
FT   gene            499751..500149
FT                   /locus_tag="Syncc9605_0508"
FT   CDS_pept        499751..500149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0508"
FT                   /product="possible ring-cleaving dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34282"
FT                   /db_xref="GOA:Q3AMA0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AMA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34282.1"
FT                   /translation="MATADQPRGVDRLGHVAIRVENVDRAVAFYTDLGMRLVWRADDWC
FT                   YLEAGEGRDGLALLGPDYKAAGPHFAFHFRDRAEVDVIHDRLKAQGVHVGAVHDHRDGT
FT                   ASFYLKDPEGNWLEMLYEPPGGIPSNCD"
FT   gene            500151..502550
FT                   /locus_tag="Syncc9605_0509"
FT   CDS_pept        500151..502550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0509"
FT                   /product="MutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34283"
FT                   /db_xref="GOA:Q3AM99"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34283.1"
FT                   /translation="MSQEADRAQKETLELLEWHRVCDHLSGFASTGMGRDAARVQPLPA
FT                   SLDESKQRLAETVEMAVLNDLTEGGLSFRGVQNLEPVVLRCSKGGVASGEELLAVAETL
FT                   AAARRLRRQIDDPELRPVCTALIETMVTLPELEQRLKFALEEGGRVADRASSALSALRH
FT                   QWNGLRQERRDKLQELLRRLAPSLQDSVIAERHGRPVLAVKAGAVSQVPGQVHDSSASG
FT                   STIFVEPRSVLTMGNKLAELESRIRDEERKVLAELSALVAEEASALNQVVAVLRTLDLA
FT                   LARGRYGRWLGGVEPQLEPAAEAPFRFSGLRHPLLVWQHKRADGPPVVPISVEVSPELR
FT                   VVAITGPNTGGKTVTLKSIGLAALMARAGMLLPCSGQPSLPWCAQVLADIGDEQSLQQS
FT                   LSTFSGHVKRIGRILEALQRGSAPALVLLDEVGAGTDPSEGTALATALLKALADRARLT
FT                   IATTHFGELKALKYDDARFENASVAFNPETLSPTYELLWGIPGRSNALAIATRLGLDSD
FT                   VLHQAQQLLAPGGDGEVNSVIRGLEEQRQRQQAAAEDAAALLARTELLHEELLQRWQKQ
FT                   KQQTAQRQEQGRQRLEQSIRQGQKEVRTLIRRLRDERADGETARRAGQRLRSLEDHHRP
FT                   TPERRAPKPGWRPAVGDHVRLLALGKAADVLAITDDGLQLTVRCGVMRTTVDLTAVESL
FT                   DGRKPEPPPKPVVKVHARSAGGGGTQVRTSRNTLDVRGMRVHEAEAAVEECLRSANGPV
FT                   WVIHGIGTGKLKRGLRAWLDTVPYVERVTDAEQGDGGPGCSVVWVR"
FT   gene            complement(502573..503751)
FT                   /locus_tag="Syncc9605_0510"
FT   CDS_pept        complement(502573..503751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0510"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34284"
FT                   /db_xref="GOA:Q3AM98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34284.1"
FT                   /translation="MAGVRFEDLSKTFPGRGGGDPVDVIRQLNLTINDGEFLVLVGPSG
FT                   CGKSTLLRLLAGLDHPSSGEIRIGTRPISDVPPARRNVAMVFQSYALYPHLSVRDNLSF
FT                   GLRRSQARSTFQRIQDQAFRSTRMLPKPLRVRSVREEQIEARVNTVARSLELTELLDRR
FT                   PKELSGGQKQRVALGRAMARNPEVFLMDEPLSNLDAKLRTSTRQKIVELQRELGTTTVY
FT                   VTHDQVEAMTMGDRIALLNQGRLQQLGTPMELYRWPSNIFVAQFIGSPAMSLLPITVGP
FT                   NATLILGSKRIQVEGDMVEPLLQREGQHLTAGLRPEHWHLAPATNRNLQAEVNHCERLG
FT                   NEQILTCRLVDGDQLIQVRGSADINIKAGDAIHLDPDPTGWRLFEADGEAIR"
FT   gene            503810..504799
FT                   /locus_tag="Syncc9605_0511"
FT   CDS_pept        503810..504799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0511"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34285"
FT                   /db_xref="GOA:Q3AM97"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34285.1"
FT                   /translation="MQFIDQARITVRGGRGGDGIAAFRREKYVPAGGPSGGDGGCGAPV
FT                   VLEADSNLQTLLDFKYKRLFAADDGRRGGPNKCTGASGKDLVIKVPCGTEVRHLRTGIL
FT                   LGDLTAPGERLTVAFGGRGGLGNAHYLSNRNRAPEKFTEGREGEEWPLQLELKLLAEVG
FT                   IIGLPNAGKSTLIAVLSAARPKIADYPFTTLVPNLGVVRRPSGDGTVFADIPGLIEGAA
FT                   QGSGLGHDFLRHIERTRLLIHLVDAGSEDPVADLNVVQQELEAYGHGLVDRPRLLVINK
FT                   QELVSEDDLPKLQQELKEASGRPVLCISAAMGTNLDQLLAETWVELGV"
FT   gene            504893..505075
FT                   /locus_tag="Syncc9605_0512"
FT   CDS_pept        504893..505075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34286.1"
FT                   /translation="MTFYTCLDNKGGVIARCQTKEDVAVLQRMGRPIAEVKAMRKEEAV
FT                   VCSLTGSPSDYNEDY"
FT   gene            complement(505106..505324)
FT                   /locus_tag="Syncc9605_0513"
FT   CDS_pept        complement(505106..505324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34287"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34287.1"
FT                   /translation="MKSIDEHIQKDQSEIEAAKAAGDDAKVRHLTDELKSLEEYKEHHP
FT                   GDSHDPTSLELHCEANPDADECRVYDD"
FT   gene            complement(505463..507364)
FT                   /locus_tag="Syncc9605_0514"
FT   CDS_pept        complement(505463..507364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0514"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34288"
FT                   /db_xref="GOA:Q3AM94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34288.1"
FT                   /translation="MSLISLVGAAKDFGIRTLFSDLDLHIAEGERLGLIGPNGAGKSTL
FT                   LKVLAGKEPLGEGERRCSPRLRVELVGQESRITPGLTVLEQVLEGCGAKRDLLVRFSAL
FT                   SDAIAADPSNEALMAELGQLSQRMDEEEAWSLEQQCREVLQKLGISDLQRPVDDLSGGY
FT                   RKRVGLASALVACPDVLLLDEPTNHLDAAAVEWLQSWLDRYPGALVLVTHDRYVLDRVT
FT                   RRMVEVDRGQARTYQGNYSTFLQHKAEEEASEAASVAKFKSVLRRELAWLRQGPKARST
FT                   KQKARLQRIEAMREQKPNQAKAKLEMTGISRRIGKQVIEAEDVGVTADGSQGGRPLLDG
FT                   FSYSFSPEDRIGIIGPNGSGKSTLLDLIARRREPTQGSLLLGETVHIGYLDQHTEDFNK
FT                   GKGLDRKVIEFVEEAASRIDLGGEQVTASQLLERFLFPPAQQHSPLAKLSGGERRRLTL
FT                   CRMLIQAPNVLLLDEPTNDLDVQTLSVLEDLLEDFRGCVIVVSHDRYFLDRTVDRLFCF
FT                   DQGRLNRFEGNYSAFLEQQRQEERSQTQASKPSSPKPERSSETKRDGPRRRNFKENKEL
FT                   AALDQQLPDLELQKEELEQQMTQEGADMAKLSLDLADLISRIEQAEERWLELSELAP"
FT   gene            complement(507361..507999)
FT                   /locus_tag="Syncc9605_0515"
FT   CDS_pept        complement(507361..507999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0515"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34289"
FT                   /db_xref="GOA:Q3AM93"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34289.1"
FT                   /translation="MTSADPTFEGVYGTYSITAADRQEVRFYRIALLITGLSLAAGVLQ
FT                   WWQTDSPWAWLWVLPMATALGLALRWIHIYLRPLHRALQLFWLSGCIGWGALLLQAGPT
FT                   EVLSVLRDQPLWILAIGPLFAALAGIGFKEFFCFQRPEAIGLTLLLPAALLGHLVGLIN
FT                   GPLCLALLEAAALLLVLLALRKFGMEAAADVGDKSVFAYLDGQLPAGTP"
FT   gene            complement(507996..508970)
FT                   /locus_tag="Syncc9605_0516"
FT   CDS_pept        complement(507996..508970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0516"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34290"
FT                   /db_xref="GOA:Q3AM92"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34290.1"
FT                   /translation="MSIPPVVVTAARRSWRWQWQRLMGGLGPADAAGSYTRPSSNPLTP
FT                   PALKPPDLLQRSAGQRPMLVIGRSCPWAHRTWLVHQLRHLHDSVTLVMARADHNAGRWA
FT                   LDPAWEGCKTLLELYQLCDAPPSYRATVPVLVDPKTRTLLGNDSAPLVDLLNRWPHHDE
FT                   VVDLAPAEATDRIQAWQHRLQPAINDGVYRCGFARNQAAYDHAEADLFTALDAVEQSLE
FT                   SNGPWLCGEALTLADVRLFPTLIRWELVYAPLFGCSRQPLWHYPNLWKWRQRFYRLPGV
FT                   ADTCDGTAWRHDYFGALFPLNPSGIVPAGPDLSTLVNSTAASG"
FT   gene            509041..509955
FT                   /locus_tag="Syncc9605_0517"
FT   CDS_pept        509041..509955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0517"
FT                   /product="Aspartoacylase"
FT                   /EC_number="3.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34291"
FT                   /db_xref="GOA:Q3AM91"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34291.1"
FT                   /translation="MSSCGVLVVAGTHGNEVNAPWLLQQWQANPDLIDAAGLAVQKVIG
FT                   NPEALRRRCRYVDRDLNRCFLPEQLEQGASGLEFQRAGELLRLHGPSGEQPCAVAIDLH
FT                   STTAAMGNSLVVYGRRPADLALAALVQGALGLPIYLHEADAQQTGFLVESWPCGLVIEV
FT                   GPVPQGLLNAGVVEQTRLGLESCLRALYQVRQELARLPDALVVHRHLGSRDLPKAENGE
FT                   PQALVHPELQGRDWQNIASTQAMFRAADGTDRCEAWVGGEIPVFVNEAAYAEKSIAFSL
FT                   TRREVWPVEPNWLLALKQLLAAA"
FT   gene            complement(509952..510278)
FT                   /locus_tag="Syncc9605_0518"
FT   CDS_pept        complement(509952..510278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34292.1"
FT                   /translation="MRRLIPLICLGMTSVGLSSCGVVPSSNDKPSASASIEQLERRINQ
FT                   LEQKLQELRSPAGAPDSKTPTGPLRSLTLRIGTEDDRLRMYWADGQTSNLICSEEGKGV
FT                   WACG"
FT   sig_peptide     complement(510213..510278)
FT                   /locus_tag="Syncc9605_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.462 at
FT                   residue 22"
FT   gene            510640..511719
FT                   /locus_tag="Syncc9605_0519"
FT   CDS_pept        510640..511719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0519"
FT                   /product="photosystem q(b) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34293"
FT                   /db_xref="GOA:Q3AM89"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34293.1"
FT                   /translation="MTTTLQQRSGASSWQAFCEWVTSTNNRLYVGWFGVLMIPTLLAAT
FT                   ICFVIAFVAAPPVDIDGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDE
FT                   WLYNGGPFQLVVFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPF
FT                   GQGSFSDAMPLGISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSS
FT                   LVRETTESESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVV
FT                   GIWFTALGVSTMAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFP
FT                   LDLAAAESTPVALQAPAIG"
FT   gene            512008..513654
FT                   /locus_tag="Syncc9605_0520"
FT   CDS_pept        512008..513654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0520"
FT                   /product="alpha-acetolactate synthase; RBL02971"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34294"
FT                   /db_xref="GOA:Q3AM88"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34294.1"
FT                   /translation="MNGAEFLVKALEAHGVTHVFGIPGAKVDSVFTALLDSPIELVLCR
FT                   HEQNAAFMAQAFGRLTGRIGVCLATSGPGVTNLVTGLATATTEGDPVLAIGGEVPLDDR
FT                   YKHTHQSLDAVALMRPVTRFSQSALNAHDLPEVLGNAIRAAEKGRLGAAFLGLPKDVGL
FT                   AKIDADPAAGWGQQVRQGPSHPEDLKTAVDILKDLQRPLLLLGMQASDPCISEALQTYV
FT                   QRSGIPYCATFQGPGCWVAPEQYVGRLGLFRNQPADALLDAADGVICIGFDPVEYDPSI
FT                   WNSDQQRPIVNVDVQPADQDRAFLPRVELIGDLQQTLIALATLPKMSVSDDFLQLEQAY
FT                   ASELQATAAEGLSMGGAAPVHPLRLVHEISIVTTEDTTLCLDVGSHYIWMNRYAQAERA
FT                   RQVLVSNGQQTLGVALPWAIAAGMVRHGSPVISVSGDGGFLFTATELETAMRMGSRFVH
FT                   VIWNSNSYNMVEFQEQAHYGRVSGIHLGDYDVVKFAESFGAKGYTINHADELGPVLRDA
FT                   LKQPVPALINVPVDYTDNIQLMQNVHQEFIH"
FT   gene            complement(513856..514239)
FT                   /locus_tag="Syncc9605_0521"
FT   CDS_pept        complement(513856..514239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0521"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34295"
FT                   /db_xref="GOA:Q3AM87"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34295.1"
FT                   /translation="MASAEYINGMNEMRSHFGDAADDWIAAIHDIYPEFAKVNVEFPFG
FT                   ELYRRDVLDDKTRELCTVAALTVQGFALPELKVHVKGALNTGSSRAEILEIITQMIAYC
FT                   GFPAATNALLATKEVFDEIDSTK"
FT   gene            complement(514684..514869)
FT                   /locus_tag="Syncc9605_0522"
FT   CDS_pept        complement(514684..514869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34296.1"
FT                   /translation="MQVQRINVSVVEGTEVDIEVDLEQIFNDADTSLVQAQVLEDEPKD
FT                   RAKNFIEREVCSQTDC"
FT   gene            complement(514936..515928)
FT                   /locus_tag="Syncc9605_0523"
FT   CDS_pept        complement(514936..515928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34297"
FT                   /db_xref="GOA:Q3AM85"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34297.1"
FT                   /translation="MWGDAAESTPAVVVDQQSLLEKQDRLEELQRSYDGEERLNESFIV
FT                   LTIGASLIASLGLVADNNAVIIGAMVVAPWILPLRVAVFAILIGQARLLSRSLITLVAG
FT                   AGITLILSMGLGLIARTQGVLVVEALPGQIIARLEPNTFDLGIALAAGAIATYAKVNPG
FT                   AVSSMAGMAIAVALVPPVCVMGLMLSGPDISSAQGPALLYAANLLGILIGGITVLAIRE
FT                   PYFRDKLRRRRRSRLPVLLALGLAVIVGQKLYGRYDQYRFKLNTEVAQKQIESEIRYYL
FT                   KNETLTFGANDAVELEKVVFDWPNYWEQNQAPSFQVVVRSLDPKLPSYK"
FT   gene            complement(515909..516703)
FT                   /locus_tag="Syncc9605_0524"
FT   CDS_pept        complement(515909..516703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0524"
FT                   /product="Band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34298"
FT                   /db_xref="GOA:Q3AM84"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34298.1"
FT                   /translation="MQTPRRINDPANSLAVVVAIVLSALLLLGQALFIVPAGKVAVVTT
FT                   LGKVSGGSRLPGLNLKVPFVQSVYPFDVRTQVKPEEFATLTKDLQVIEATATVKYAVRL
FT                   NEAGRIYRTIAGNDREIYPRIIQPSLLKALKSVFSQYELVTIATEWNDISALVERTVAE
FT                   ELDKFDYVEVRGLDLTGLQIAEEYRAAIEQKQIAEQQLLRAQTEVKIAEQEALRYDTLN
FT                   RSLDDQVLYKLFLDKWDGQTEVVPALPGSNGSTPPVIVGRRS"
FT   sig_peptide     complement(516614..516703)
FT                   /locus_tag="Syncc9605_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.702) with cleavage site probability 0.547 at
FT                   residue 30"
FT   gene            complement(516807..517085)
FT                   /locus_tag="Syncc9605_0525"
FT   CDS_pept        complement(516807..517085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34299.1"
FT                   /translation="MRSLNGLLPLSIALSLLSSAAGALEMGPCEPAKAVKIIDTSIKEG
FT                   KTLQQAMEMMIKEKVFDGSKACITFIRETSMTMRDPHPSAFKALWLN"
FT   sig_peptide     complement(517014..517085)
FT                   /locus_tag="Syncc9605_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.745 at
FT                   residue 24"
FT   gene            517644..517937
FT                   /locus_tag="Syncc9605_0526"
FT   CDS_pept        517644..517937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34300"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34300.1"
FT                   /translation="MTVNREQARDALATLLEVFAGPNYSGALRDGDLTTRLERCTGWVK
FT                   AEASEAASLIESCVPHGKPMLAQAQQRLAVLESLKTLQEVAVNHFGPLEDPS"
FT   gene            complement(517944..518240)
FT                   /locus_tag="Syncc9605_0527"
FT   CDS_pept        complement(517944..518240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34301"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34301.1"
FT                   /translation="MLTTSTRLKLQNICSRLAQGEFVSLQERVYLQKFAERDRSVSTWV
FT                   SRAQRFQREGTQQGLDGLMANLDLGRRNPDDPEHPEDDLGDWFSNASPWLRRD"
FT   gene            518321..518836
FT                   /locus_tag="Syncc9605_0528"
FT   CDS_pept        518321..518836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34302"
FT                   /db_xref="GOA:Q3AM80"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34302.1"
FT                   /translation="MAWFSYPDGMEHEEAQSLRPISSDSPWLERCGTLLRPQGDPAMFG
FT                   PADADLYFAADGLPRFYVMRIRRRPPVLKSMTRHYRVSQCLGSADAQPWWLAMAPSTDS
FT                   GCPPAVSSIALIKFQAGEAFKLHPGTWHAGPFVQEQSALFFNLELRTTNEDDHNSLALP
FT                   QLLRLNLI"
FT   gene            519337..519564
FT                   /locus_tag="Syncc9605_0529"
FT   CDS_pept        519337..519564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34303.1"
FT                   /translation="MPSIDPENLSPQDVLTILLHLFQQQPGFVDRGHEVNNKETAWVNG
FT                   FLFRLQNDATAERLSIEEVGSSVDKISALR"
FT   gene            519660..519851
FT                   /locus_tag="Syncc9605_0530"
FT   CDS_pept        519660..519851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34304.1"
FT                   /translation="MFAVQELTVEGWSNRAEHASKDNAFWHARARSDADGHTYRLISEE
FT                   NHVVCLLTSRGSECWELD"
FT   gene            519891..520208
FT                   /locus_tag="Syncc9605_0531"
FT   CDS_pept        519891..520208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34305"
FT                   /db_xref="InterPro:IPR021705"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34305.1"
FT                   /translation="MSDDTQQTHPLYAIDRDQIDAVLGHEGTPGPQQLTTIAALFSRYA
FT                   DFPGAEDIRDDLQKCLTLWGLSRDELNLKTREIWESGWRPGQDPVAEGVGSGADVEDAD
FT                   A"
FT   gene            520343..520744
FT                   /locus_tag="Syncc9605_0532"
FT   CDS_pept        520343..520744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34306.1"
FT                   /translation="MHRSTHHFSEEKKGSKRLARGALGPWARGVGSFSPLAPETVQVER
FT                   RLAWRTIACPLKDQPRSLLRLLEQGPESQSASLVCWGGVSSVMGSSDLDAHSFVPSGHK
FT                   VISIKAHCLEGLNDRLLGWHAFQSTEAGA"
FT   gene            complement(520776..520991)
FT                   /locus_tag="Syncc9605_0533"
FT   CDS_pept        complement(520776..520991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34307.1"
FT                   /translation="MFHGMNNEQQAELERLERVLAVAKRNGNELFIQNIEREIAAVQRG
FT                   ESSPLIEEYLTEEERASRDVDHQTGV"
FT   gene            521393..521683
FT                   /locus_tag="Syncc9605_0534"
FT   CDS_pept        521393..521683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34308"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34308.1"
FT                   /translation="MASTPSMTFLMHWSFKTGYHEIAAKKFLSTGAPFPECKSWKRWHA
FT                   PGSVEGWILVEADTADACYEHAAEWAECLDWEVTPVLSDEQAGPLIAKAYS"
FT   gene            522048..522278
FT                   /locus_tag="Syncc9605_0535"
FT   CDS_pept        522048..522278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34309.1"
FT                   /translation="MPSPQPIIHAMTEVNKKLQVHFQHLSNPELDASDRETIGIHAAEG
FT                   VRRGFTVMVLHQRFFNLMLDELEQEALAVQS"
FT   gene            522278..522463
FT                   /locus_tag="Syncc9605_0536"
FT   CDS_pept        522278..522463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34310"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34310.1"
FT                   /translation="MAEPMKPRALTYTEMMNGGRQQMDEAEHAREQQLKQRVDALQKDV
FT                   DQLEKSLEGGSESASS"
FT   gene            523595..523795
FT                   /locus_tag="Syncc9605_0537"
FT   CDS_pept        523595..523795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34311"
FT                   /db_xref="GOA:Q3AM71"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34311.1"
FT                   /translation="MLTVFRLSAAERRFALTSFAVKVAIFWIAQLMVCVLDPRRLVCGV
FT                   VEKGFLPCLISFAVMDFLVIP"
FT   gene            complement(525654..525872)
FT                   /locus_tag="Syncc9605_0538"
FT   CDS_pept        complement(525654..525872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34312"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34312.1"
FT                   /translation="MPISVELSCQQAFADLEALSGPWQDAWETSDPDLAALLLRLFGTH
FT                   LQVHSDRIMKAMILERLDALELPPRLR"
FT   gene            526279..526635
FT                   /locus_tag="Syncc9605_0539"
FT   CDS_pept        526279..526635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34313.1"
FT                   /translation="MTSIKEAQFPATPSSGELRKKYGELREAAQFLSRSRGQYKGQVTR
FT                   LTTRITEMECELRQFASAAEMTLRQKAELDNLLLNTTTSLKALRSPVMSWRTHGTTIRD
FT                   ASGVAMPSVSCSSP"
FT   gene            526696..527079
FT                   /locus_tag="Syncc9605_0540"
FT   CDS_pept        526696..527079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34314"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34314.1"
FT                   /translation="MNLRSVIERSVEADRTLARLVGQHIDDSAKGLRELKDISTKEEAA
FT                   ETYQLVGTALGPASFDELNALTDKRLRQMLTAQKIPGRGAKGMKKADRIQLLLDHKAPM
FT                   LPSYEQLLRFWYDQSAPQIITAR"
FT   gene            527232..527771
FT                   /locus_tag="Syncc9605_0541"
FT   CDS_pept        527232..527771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34315"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34315.1"
FT                   /translation="MTMPGVVIYAEDVVAWNMSDNTIQRSYHGWFGAKSFYSPNEDQRF
FT                   FIKYMGDDGTRQLVQVAFLNHKPARSFINMMGLWSGLESENLRTTITADKRTAVKDPGT
FT                   VKPFEDVTTSPNAQNKGAHNLGQGSVPAKRYRKTPKPQLKACWSVHLEANPSMKVWADS
FT                   NPEAAEKVKSKKYDDC"
FT   gene            complement(527869..528369)
FT                   /locus_tag="Syncc9605_0542"
FT   CDS_pept        complement(527869..528369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34316"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34316.1"
FT                   /translation="MAASTVGGQRDWSRGQYLSNAEQATGIIEWLARWNLRPGTTKVIA
FT                   DDAVFNATGSARGSTAGDFKAAGCPLRRAGKMNAREANGLALVRTMLHAAGCDAETPWL
FT                   LWTRACEGLMATWPTLPRHPRDVERIADGCANHSLDAVRYWVQWYRTKWKMGSSQSRLG
FT                   QVW"
FT   gene            complement(528315..529007)
FT                   /locus_tag="Syncc9605_0543"
FT   CDS_pept        complement(528315..529007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34317.1"
FT                   /translation="MPFGRVELAYTGAGPAEQVRALARLQGRSFICAIHDEVGNHFDAG
FT                   FIDSSAATLRGPAGVPTRTILLGNPGGPFHPVLQARYGIPAGYPEAGKASRFLEDLGKH
FT                   CIFASFTAASNQHLDLDQYIRNIKVACADDSALLDAWLHGRLDVDIAGAFFGSSYGMRR
FT                   SLRDVRPGGVPPEELKRAFVAMAPRPWRISAYRNQPAPPGVRSGCWMSSMWRPALLVGN
FT                   GTGAVGNT"
FT   gene            complement(529106..529357)
FT                   /locus_tag="Syncc9605_0544"
FT   CDS_pept        complement(529106..529357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34318.1"
FT                   /translation="MRWPDWCMAVTPTQAPATAAGPEIKDPTLTQQLMLDAPFGDDLCV
FT                   ISARGTGKSWEIVMLVARDAAHWKERYSCLITRTTYQA"
FT   gene            529410..529718
FT                   /locus_tag="Syncc9605_0545"
FT   CDS_pept        529410..529718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34319"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34319.1"
FT                   /translation="MRIYSLLNVDLDTQTQCQKLWRKDPFGVETSAFAEENLGRANLGN
FT                   PIEGISKLNSSDIDFTASKIMKPATPTITTANKMVLSSMRKLPRKLLKPQQSETESV"
FT   gene            complement(529824..530111)
FT                   /locus_tag="Syncc9605_0546"
FT   CDS_pept        complement(529824..530111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34320.1"
FT                   /translation="MKRFLFVAASLLLAFTAEAEVRGYGALTLDFTRARKMGQSIVIPA
FT                   ERDQKQKLHVAVVCEGRVFNSTDDEMKWGEWREPNNIFESRIVADVCNFI"
FT   sig_peptide     complement(530052..530111)
FT                   /locus_tag="Syncc9605_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 20"
FT   gene            complement(530355..530633)
FT                   /locus_tag="Syncc9605_0547"
FT   CDS_pept        complement(530355..530633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34321"
FT                   /db_xref="InterPro:IPR022240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34321.1"
FT                   /translation="MTETTVLDFKLSNTFEEYRAHMNAPEQQAMFGEMGVKTFFIGVCK
FT                   DDPQRATVMFQGPEDVLYNIFTNPETKPIVEASGHVYEGTVITRWLA"
FT   gene            complement(531643..531975)
FT                   /locus_tag="Syncc9605_0548"
FT   CDS_pept        complement(531643..531975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34322.1"
FT                   /translation="MGSASSVSYPLRQRASLLFAKSVLLDTSERAELSHHMYVEASSMA
FT                   KSNLIVETPHGASIQKTEDGQFIVCDGENNCRITRTLYSAEQELSVMETGFSFPYSTAF
FT                   HLARVG"
FT   gene            532040..532429
FT                   /locus_tag="Syncc9605_0549"
FT   CDS_pept        532040..532429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34323"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34323.1"
FT                   /translation="MASFDKSTPFMLLARIHVKPGCVDQYLELARVTDEAVQTSEPGMI
FT                   HHTFDQDPEDPQAFVWSEVYANDEAFSAHVSNPPVQEYLQKHVELGDGFSVEVYGTIGD
FT                   ECRQLMESFGLPLKIFETKLGYSRV"
FT   gene            complement(532958..533530)
FT                   /locus_tag="Syncc9605_0550"
FT   CDS_pept        complement(532958..533530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34324"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34324.1"
FT                   /translation="MQLLETTSRAEINLPCRHEKLAEITCCKAASDCLLSSRSMVRIHQ
FT                   GASPLKACSALASQRRQAPLAGAFFMPSRPPGVSQSMRRCLVSNLRPIRALPDHRTGGR
FT                   HLTQPVFCIVPQASMALWRSIRRWVIGAGCRSRTDGCGCRRSANDSHRRTTGAKKSAGM
FT                   FSGLLRIRFGGDTSTLDASVREWHRHP"
FT   gene            533693..534091
FT                   /locus_tag="Syncc9605_0551"
FT   CDS_pept        533693..534091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34325.1"
FT                   /translation="MPSASTSDEVDSLHIRARAMRSIAVLTAAVLATVVSPANAEKLKL
FT                   RCESPLVPSASSTLYIDEVNGQITQIWDSTGYEETSPATFKEGVWRWLGWRTRESHGVT
FT                   DISLDRRTGEIFGTTPSGKLLPLGPFCR"
FT   sig_peptide     533693..533815
FT                   /locus_tag="Syncc9605_0551"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.761 at
FT                   residue 41"
FT   gene            534160..534330
FT                   /locus_tag="Syncc9605_0552"
FT   CDS_pept        534160..534330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34326"
FT                   /db_xref="InterPro:IPR021453"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34326.1"
FT                   /translation="MIVTDTEVAWRMADVIWVDGGARNPKVPILFQVADVDTGVINWIN
FT                   ADLVTHIVPRV"
FT   gene            535525..536205
FT                   /locus_tag="Syncc9605_0553"
FT   CDS_pept        535525..536205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0553"
FT                   /product="putative maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34327"
FT                   /db_xref="GOA:Q3AM55"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34327.1"
FT                   /translation="MPSLELYGCWRSSASQRLQIGLRLKKLPFSYTPVSLDRGEQHRDW
FT                   YRTINPRAELPTLVVDGEPWVQTLAILETLEETFPEQGHSLLPNTHRERRICRAIAEQI
FT                   NSSMQPLLLPARLRKPIIEAGGQTAAAPLEPALHAGIRQHQLNALNSLNTWLASLPGPF
FT                   CLDSSPTMADACVVPQLDAVMRLGLDLSPFERLVALHRHCQSLEAFAMAAPDQQPDAPN
FT                   RLSG"
FT   gene            complement(536223..537812)
FT                   /locus_tag="Syncc9605_0554"
FT   CDS_pept        complement(536223..537812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0554"
FT                   /product="GAF"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34328"
FT                   /db_xref="GOA:Q3AM54"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34328.1"
FT                   /translation="MPIMRFRRLRSMQSLDQRMQRVVVRRQELAQRWDALRNNDLFQLL
FT                   VVTLPDLLRAERCGVFVLDPDADELWLEAGTKVVQRQICADVEGSMVGECVSTGSCVNR
FT                   SGLEILEGAHQKVGEALSYKVSTAITVPINGDALEVVGALQVLNRIDGKPFSAADQTQL
FT                   EAVANAIQPSVQVMYASRALQQRSLKLDHTIEVLRDRLEALRPGHSFRTFEPALLAHEE
FT                   GFLHHRWNGRCYPPFIDYRATEHLTKTWDTQPNDVFLATHQKVGTHLAKKFLVELVRAN
FT                   VELPGRHPMVDGDIGHGAMPWPEVLLSQETPGDWQRFQAATSDCPRLWYLHCAVDDLPC
FT                   RRIHPQTRFVVAIRDPRAALVSQYFFWVRHPLLQVDPELELDRFAELFVQGDLYFGSYF
FT                   RHIRGWLTPEPRLQASQICALRYEDMVERKAETVEQLQQFLFPSATLEPERAAAIAAGT
FT                   EFQAMKQGITENPGSFHLNPKLYFRAGTTDNWRQHLSPRAEALVATAAREQWAGIETHP
FT                   LLAGYLEELSDL"
FT   gene            538656..539633
FT                   /locus_tag="Syncc9605_0555"
FT   CDS_pept        538656..539633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34329"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34329.1"
FT                   /translation="MSSTSNKVSVDKSNYAKAETTDVLKDYIKKISKGTCTTGVGVFMH
FT                   QRSAMDPADRTILRPNFDTLYSFAVLDLKNPATINLPEITRYQILEIVTGEHWIPLVSD
FT                   KPGTYQITQELTGSRYAFAMVRTQVNMQDENDLKNAREAQDKLELVQASQGVYEQDKEF
FT                   NRSEILSLRAEYNQRRQPEGITSEMIFGKEGEISPEMRNFGVAIGWGGLPKQGAVYPMP
FT                   KLTESTDPQRLIMKNVPMEKGSFWSVTVYDENGFSTGKYYNINSAFAKESNPGEYIINL
FT                   GGSENEDNFLNIFPGWNAVIRIYSPTKDYFNGSWEVPQYEPKNQ"
FT   gene            complement(539755..540105)
FT                   /locus_tag="Syncc9605_0556"
FT   CDS_pept        complement(539755..540105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34330.1"
FT                   /translation="MVMDVVVKEGIVAGDCVLLSCGDSAQLLKVSDVDGCQIQLDGEVT
FT                   SVDGEWCKVRVQLESKHGIFGRQPITTVLTTRLKTVELTDRVHVWNQLKAKSIDRVRRT
FT                   GTDECEFWAPLS"
FT   gene            complement(540400..541053)
FT                   /locus_tag="Syncc9605_0557"
FT   CDS_pept        complement(540400..541053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34331"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34331.1"
FT                   /translation="MVRIHQGASSYTRAFQPILTRHPAGFPAPDQPVRFYREDTASSTV
FT                   YIGSNIAANPHLDFEQTRRQIEIAAGGDPELLRAWLESSFEGDVTGSFFGDAMSSRRNL
FT                   LELNGGDRPEIPTGSRLLVSFDWGIAAPSCATLFITNHPLLPRGSPFAIDECDLAKATR
FT                   AGEPDWNAGLEASNLQQAQILQEWISRWGLEPQDLGWIMDDLLEPDWSRDDHRG"
FT   gene            541216..542016
FT                   /locus_tag="Syncc9605_0558"
FT   CDS_pept        541216..542016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34332"
FT                   /db_xref="GOA:Q3AM50"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34332.1"
FT                   /translation="MELLGFLLAALAVAFVIAKVLFKQQAGPSPNNSRAVSHSAVNEAE
FT                   SWVEKDAESLLDGIPLKGMVFHATFKLTTPLAVLEQHGLLVPQGEPLPKVMPGAGSSED
FT                   PFGAYGMWFHEIDYEAQGFIPPAPSLIWTQLGHYRENDPEYAELLEFLKGFRRIVESTD
FT                   DVMEALDHLQDFSRQSQSHQRVWERYTDLFPEFPMHYFAEQLRFNIGGSKKHARCLIDA
FT                   GYTSPQKVRDASDAELLQVKGIGSITVKRIRERLANPGERFDMD"
FT   sig_peptide     541216..541272
FT                   /locus_tag="Syncc9605_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.700 at
FT                   residue 19"
FT   gene            542873..543166
FT                   /locus_tag="Syncc9605_0559"
FT   CDS_pept        542873..543166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34333"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34333.1"
FT                   /translation="MVLAAGFHTPKALAEITVYNVNAIHELFSENEIAAKKIYHNKKAL
FT                   VFGRVDKVDDENVIIEGDSEFGRLFCRYGSQDLNKVLALREDSRVRSVEHLK"
FT   gene            543406..544149
FT                   /locus_tag="Syncc9605_0560"
FT   CDS_pept        543406..544149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34334"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34334.1"
FT                   /translation="MLYTQTTKRRLKRVKKQILAATTLLLLGSGSALAGTYDALCGDME
FT                   CQISVSGKGVSSPAGFTPIDLISQWNVGKASDYNAGKGVAGGLGGATAGAIGGAVLLGP
FT                   IGLLGGLIGGAIAGADAGKEFEGYFTIVGYNKKGEKIAHNFFFINRKPVKRLLSELPLI
FT                   TGLALGEERDLSEIEAAFSGQSKSTNAKENLPSRLGQTKTAAKKDKCWEDFLNSNPAMA
FT                   VWANNNPQLADKQRVKSGYNLCEKN"
FT   sig_peptide     543406..543510
FT                   /locus_tag="Syncc9605_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            complement(544231..544650)
FT                   /locus_tag="Syncc9605_0561"
FT   CDS_pept        complement(544231..544650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34335"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34335.1"
FT                   /translation="MSENQLVNRFDAIPPHIIKALTLCANGSTWADAAAAVGIKAPCLR
FT                   KWYRDRRAEEFIETLVRENLNVANNLLTSAAPRLADELIQIALDPNVKAYARTQAISES
FT                   FKILRENVLEAEQRRQLQEIRQTLQSLEDSKTVTV"
FT   gene            complement(544647..544901)
FT                   /locus_tag="Syncc9605_0562"
FT   CDS_pept        complement(544647..544901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34336"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34336.1"
FT                   /translation="MSTPWNTTMDEWLVLSRCNRVAEQLFSRDRHAADEFARLAYQRWM
FT                   LEGVTPEQLRDRRAPGMSDQRRLRKWKQLKSKGFPGAMS"
FT   gene            545219..545794
FT                   /locus_tag="Syncc9605_0563"
FT   CDS_pept        545219..545794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0563"
FT                   /product="phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34337"
FT                   /db_xref="GOA:Q3AM45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34337.1"
FT                   /translation="MKSNRHGQSRVLSTDELDLLISKLPEQHHKIVAEICRRTGCRIGE
FT                   ATQLTWGMVSESAVTFQKGITKGKLASRSVPVTPALWEALRSWRGAWVVRQGREPAAGD
FT                   HLVPGRFAGSCLSTRSFMDALERAAAESGLEGVSSHSFRRSALTSAHNAGVPLRVLMAL
FT                   SGHKSMSALQRYLEVTPAQREAAAAAFA"
FT   gene            complement(546860..549568)
FT                   /locus_tag="Syncc9605_0564"
FT   CDS_pept        complement(546860..549568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0564"
FT                   /product="ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34338"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34338.1"
FT                   /translation="MGTPCKQTSEVVDVQASIVLEEEPLELTDIDEKEAQRHLEAVGFG
FT                   EDDPCILACYGDTSRYVPARDLKNDLPYDWDQVVAKFNGDRRFDLVRHHLQNPKTPNLG
FT                   FLSAIGGTSKRRDTITGVVCMSYEIDEGLDLEGQKVAWKKANLPTPTIGVFTGNKSIHW
FT                   SWVFRTPVSLTAAEFCRERLSKAIEDANPGVQTDHNLHSAVQVQRLAGSVHPKTGRRAE
FT                   IIHLSPHTYELDEVLSFLPELDEPVDDVTDSGGDFRPADGPEPDDHEQFPDFSTLPPGH
FT                   LIQALAPKTLGLLKGLDPDSDDRWRKCWQLSKHLRAGRLHLESLGCTVVDADSIEMTLM
FT                   SDFIRASGMKGGDVEAALEEHYRPEPCGTSDYCDTYLKRKLRAHFEHEGLWRHSYGWHK
FT                   RLVPASNPADWTANIDDSFWTVCRIKTCEVVIENAIGLKGDLTNQPLAHSRGRFVRYNP
FT                   DQGCWLHVSRDAMKREVADLLLKCFSYNKDEEKVFRFSTASRVKSSIEWLETMTADAEM
FT                   DQTPAIAFANGTYLIDKGELVPHKPEYRLTYSIQGDFIPDCVECPPHLHDFIVSSFGDH
FT                   YVEPVQQLLRYMVDPTLPNRKIVMVIGPSGSGKGVLERLIEKLFPPSCVSSITSSIKEI
FT                   NSPEKIRQYVSGKQLVAFPDVQGLQTGVTTIYSMVDGGLMAQRNLFTDDTEGVVFTGRV
FT                   VICSSQAPQFENAGSGMARRALILETQRPAEKPDADLDQKLAGELGSIVSWALQAKHAD
FT                   VKRVLVSGNQTFIDAQHNVEADMDVVRQFLDNCCEPCGGDYMPKLGVLYETFKQFCEDF
FT                   GYTKVLNRRTLLTRIKQALPNLHTQRRSVPGTNSTKKVNPQLFGFRIRPEVDCARWEKR
FT                   NYREGNWAALVSHKAEAPTPEQVFEHQRLPN"
FT   gene            complement(550043..551287)
FT                   /locus_tag="Syncc9605_0565"
FT   CDS_pept        complement(550043..551287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34339"
FT                   /db_xref="GOA:Q3AM43"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34339.1"
FT                   /translation="MPKERADAQPWEAALKRAIKTQHKWGYSVRPMRGKVQVERYWKDT
FT                   GKRQAATLPIEWRRGCEREVLNALHGINAAIAKGLSLKDAVRLTFDLTAGPKVQTNWRE
FT                   IYSRFYDFKVPAKVKETTWEKEYAPRLLWLIDVLTGADVPNNAELALAAMRAGRNGQGD
FT                   APGSRSRKLRIQYAVQMLRFAVSKCGASGRWLPPDEDTIRDLIGEPAPNSSKASQSGQA
FT                   LALSDEQFLRLFDSIANARWKLAVGLIGVFGLRGVELKYATAHRDHLHVNYGKRTAKGS
FT                   TEARDVPILDPAGRAGLGQQLLMTLSSGITELPPLGSTDKAASGAIDTFLRRNDVWMEY
FT                   KSDAKALGQRVSLYSLRHCFADRCAMATPPIPPKAAAVAMGHSLQVHLQTYQRQHSLKL
FT                   VKEAFETSNTSKVAI"
FT   gene            complement(551438..551511)
FT                   /gene="tRNA-Arg1"
FT                   /locus_tag="Syncc9605_R0023"
FT   tRNA            complement(551438..551511)
FT                   /gene="tRNA-Arg1"
FT                   /locus_tag="Syncc9605_R0023"
FT                   /product="tRNA-Arg"
FT   gene            551601..552320
FT                   /locus_tag="Syncc9605_0566"
FT   CDS_pept        551601..552320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34340.1"
FT                   /translation="MAPRRLSDSEKQDLVGRYKAGESTAALAEAFSCSPNTVSRTVKAL
FT                   LPADAYAALKASRQKGLVSPPPSTVTEAEQPEVDEVDSLKEDDSSLALDDADDFGEDSE
FT                   EELAEDDDNASVETFTELVPLLGVGDLNDRPLNQAQPFSVDLLPDSAYMLVDKVVELDA
FT                   RPLKEFPELGLLDDAEQERQGLCLFASPRAAKRQCGRSQRVIKVPDTAVFQRTSSYLLA
FT                   RGITRLVLDGTLIALDT"
FT   gene            complement(552354..552590)
FT                   /locus_tag="Syncc9605_0567"
FT   CDS_pept        complement(552354..552590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34341"
FT                   /db_xref="GOA:Q3AM41"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34341.1"
FT                   /translation="MLIRLRLLLISFGGSLLLLLLLCLGAQNLQDRHTLQLGGQRSVPL
FT                   PTGFLVGVALVIGVISGGTVTAVLLPDQRDRFD"
FT   sig_peptide     complement(552513..552590)
FT                   /locus_tag="Syncc9605_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.334 at
FT                   residue 26"
FT   gene            complement(552610..553467)
FT                   /locus_tag="Syncc9605_0568"
FT   CDS_pept        complement(552610..553467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0568"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34342"
FT                   /db_xref="GOA:Q3AM40"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34342.1"
FT                   /translation="MQRDEPSGGSLYLVGTPIGHLGDLSPRARDLLRSVDVIACEDTRH
FT                   SGQLLSSLGAGGHKLSFHQHNTRTRVPQMLNLLAEGQSLAVISDAGLPGISDPGEELVA
FT                   AAHQAGHPVICIPGPCAATTALVSSGLPSGRFCFEGFLPAKGKERRARLDAISHEPRTT
FT                   VLYEAPHRLITLLEELQHHCGGDRPLKVARELTKRHEEQVGPTVDRALLHFQQHPPQGE
FT                   CTVVIGGAPLEDAKEPDDDDLLRQLQALQDAGASASDAARQLAQSTGLSKRRLYALLHQ
FT                   GTSN"
FT   gene            553494..554411
FT                   /locus_tag="Syncc9605_0569"
FT   CDS_pept        553494..554411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0569"
FT                   /product="CysQ protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34343"
FT                   /db_xref="GOA:Q3AM39"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34343.1"
FT                   /translation="MMPSSAVLPAGVNKEALLTELRRLSWVAADILRAYARGEQPPHGF
FT                   PKALSVDEGGEGPVSAADLAVNKWLLDGLSAAFPKANWTLLSEETAKEQLTEGQPLSAE
FT                   WLWILDPLDGTKDFLQGTGEYAVHLALVRDKRPVIGVVLLPEADELWIGIVGEGAWCED
FT                   RQGERSPVRFSDRTEVSDLILVASRSHRDDRLVKLIDALDLGGSKAVGSVGFKVATILR
FT                   GETDLYVSLSGKSAPKDWDMAAPEAVLLAAGGRFTHADQADLTYNTGDVRQAGCLIASH
FT                   GKAHAELGERATRAMAEIDPGFQV"
FT   gene            complement(554419..556584)
FT                   /locus_tag="Syncc9605_0570"
FT   CDS_pept        complement(554419..556584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0570"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34344"
FT                   /db_xref="GOA:Q3AM38"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34344.1"
FT                   /translation="MQGQTQSISFDGREIRLTTGRFAPQAGGSVLVECGDTAVLVTATR
FT                   SGGREGIDFLPLICDYEERLYAAGRIPGSYMRRESRPPERATLTARLIDRPMRPLFPSW
FT                   LRDDLQVVATCLSLDERVPADVLAVTGASIATLLAGIPFNGPMAAVRVGLLGDDFVLNP
FT                   SYREIERGDLDLVVAGTPDGVVMVEAGANQLPEQDVIEAIDFGYEAICELIKAQEQLLK
FT                   DLGITQVKPEKPDEDSTVPAYLEKQCSKAISAVLSKFDQSKDERDTALETVKGEVSETI
FT                   AGLKEDHAVRQALASSPKLLGNSFKALTKKLMRQQILKDGKRVDGRGLDEVRQISAMAG
FT                   VLPRRVHGSGLFQRGLTQVLSTATLGTPSDAQEMDDLHPNTEKLYLHHYNFPPYSVGET
FT                   RPMRSPGRREIGHGALAERAILPVLPEKDTFPYVVRVVSEVLSSNGSTSMGSVCGSTLS
FT                   LMDAGVPLKAPVSGAAMGLIKEGDEVRILTDIQGIEDFLGDMDFKVAGSEKGITALQMD
FT                   MKITGLSVKTVAEAVNQARPARLHILEKMLEAIDTPRDNLSPHAPRLLSFRIDPELIGT
FT                   VIGPGGRTIKGITERTNTKIDIEDGGIVTIASHDGAAAEEAQKIIEGLTRKVNEGEVFS
FT                   GSITRIIPIGAFVEILPGKEGMIHISQLSEARVEKVEDVVKVGDEVTVRVREIDNRGRI
FT                   NLTLRGVPQAGDAADVEPQPTPVAPLS"
FT   gene            complement(556691..556993)
FT                   /locus_tag="Syncc9605_0571"
FT   CDS_pept        complement(556691..556993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0571"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34345"
FT                   /db_xref="GOA:Q3AM37"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34345.1"
FT                   /translation="MAKKSMIARDVKRKKTVERYAAKRAALMAAFNAAEDPMDRLEIHR
FT                   KIQALPRNSARIRVRNRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW"
FT   gene            complement(557051..558133)
FT                   /locus_tag="Syncc9605_0572"
FT   CDS_pept        complement(557051..558133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0572"
FT                   /product="Peptidase M50, putative membrane-associated zinc
FT                   metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34346"
FT                   /db_xref="GOA:Q3AM36"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34346.1"
FT                   /translation="MNVLAALLVLALLIVVHEAGHFLAATLQGIHVSGFSIGFGPALIK
FT                   KQRRGVTYALRLLPLGGFVAFPDDDEESTIPADDPDLLRNRPIPQQALVVAAGVLANLA
FT                   LALVVLFAQAAIVGVPAAPDPGVLVVQVQPGGAAARSGLRAGDQILSLNDQPLAAGQRG
FT                   VAAMVRDVKAAPEQPIRVERKRGDATSTVELIPEDQQGTGKIGAQLQANISGEMRPVHN
FT                   PGELVLTTGSQFSQMLEQTVRGYAGLLTNFRATAGQVSGPVKIVEMGAQLSQQGGSGLA
FT                   LFSALISINLAVLNSLPLPLLDGWQMMMLAIQSVRGRPVSERIQMAFVQSGFLLLVGLT
FT                   LVLIVRDTTQLPVVQQLMGR"
FT   gene            complement(558158..559435)
FT                   /locus_tag="Syncc9605_0573"
FT   CDS_pept        complement(558158..559435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0573"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34347"
FT                   /db_xref="GOA:Q3AM35"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34347.1"
FT                   /translation="MLDQRLVRDNPETIAQQLGRRGKAVDLTKLQLIAQQQRDLEQQRS
FT                   GLQAEGNRIGKEVGQRIKSGADPKGDEVAELRQQGNAIKQKVAVLEEEEKQLSSELKQQ
FT                   LLGFPNLPSEACPDGRSEDDNVEVRRWGTPRVDDGLYEHWQIAERLQLFDTERSVRIAQ
FT                   SRFVTLMGQGARLERALINFMLDLHTSKGYREVLPPVLVNSASLTGSGQLPKFAEESFR
FT                   CAEDDLWLTPTAEVPVTSLHRDEIIPADQLPLRYAAYSPCFRREAGSYGRDTRGLIRLH
FT                   QFNKVELYWFVHPDHSDEAHQRITADAEAVLQALELPYRVLDLCTADLGFSARRTYDLE
FT                   VWLPGAGAYREISSCSVCGDFQARRSSIRTKEGKATKLVHTLNGSGLAVGRTMAALLEN
FT                   GQQSDGSVLLPKALVPYVGRERLQPE"
FT   gene            complement(559478..559639)
FT                   /locus_tag="Syncc9605_0574"
FT   CDS_pept        complement(559478..559639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34348"
FT                   /db_xref="GOA:Q3AM34"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34348.1"
FT                   /translation="MESRNDIATQLCVACLGAGVITTMAVAQGQSPLTALGITLFSGIA
FT                   AVMVGQVL"
FT   sig_peptide     complement(559556..559639)
FT                   /locus_tag="Syncc9605_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.710 at
FT                   residue 28"
FT   gene            complement(559718..561208)
FT                   /locus_tag="Syncc9605_0575"
FT   CDS_pept        complement(559718..561208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0575"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34349"
FT                   /db_xref="GOA:Q3AM33"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34349.1"
FT                   /translation="MSSAAWGHQLDLLVRARTPLIWVRSNEEARVESLLGEAAQRLARQ
FT                   LVCWNFIDGISGPVNADGQGSRQPMAMLQWLQQRDAGSPTLLLAKDFHRFCDDPGVARM
FT                   LRNLEASLRSTPHTLVLCCGQWTPPGDLEESLTLLDLPLPDNNDLRRLISSIGTSSGSP
FT                   LPAPVLDELAQACSGLSEMRVRQVAARALARRGQLGSDDLQDVLDEKRQTIARSEVLEF
FT                   CRCDAGTEAIGGLDGLKTWLNQRHRAFSEDARRFGLPLPRGVLLVGPQGTGKSLTAKAI
FT                   ACSWSMPLLRLDVGRLFAGLVGASEARTREMIQRAEAMAPCVLWIDEIDKGFGGDGRSD
FT                   GGTTQRVLANVLTWMAEKQSPVFVVATANGVEKLPPELLRKGRFDEIFMLDLPSSSERH
FT                   SILELHLERRRPGLKLPLDTVVSRSEGFSGAELEQTVIEAMHLAFADNRELTEPDLIGA
FT                   ASQLIPLSRTASEQLERLKQWAAGGRARPASVAAGNEA"
FT   gene            complement(561205..561741)
FT                   /locus_tag="Syncc9605_0576"
FT   CDS_pept        complement(561205..561741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34350"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34350.1"
FT                   /translation="MIEALEPVPLQELRALGTAKVWDVEGELYELPSLTPVRGHVSAEH
FT                   RGNVLAVEGKLSTIVTLCCDRCLNQFNQSLSCTPAELIWLGEEQPTADELELSGEVAEM
FT                   EGLADVLDPRGQFDPQQWAFEQLNLLLPVVNHCGDHCPGPPGLQQQPVTSDAKPKDVDP
FT                   RWQALQQLQQQIDQP"
FT   gene            complement(561738..562868)
FT                   /locus_tag="Syncc9605_0577"
FT   CDS_pept        complement(561738..562868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0577"
FT                   /product="putative inner membrane protein; similar to 60
FT                   kDa inner membrane protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34351"
FT                   /db_xref="GOA:Q3AM31"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34351.1"
FT                   /translation="MIGYISDNLLIPILDFFYGLVPSYGLAIVALTLVIRIALYPLSAG
FT                   SIRSARRMRIAQPVIQKRQAEIRSRYANNPQKLQEELGNVMKEFGSPLAGCLPLLVQMP
FT                   ILFALFATLRGSPFADVPYTLNMKVLPADQIAAVEPKPFNSASHSIFIGETDHVPVIAS
FT                   LPRGTKIGVGDSATVNLHTKDGRVFSDVLTDVENPGRFAPTWAVTKGDDIVSVSEDGTI
FT                   TALATGDATVEAKIPGLAARSGFLFIKALGQVGFYADGAINWDIAILVAGFGITLFISQ
FT                   LLSGMGMPANPQQATANKITPVMITGMFLFFPLPAGVLLYMLIANIFQGLQTFILTKEA
FT                   LPDNLQKILDQQMAQKTVTVSATSGGSRLPFEPKGK"
FT   gene            complement(562925..563332)
FT                   /locus_tag="Syncc9605_0578"
FT   CDS_pept        complement(562925..563332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34352"
FT                   /db_xref="GOA:Q3AM30"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34352.1"
FT                   /translation="MTSIQEDVHYDGGPARGDLIFNILLGFTLVGLPFTIGAVVRALWL
FT                   RFRITSRRISVTGGWMGKDKTQVVYSQISEVRTVPRGFGAWGDMVLVLKDGARLELRSM
FT                   PRFREVEAYILERISTRAAKAQQKTTEGFAA"
FT   gene            complement(563329..563715)
FT                   /locus_tag="Syncc9605_0579"
FT   CDS_pept        complement(563329..563715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0579"
FT                   /product="ribonuclease P protein component of ribozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34353"
FT                   /db_xref="GOA:Q3AM29"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34353.1"
FT                   /translation="MVLPASMRLRGHRCFNRLHRSSKRQHGTLMVLRVAAGDSNLLRRE
FT                   LRGIQERTCRCALVISNKVSKRSVKRNRLRRLLHDHLRRRFEQRNDLAGRWLLISLRPE
FT                   AAEAEPTQLLEECDSLLRSAGLDP"
FT   gene            complement(563777..563914)
FT                   /locus_tag="Syncc9605_0580"
FT   CDS_pept        complement(563777..563914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0580"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34354"
FT                   /db_xref="GOA:Q3AM28"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3AM28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34354.1"
FT                   /translation="MTKRTLGGTNRKRKRVSGFRVRMRSHTGRRVIRTRRKRGRARLAA
FT                   "
FT   gene            complement(563961..564536)
FT                   /locus_tag="Syncc9605_0581"
FT   CDS_pept        complement(563961..564536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34355.1"
FT                   /translation="MARSTIRRLLAGAGTAAALLLGSAFSGAPEQIAHAQGTPGLMEFR
FT                   WDNDRDYRKLYYYQTSSIENDRSEWYLTLREKDRKTAILKLTVTVPDYFDSKLKPHRMR
FT                   ICRTSVGSMMSRTKCLEEIPSLIEVNKDQTEIVVFPDTPLPSDGDYSLHIKLFNPQGKR
FT                   MYQFNALVQAPGDVPMSGYRGSWLIDVD"
FT   sig_peptide     complement(564456..564536)
FT                   /locus_tag="Syncc9605_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.851 at
FT                   residue 27"
FT   gene            complement(564612..564995)
FT                   /locus_tag="Syncc9605_0582"
FT   CDS_pept        complement(564612..564995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0582"
FT                   /product="chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34356"
FT                   /db_xref="GOA:Q3AM26"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34356.1"
FT                   /translation="MTSSPLVLRGLRGATTCTENSTEAIEAAVSALMDALVDSNDLSSD
FT                   HLVSVTFSVTADLDACFPAAIARRRPGWDTVALLDCQQMAVQGDLPRCIRVLAHAWIPQ
FT                   EQQPVHPYQGDAQRLRPDRSGHN"
FT   gene            complement(564992..565813)
FT                   /locus_tag="Syncc9605_0583"
FT   CDS_pept        complement(564992..565813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0583"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34357"
FT                   /db_xref="GOA:Q3AM25"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34357.1"
FT                   /translation="MRNMIWPLRRKSRRRMARIVVDGPITGATRKRVLNALREVKQREF
FT                   PALLLRIDSPGGTVGDSQEIHAALLRLREQGCRVVASFGNISASGGVYIGVAAEKIVAN
FT                   PGTITGSIGVILRGNDLSRVFEKIGIRFDTVKSGPFKDILSPDRPLSDAERALLQELID
FT                   SSYGQFVGVVAQGRNLELETVKRFADGRVFSGEQAQALGLVDELGDEDHARRLAAQLAD
FT                   LDTDDIRPVTLGKQRRKLSGLLPGSQLLHQLQQRLSIELMGSGQVLWLYRP"
FT   gene            565858..566799
FT                   /locus_tag="Syncc9605_0584"
FT   CDS_pept        565858..566799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0584"
FT                   /product="putative SMR family transporter, possible PecM"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34358"
FT                   /db_xref="GOA:Q3AM24"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34358.1"
FT                   /translation="MPSLRLWFLMVLPFALWGTAMTAMAPLLASAGPWLVAGLRLVPAG
FT                   LALLLWGQCTGRGLAIDSRDRLWFLLFTVVDATLFQGLLALGLEGTGAGLGSVLIDCQP
FT                   LLVALMARALFMESINPIGWMGLAIGLAGIVCIGLPAELLGHWWLLADPPVVQQLFQPG
FT                   EGWMLLAAVAMAAGTVLIRFASRHSDPVSVTAWHMVLGGLPLLGVHALQRTDAGLGWTA
FT                   TDWARMGYASLLGSALAYGLFFWFANQRDLTSFSSLGFLTPVFALATGGWLLGERLDLL
FT                   QWIGVVMVLVSVIFVSQRRRFWEPLSLADPSS"
FT   sig_peptide     565858..565953
FT                   /locus_tag="Syncc9605_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.561 at
FT                   residue 32"
FT   gene            566796..567905
FT                   /locus_tag="Syncc9605_0585"
FT   CDS_pept        566796..567905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0585"
FT                   /product="putative UDP-glucose:tetrahydrobiopterin
FT                   glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34359"
FT                   /db_xref="GOA:Q3AM23"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34359.1"
FT                   /translation="MTLSPLHLVIVNTPIGALGSGEGGGVELTLRSLVQGLVRRGHRLT
FT                   VVAAKGSTLPADCSGVELLEVEGVNQPSWQHADEHAPVEIPRNGLLPALWEAALDVGQS
FT                   ADAVINGGYDWLPLWLTQQVSARLFHLVSMGDVAAVMRDVIEAVAAWDSRRLAFHTHRQ
FT                   AADFQLPSPANVVGNGFDLSIYTFQRPTDGPLGWAGRIAPEKGLEDAAAAAAALGEQLL
FT                   VWGLREDDAYARQVESSVPKGTIDWRGFLSTQELQQEMGHCRALINTPKWNEAYGNVVV
FT                   EALACGVPVVAYDRGGPGELICSGRTGWLVPPDDVAALTEALRRVDSIERSYCRSWAEE
FT                   YASCEVFSQRVESWVRTGLMADVSINPRS"
FT   gene            567880..569721
FT                   /locus_tag="Syncc9605_0586"
FT   CDS_pept        567880..569721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34360"
FT                   /db_xref="GOA:Q3AM22"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34360.1"
FT                   /translation="MSASTPGAEGPLSVNVSGRQRRQVLALVLTLGLVITCWRLGSTGV
FT                   VDETPPLFAAAGRAMADTGDWLTPRVNGLPRYDKPPLVYWLMGFGYALPGREVWDPLGS
FT                   WAARFPSALATVGLMLGLADTVLRWPFSGDARPRLTALIAPLAFAFSPLVLVWSRTAVS
FT                   DALLCGLLGLSLLLQWRRFAAPQEVAWWPAWVILGFAVLAKGPVAVVLSGLALLMFGAL
FT                   RRDLVQPWLRLRPLPGLLLTALISLPWYALELLVEGQPFWDSFFGYHNLQRFTSVVNDH
FT                   LQPWWFFGPVMLLAALPFTPYLLLGLARVPQSRIAPEHSLHQFAACWLLAVLLLFTTAA
FT                   TKLPSYWLPATPAAALLVAQATVSSTVGSSRWQRMAWGACLMLIAVLAAGFWLGSLWVP
FT                   LIDDPEMPTLSVDLLASGLLKWAAVWFSAAAALGAVLLLQRRAAAQALLALQGCLLGFH
FT                   LTALIPIAELADRLRQQPVRDASSLMLLQQRSGEPMVMVGAMKPSLHFYTGQVILYEGQ
FT                   SDGALVNIADRLAHEQRRGWSGYPLGSPGASSTVLVLIDRGTAARDHWSDLQPLLLGQI
FT                   GIYDVWRLDRSRLEQRAQNLKADGVDADWREPRPERY"
FT   gene            complement(569725..570246)
FT                   /locus_tag="Syncc9605_0587"
FT   CDS_pept        complement(569725..570246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34361"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34361.1"
FT                   /translation="MGVAPESQRRRLPGLELLQSAAPAPAEPLQTCLNALQKEWRKDDH
FT                   LAALWQDWPRVAGAQLAPHCRPLSLQRGVLTVGASHPQWRQALLYNKPQLISALHQAGH
FT                   AVRDLRIQQHHPLQSAVLESEASIWAQHPSRTDVHGMGTCPDCSRPAPNGEIKLWGQCG
FT                   FCHRQTLSRS"
FT   gene            570311..571084
FT                   /locus_tag="Syncc9605_0588"
FT   CDS_pept        570311..571084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0588"
FT                   /product="membrane-associated 30 kD protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34362"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34362.1"
FT                   /translation="MGFFDRLSRLVRANANAAVSSMEDPAKILDQSVADMQADLVKLRQ
FT                   AVALAIASQKRLTSQAEQAAAQSKTWYERAELALKKGEESLAREALTRRKTFQETATSL
FT                   TAQVQAQDGQVESLKKSLVALEGKIAEAKTKKDMLKARAQAAKAQQQLQSTVGSIGTDS
FT                   AMAAFERMEEKVEALEATGQAAAELAGSDLESQFAALESGGGVDDDLEALRAQLKGGPE
FT                   AVALPASEASEAVKPVQVEEVDAELEDLKRSIDKL"
FT   gene            571132..571467
FT                   /locus_tag="Syncc9605_0589"
FT   CDS_pept        571132..571467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0589"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34363"
FT                   /db_xref="GOA:Q3AM19"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34363.1"
FT                   /translation="MSALAGAVADFTDAGFKREVLKASGTVLVDFWAAWCGPCRLIAPL
FT                   MDWVASDYGDRVSVGKLEVDANPQTRDAYEVQGIPTLILFRNGEVVARHEGAIAKPQLQ
FT                   SFLDANL"
FT   gene            571454..572644
FT                   /locus_tag="Syncc9605_0590"
FT   CDS_pept        571454..572644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0590"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34364"
FT                   /db_xref="GOA:Q3AM18"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34364.1"
FT                   /translation="MPTSKRLASLGNAVFARVDAAKQAYRLEASSLERPGLVDLSIGSS
FT                   DLRPPTTLLDTMASAVMAFDSSSYCLQAGLRPFHAAVADWCRHRFDVAVDPDHEVQLLV
FT                   GSQEGTAHLPLALLDSGDAALHLDPCYPSHTGGLHLAGARTKALALSPDNDWRPDLSTI
FT                   SPQLWDQLKLFVLGYPHNPSARVGDQEDLNRITAIAARHDVVIAHDNPYVDLALDGEPP
FT                   ALLKAPSWRECGIEFFSLSKGWCLGGFRLGFAVGAAPLIAALRRAKAVIDFNQSLALQQ
FT                   GAIQALQSFPDWPRQLHPTYRERRDRVVETLRARGWSVPCPEMAMYLWFPLPDAAHRRG
FT                   WSDEDAARELLQRSGVALTPGSGFGDGGRQWLRMALVRPVNELVEVAERLADAMDD"
FT   sig_peptide     571454..571519
FT                   /locus_tag="Syncc9605_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.603) with cleavage site probability 0.359 at
FT                   residue 22"
FT   gene            572628..573419
FT                   /locus_tag="Syncc9605_0591"
FT   CDS_pept        572628..573419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0591"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34365"
FT                   /db_xref="GOA:Q3AM17"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34365.1"
FT                   /translation="MQWMTDPRLPQYRGPHRGGGRLVAMYRRLAGASARCWAIRHVPVC
FT                   SSTEELLGTWLRDQPSLMGPRAVIATHQRRGVGQSGRAWVSPPGGVWISAALPWRGHGS
FT                   GQAGLLGLALALSVLQRLEQRGLSVQIKWPNDLFVNGRKLAGLLPGVVQRGSQLRLLRI
FT                   GLGLNVRNAVPGHAIALRRLEGQLAADPIRWTAEVLLAFDHCHGIGGDGAWCLDGVQAR
FT                   LWSDQLVHPQDGQIWRIAGLERDGGLRLRQGSRTETWRRWP"
FT   gene            573493..574341
FT                   /locus_tag="Syncc9605_0592"
FT   CDS_pept        573493..574341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0592"
FT                   /product="peptidase family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34366"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34366.1"
FT                   /translation="MLVPAAAAQGFDQSLDGLVRQRVITSQERKLLRGGGVAVPMERSR
FT                   FEEACRTGALSRQDCASRVARRSPGAPASARVRLIPSRQPLRVPVSALLARDGGTFRLE
FT                   SVFAVTPRPLPAPGNGDRQLLFPVVGDAFKSSGFGWRLHPILGSWLMHAGRDFAAPEGT
FT                   PVVAALSGQVLSSGLAGGYGVAIELEHTQPLRRTLYGHLSEIYVRPGQPVRQGEVIGRV
FT                   GSTGLSTGPHLHFELRTPLRAGWQAVDPGDLDLSAVMRANNDPVSLLLGQVLRSLERDQ
FT                   P"
FT   gene            complement(574372..574965)
FT                   /locus_tag="Syncc9605_0593"
FT   CDS_pept        complement(574372..574965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0593"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34367"
FT                   /db_xref="GOA:Q3AM15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34367.1"
FT                   /translation="MELQRSSTPPHQFARQGEPQTRALHPFAIPFGLAPDKRRRPAFQI
FT                   LRSHRSVKALEAGVDDYLIKPFSIDELMARLRAMHRRAETFSGLVGGPDVNEILKVADL
FT                   SMNTRTRDVMRGDRAIRLSVKEYDLLNFLMRGAGRVLERQEIMHGVWGENFCGDDNLLD
FT                   VYISYLRQKVELDDAPTLIHTVRGVGFILREQTN"
FT   gene            complement(575018..575404)
FT                   /locus_tag="Syncc9605_0594"
FT   CDS_pept        complement(575018..575404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0594"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34368"
FT                   /db_xref="GOA:Q3AM14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34368.1"
FT                   /translation="MEETPKALRVAVVEDDPRIQQLISAEITDEGHTCIRFGSAEDFLD
FT                   EAGSDRFDLLLLDLMLPGMDGLACLKQLQLQAASQPALRVVIVTALNDADKKHEALANG
FT                   AEAYVLKPDLFEQLPQLLQTRSMF"
FT   gene            complement(575424..576110)
FT                   /locus_tag="Syncc9605_0595"
FT   CDS_pept        complement(575424..576110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0595"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34369"
FT                   /db_xref="GOA:Q3AM13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34369.1"
FT                   /translation="MQQPVAELKGISKIYGSGDLEVKALDQLNLTVQEGDYLAVMGASG
FT                   SGKSTAMNILGCLDRPTSGTYRLNGMAVEQLDDDALADVRNRSLGFVFQQFHLLGHASA
FT                   MENVMLPMIYAGVPREERIERAQSALRRVGLAQRLENKPNQLSGGQQQRVAIARAIINR
FT                   PSLLLADEPTGALDSNTTAEVLELFDELHQQGITLVMVTHEDDVAARAQRIARFQDGRA
FT                   LTGCPQ"
FT   gene            complement(576115..577746)
FT                   /locus_tag="Syncc9605_0596"
FT   CDS_pept        complement(576115..577746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0596"
FT                   /product="Proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34370"
FT                   /db_xref="GOA:Q3AM12"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34370.1"
FT                   /translation="MTVGASSAATVTPAQRFQAAMPDMGAFLLATQATAAPGELLNLSL
FT                   NASAVLPEGAVLLAMIATLLVDLAGEKVATRWVPPICYAGLGTSLVLLALQWNAPLEPS
FT                   FLGAFLADNLAVAFRAVIALSTLLSLLISWRYAVKSGTPVGEYAAILLAATLGAMLLCG
FT                   ATDLVSVFISLETLSVASYLLSGYMKRDARSSEAALKYLLVGSAAAAVFLYGSSLLYGL
FT                   SGSTSLDTIGLALQTSTTPLAALALVFVLATVAFKIAAVPFHQWTPDVYEGSPTPVVAF
FT                   LSVGSKAAGFALALRILVGCFGAFDDQWKLLFTVLAVLSMTLGNVVALAQTSMKRMLAY
FT                   SSIGQAGFVMIGMVCGTEDGFAAMVLYMAAYLFMNLGAFACIILFSIRTGSDRISDYAG
FT                   LYQKDPLITLGLSLCLLSLGGIPPMLGFFGKIYLFFAGWANHEYLLVVVGLVTSVVSIY
FT                   YYISVIKMMVVKEPQEASDVVKAYPDVNWSLMGMQPLRVALIGCVAITAVGGILSNPLF
FT                   QWANTAVAGTPLLQQAIALSSLKGLG"
FT   gene            577798..580497
FT                   /locus_tag="Syncc9605_0597"
FT   CDS_pept        577798..580497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0597"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34371"
FT                   /db_xref="GOA:Q3AM11"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34371.1"
FT                   /translation="MAHTLVIVESPTKAKTIRGFLPKGFKVEASMGHVRDLPNNASEIP
FT                   ASAKGQKWANLGVNIEADFEPLYVVPKDKKKTVRELKDALKGADQLLLATDEDREGESI
FT                   SWHLLQLLAPKVPVKRMVFHEITKEAIGKALDQTRDLDMELVHAQETRRVLDRLVGYTL
FT                   SPLLWKKVAWGLSAGRVQSVAVRLLVQRERARRAFRSGSYWDLKAQLEQSGSAFEAKLT
FT                   HVGGQRIATGNDFDESTGGLKAGSAVRLLSESEAKALAESVRSSAWTVDAVEEKPTVRK
FT                   PVPPFTTSTLQQEANRKLRLSARETMRCAQGLYERGFITYMRTDSVHLSDQAINASRNC
FT                   VETLYGKEYLSKGPRQFSTKARNAQEAHEAIRPSGESFRTPGETGLDGRDLAVYELIWK
FT                   RTVASQMAEARLTMLSVDLSSGEASFRASGKRIDFPGFFRAYVEGSDDPDAALEGQEVL
FT                   LPALSVGDAPEPKTVEPLGHQTQPPARFSEASLVKMLEKEGIGRPSTYASIIGTIVDRG
FT                   YATLLGNALTPSFTAFAVTALLEEHFPELVDTSFTARMENTLDEISHGKVQWLPYLEGF
FT                   YKGDEGLENQVQQREGDIDPGASRTIDLEGLSSVVRIGRFGAYLEAKRVSDDGEEELIK
FT                   ATLPREITPADLDEEQAELILKQKADGPEAIGEDPETGDLVYLLSGQYGPYVQRGQVSD
FT                   ENPKPKRASLPKGQKPEDLTLEDALGLLRLPRLLGEHPEGGRIQAGLGRFGPYVVWDKG
FT                   KGDKDYRSLKGDDDVLAVGLSRAIELLAMPKRGRGGRTALKDLGKPEGSDETIQVYDGP
FT                   YGLYVKQGKVNASLPEGKGADDVTLEEAVELLVAKAASKKGGRKTAAKKPAAKKPAAKK
FT                   PAAKKPPATTKTGRLRASAVRVIKPADN"
FT   gene            580497..580925
FT                   /locus_tag="Syncc9605_0598"
FT   CDS_pept        580497..580925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34372"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34372.1"
FT                   /translation="MVRLLWLLPVGLLQACAGTPVAEQLERSFAVPEARPAQAAEPMPA
FT                   VKTSPRVVSPSVASPIAERPSTPEAEPVSLPEATDAPEPDPQPKPQTVSSQRQPQEPYR
FT                   ITIRLAGADPAAPAEAVTRALREADVGFAVERIERVEP"
FT   sig_peptide     580497..580565
FT                   /locus_tag="Syncc9605_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.582 at
FT                   residue 23"
FT   gene            580922..581575
FT                   /locus_tag="Syncc9605_0599"
FT   CDS_pept        580922..581575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34373"
FT                   /db_xref="GOA:Q3AM09"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34373.1"
FT                   /translation="MTDANPRLSRQQALRLIEGAYLAAATGLIWLALYYLPVGGALFRL
FT                   ALPLPLILLQLRRGSRSGVEGLLLSVLLLTALMGPLRGPLLLFPYGLLSLWLGWSWCRG
FT                   ISWWLSWSGGVVLGTAGFLVRVLVLSLLVGENLWVVITRAGSALLDRLIAALHLPITPD
FT                   LTQVQLMALLLVVVQEVIYVLSLHALAYWIFPRLKSPIPEPPRLLHGLVALDPL"
FT   gene            581547..582746
FT                   /locus_tag="Syncc9605_0600"
FT   CDS_pept        581547..582746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0600"
FT                   /product="Protein of unknown function DUF102"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34374"
FT                   /db_xref="GOA:Q3AM08"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34374.1"
FT                   /translation="MDSLPSIPSEASMFPEGCQQLGRLGASVLDAAALRPWTSSAQPLD
FT                   LLLVLAATRTAEHEGISAAGSTVASRRYTALADAELLIQGPARKRRWPLPPLPAGVSPA
FT                   LLSHVAARRLNLTPQVAALGLVQKPDFPHLDIEPLDQGPSACLSSGAAMPLPRVQQLWR
FT                   QGERLGRRLKRPLVVAECVPGGTTTAQAVLTALGVEVGHLISGSALHPPQQLKQELVIE
FT                   GLQRASLGAHPSAEQILAALGDPFQAFTAGVLVGSVSTGQPLLLGGGCQMLAVLALAMQ
FT                   ALPAAQRDHLAAQVLIGTTGWLADEGADAAGQSPFGGLVDATASHLAAALSVLACGVRF
FT                   HGSTHQPLRDYERGYVKEGVGAGALLLLAQLRGCSCAELVLDCEHALEQLLSRPVTSSP
FT                   "
FT   gene            582743..583756
FT                   /locus_tag="Syncc9605_0601"
FT   CDS_pept        582743..583756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0601"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34375"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34375.1"
FT                   /translation="MNLWSERLGPLSRRHVLQMIGATGTALLAGCRPTTSAPTLMAPAG
FT                   VLPKPWADALPKPWRLTLAPAQQDWTPADQARADVLVIGDGWLDSHPADTLQPIASEPL
FT                   VSQLDGQAKALLASLGALQDRVLPLAVSPWVMLLRDDPAMTQQGWPLLLDSSLAGRVVL
FT                   PASPRLVMSLADHLGGGQALPALRRQALTYDDRQVTNWLLKGEAKVVVLPLSRCIALLG
FT                   RDPRLRAILPASGAPLHWTVLLRPEASREPVPQSWVEQGWRDPLRRRLVQQGWRAPIAS
FT                   SGAIVDQNALSARLRPLLFPSADTWLRCWSLPPLLPEDRSGLEERWRDSAPEPPSR"
FT   gene            complement(583730..584851)
FT                   /locus_tag="Syncc9605_0602"
FT   CDS_pept        complement(583730..584851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0602"
FT                   /product="putative oxidoreductase, aldo/keto reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34376"
FT                   /db_xref="GOA:Q3AM06"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34376.1"
FT                   /translation="MNTRSFGSGRPVSLFTLGTMRALNSAAQMAEVLDAAAEAGINHLE
FT                   TAPAYGPAERFLGEALRQNSSTGSDNWVITSKLLPVLSFEEGQRRLDQILERLGCPQLD
FT                   NLAIHGINREEHLDWALGGDGSKLLDWALSSGRVSQVGFSSHGSNPLIDRALRSQRFSF
FT                   CSLHLHWLDPQRLPLARWALEHGLGVMAISPADKGGRLQAPSPTLMDDCTPFVPLELAY
FT                   RFLLAQGISTLTVGAAVAGDLQLAATLAQADGPLSQAEQQALITAERRQQERLGQEHCK
FT                   QCQACIPCPNEVPIPELLRLRNLAIGHGLNEFAQERYNLIGRAGHWWEEHDASDCERCG
FT                   ACLPRCPHHLPIPDLLADTHQRLKASPRRRLWS"
FT   sig_peptide     complement(584759..584851)
FT                   /locus_tag="Syncc9605_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.384 at
FT                   residue 31"
FT   gene            complement(584848..585396)
FT                   /locus_tag="Syncc9605_0603"
FT   CDS_pept        complement(584848..585396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34377"
FT                   /db_xref="GOA:Q3AM05"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34377.1"
FT                   /translation="MVEMSVAGIALDAASRTPMVLLRDPSGRRQVPIWIDQAQAHNIMA
FT                   GLQGGAPPRPLSHDLMAALLVAGGLELERVIVHAIEDSTFHAVLKLRPDLDEAELAENE
FT                   VLELIEVDARPSDAIALAIRTGSGIWMLEEVVAEASIPVDAEADAEDQSAFSRFVDDLS
FT                   PAALVRHLRNEDSEAPSEE"
FT   gene            585446..586114
FT                   /locus_tag="Syncc9605_0604"
FT   CDS_pept        585446..586114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0604"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34378"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34378.1"
FT                   /translation="MFTGLVQSVGRIERRAGAVVVWGCAPFAPLALGDSVAVDGVCLTA
FT                   AELMADGFRADVSEETLRRTTLGRKADRGGAVNLEPALRLSDRLGGHLVSGHVDATGEV
FT                   THLESLPHSWAVSIRWSDPRFGRYVCEKASIAVDGISLTVAECSADGTTFSLAVIPHTW
FT                   EETTLKQLAVGDTVNLEADQLARYAERLLHATAADAGNADGQYKNETLSASWLAAHGWS
FT                   "
FT   gene            complement(586099..586470)
FT                   /locus_tag="Syncc9605_0605"
FT   CDS_pept        complement(586099..586470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0605"
FT                   /product="Transcriptional regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34379"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34379.1"
FT                   /translation="MLVGKELLDKARSLSNRPEDDIARGCGYVGPSGRLLKKSFYRALV
FT                   EAKAAAQGWQLPKSSSSSSGGSRGRQAEFRTRVHGNGNLLIGHAYTRRLGLEPGQEFKI
FT                   ELQRDSGMIVLQQMDQDQP"
FT   gene            complement(586525..587130)
FT                   /locus_tag="Syncc9605_0606"
FT   CDS_pept        complement(586525..587130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0606"
FT                   /product="possible cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34380"
FT                   /db_xref="GOA:Q3AM02"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34380.1"
FT                   /translation="MTTTVPTKDQDQNHSHGEHAEHPDHRMFGLATFLVADAMTFAGFF
FT                   AAYLTFKAVNPLPDGAIYELELPLPILNTILLLVSSATFHRAGQAIRQNDHGRCRRWLL
FT                   ITAGLGLAFLVSQMVEYFTLPFGLTDNLYASTFFAATGFHGLHVTLGALMTLIVWWQAR
FT                   QPQGRVTAADHFPLEAAELYWHFVDGIWVILFVILYLL"
FT   gene            complement(587127..588794)
FT                   /locus_tag="Syncc9605_0607"
FT   CDS_pept        complement(587127..588794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0607"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34381"
FT                   /db_xref="GOA:Q3AM01"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34381.1"
FT                   /translation="MTISLPPETSSPPRLQPSSWLRYFSFSVDHKVIGLQYLVCGFVFY
FT                   LIGGALAGAIRTELTSPVSDFMARDVYNQVLTLHGTVMIFLWIVPVVNGAFGNYLIPFY
FT                   VGARDMAFPRLNAVAFWLIPPAGLMLITSYFLTGAAQSGWTAYPPLSITTPATGQIIWI
FT                   LSVLLLGGSSIFGGINFIATILKLRRPGLKLMQLPMYCWAMLGTSILVVLSTPVLAGTL
FT                   VLLSFDIVAHTGFFNPTLGGNVVVYQHLFWFYSHPAVYIMVLPAFGLVSEILPVHARKP
FT                   LFGYVTMVYSIMAIVVLGLIVWAHHMFTSGTPPWMRLFFTIATAFIAVPTGIKFFNWLA
FT                   TLWGGRISLNSAMLFSCGFIVNFVLGGITGVALAQVPFDIHVHDTYFVVAHFHYIVFGG
FT                   SVFVIFASIYHWYPKFTGRMLNEDLGRLHCALTFIGFNMCFGPQHWLGLNGMPRRVAEY
FT                   DPQFTLINQISSVGALLMAISTLPFLWNVIHSALSGPVAGDNPWKALTPEWLTSSPPPV
FT                   ENWIGEAPLVEEPYGYGVPPDELDLTAASGRDLWSSGK"
FT   gene            complement(588796..589626)
FT                   /locus_tag="Syncc9605_0608"
FT   CDS_pept        complement(588796..589626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0608"
FT                   /product="possible cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34382"
FT                   /db_xref="GOA:Q3AM00"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3AM00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34382.1"
FT                   /translation="MQIPSAILTLVIGMVLALGGLWIGQNINLLPIDASANAPIYDELF
FT                   KVLFTIGSILFIGIVGLLVFSLIRFRRRNGQLGDGVAIEGNLPLEIFWTAVPAVVVLFV
FT                   GLYSYDIYDRMGGMVPLAHDHMGEAHEEQIWGGISSGSIESAAATNVLPVEVTAMQFAF
FT                   LFHYPEGDITSGELHVPADRPITLRMEAKDVIHAFWVPEFRLKQDVIPGQPTQLSFTPT
FT                   RTGRYPIVCAELCGPYHGGMRSTVVVESPEDWDSWYRDNAKATPEDETLTIANA"
FT   sig_peptide     complement(589567..589626)
FT                   /locus_tag="Syncc9605_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.607) with cleavage site probability 0.452 at
FT                   residue 20"
FT   gene            589828..590754
FT                   /locus_tag="Syncc9605_0609"
FT   CDS_pept        589828..590754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0609"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34383"
FT                   /db_xref="GOA:Q3ALZ9"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34383.1"
FT                   /translation="MMLSSMSTLRRRLGLLSAHLVVAVIALVVIGGATRVMEAGLACPD
FT                   WPLCFGSLLPGRQMNVQVFLEWFHRLDAFVIGIALVVMAVATTLQRRQLPRWLPWLAVG
FT                   LMALVAMQGGLGALTVTRLLPSGVVTAHLALALTLVALLSGLTQRLLHPNAVVAPLWWR
FT                   IGASLGLMSVFVQCLLGGRMATAWAGQRCLAGGEACQLVLSHRLTAMPVVVVVLGFAGA
FT                   AVLAGGWARQQWPWLGGAVLLVLIQVALGVFTLRLGLSQPVVTVAHQLVAALLIALLSA
FT                   LLVRSPDRPSPSRSVVLDDTSLEACHG"
FT   sig_peptide     589828..589944
FT                   /locus_tag="Syncc9605_0609"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.885) with cleavage site probability 0.606 at
FT                   residue 39"
FT   gene            590747..591730
FT                   /locus_tag="Syncc9605_0610"
FT   CDS_pept        590747..591730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0610"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34384"
FT                   /db_xref="GOA:Q3ALZ8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34384.1"
FT                   /translation="MAEITATVRPTREEVVPSRKRVKLPAWLEVAKPRLIPLLLATTLG
FT                   GMALSEGWPLSSPRLVCTLGGGALASAAAGVLNCLWEQDLDGRMARTSGRALPSGRLSP
FT                   TSAFIGAIACTLAAAMLLVSGVNCLAAGLSLLGLCSYVLLYTALLKPRTSQNIVIGGVA
FT                   GAIPPLVGAAAATGHVGLGGWWLFALVMVWTPAHFWALALLLREDYRAVGIPMLPVVKG
FT                   PVVTARAIKTYGWITVLLSSLGVFALPSGGAFYGVMLLPYNARLLQLVDRLSLDPDSLV
FT                   NAKALFRWSILYLFGVCLLLILSRTDLASGFTHQVIQLLSLPTGVH"
FT   gene            591781..592794
FT                   /locus_tag="Syncc9605_0611"
FT   CDS_pept        591781..592794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0611"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34385"
FT                   /db_xref="GOA:Q3ALZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34385.1"
FT                   /translation="MALIQLRKISKAYGAVPALRELDLTVPEGCLYGLLGPNGAGKTTA
FT                   MRILATLLAPDSGSVVVGGVDGLAQPRDVRQLMGYVAQEVAIDKILSGRELLQLQGDLY
FT                   HLPRNDRDSRIADLIDRLAMGDWIDRRCGTYSGGMRRRLDLAAGLLHRPRLLVLDEPTV
FT                   GLDIESRSAIWQLLRQLVEEGTTVLLSSHYLEEVEALADQMAIIDAGRVIAEGSPDQLK
FT                   QRLGGDRVTLRIREFSSADEATQVRALLEPLDGVRQVVVNRSQGFSLNLVIEGGAVIDQ
FT                   LRQTLEAAGLPVFALAQSRPSLDDVYLQATGRTLMDAELAIAGQRDVKQEKRQSMR"
FT   gene            592804..593658
FT                   /locus_tag="Syncc9605_0612"
FT   CDS_pept        592804..593658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0612"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34386"
FT                   /db_xref="GOA:Q3ALZ6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34386.1"
FT                   /translation="MTSPTASVALQQQQSGAFAELSQETLALTRRLFLQLMRRPSTLIA
FT                   GVLQPLIWLILFGALFANAPEGLLPGGMSYGRFLGAGVIVFTAFSGALNAGLPVMFDRE
FT                   FGFLNRLLVAPLRSRSSIVLASVIYITALSLLQSLAIMATAALLGYGWPGISGLALVLV
FT                   TLLLLVFAVTALSLGLAFALPGHIELIAVIFVANLPLLFASTALAPLSFMPTWLGWLAA
FT                   LNPLTFAIEPIRAAYQGPLDLSAVLLEAPYGDVTGTSCLLILLLLTIALFLAIRPLLNR
FT                   KLS"
FT   gene            593663..594211
FT                   /locus_tag="Syncc9605_0613"
FT   CDS_pept        593663..594211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34387.1"
FT                   /translation="MLSSPFQQPSPRQNALALQIQEARTSGDEALLVGLISQWVHRYGF
FT                   EGAAELDLSLPEPSASKHGFSSAPMSVIEEEIAPEDDVLVENEVVVQDEVAAEDEMVVE
FT                   EEVQIVAEDDLLTESEVMENGLVAEEETIVEQDEIAAEETPLQRSFPAVPVPAPPISTP
FT                   RSLRRWLPRREDDAFPKAS"
FT   gene            594217..594906
FT                   /locus_tag="Syncc9605_0614"
FT   CDS_pept        594217..594906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0614"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34388"
FT                   /db_xref="GOA:Q3ALZ4"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34388.1"
FT                   /translation="MIPNPESLDQGLIVSVQAPQGSPMRDPDVIAAMADASLRNGAVGV
FT                   RLESPEHIGAVRRRCQDALIIGLWKCTFPESSVYITPGWKEIQAVWSAGADVIAIDATA
FT                   RPRPEGQDLAALIQRSRDELRAPLMADVDSLANGVRAAELGCDWVGTTLYGYTEDTAQQ
FT                   HPPAFDLLPQLRAELPSSVRLICEGGIASPADARLALQAGADTVVVGTAITGVDLQVTA
FT                   YRQGMVS"
FT   gene            complement(594907..596586)
FT                   /locus_tag="Syncc9605_0615"
FT   CDS_pept        complement(594907..596586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0615"
FT                   /product="Chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34389"
FT                   /db_xref="GOA:Q3ALZ3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34389.1"
FT                   /translation="MAKLLSFSDESRSALERGVDALADAVRVTIGPRGRNVVLEKKFGA
FT                   PDIVNDGDSIAREIELDDPFENLGAKLMQQVASKTKDKAGDGTTTATVLAQAMVREGLR
FT                   NTAAGASPVELRRGMEKAAAHIVAGLSERSQAIAGDAIRQVATVSSGGDEEVGRMIAEA
FT                   MDKVSTDGVITVEESKSLATELEITEGMAFDRGYSSPYFVTDADRQVCEFDNPLILLTD
FT                   RKISTITDLVPVLETVQKSGSPLLILSEEVEGEALATLVMNKSRGVLQVAAVRAPSFGE
FT                   RRKAALADIAILTGGTLISEDKAMTLDKVTLEDLGKARRVTISKENTTIVANDDHRQAV
FT                   SERVSAIRRELEATESDYDREKLQERIAKLAGGVAVIKVGAPTETELKNRKLRIEDALN
FT                   ATRAAVEEGIVAGGGSTLLQLADSLDALASSLNGDQRTGVEIVQRALTAPIHQIATNAG
FT                   QNGDVVIAGMRSSGQGFNALSGVYEDLMAAGIVDAAKVVRLAVQDSISIASLLITTEVV
FT                   IADKPEPPAPAPAGDGDPMGGMGGMGGMGMPGMGGMGMPGMM"
FT   gene            596718..596894
FT                   /locus_tag="Syncc9605_0616"
FT   CDS_pept        596718..596894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34390"
FT                   /db_xref="GOA:Q3ALZ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34390.1"
FT                   /translation="MGESGALFFVLMAGLAGSMALVYVPLRIFLTATARSRRLRLLQRI
FT                   RRLRDELAQPLDS"
FT   sig_peptide     596718..596786
FT                   /locus_tag="Syncc9605_0616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.900) with cleavage site probability 0.517 at
FT                   residue 23"
FT   gene            complement(596904..597698)
FT                   /locus_tag="Syncc9605_0617"
FT   CDS_pept        complement(596904..597698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0617"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34391"
FT                   /db_xref="GOA:Q3ALZ1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34391.1"
FT                   /translation="MSMAPYDPAINGALMSPSASLAGQTALVTGGGRGIGRAIALALGE
FT                   AGAEVVVNYSSSAAAADEVVAAITTAGGKAYALQASVSVETEVDGLIKTVLERSGRLDV
FT                   LVNNAGITRDGLLMRMKTDDWQSVIDLNLSGVFLCTRAVSRPMLKQKSGRIINITSVVG
FT                   LMGNAGQANYAAAKAGVIGLTRSTAKELASRGITVNAVAPGFIATDMTKDLDAEAILKD
FT                   IPLGTFGTQEQVAGAVRFLAADPAAAYITGQVLQVDGGMVMA"
FT   gene            complement(597704..598759)
FT                   /locus_tag="Syncc9605_0618"
FT   CDS_pept        complement(597704..598759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0618"
FT                   /product="putative potassium channel, VIC family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34392"
FT                   /db_xref="GOA:Q3ALZ0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34392.1"
FT                   /translation="MRRRRARGQLKLITAPWRGPISALSAVIFAGALGYRITEGWDWGD
FT                   CLWMVLITISTIGFGEVAPLSPPGRLVTVLIVVGGLVVVQLAIQRVLGLKESGYFRRLR
FT                   EFRFLRMLEGLHDHVILCGYGRIGQEIAAQLQRDAVPLVVIETDPERKAVADENGFWVL
FT                   QADATLDETLLDAGLERCCSLVAALPSDASNLYVILSAKDLRPDCRLIARANSDEAASK
FT                   LRLAGATVVVSPYVAGGRVMAASALRPLALNFMDLLAGSDYEIEEFQLSQNPLLLKEIE
FT                   GKSLSELELGRRSGAIVLAIRDNGKLIANPGGATQMAAGQLLIVLGSKTQLTTFQRLLG
FT                   EAVDTIESMPG"
FT   sig_peptide     complement(598655..598759)
FT                   /locus_tag="Syncc9605_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.695) with cleavage site probability 0.423 at
FT                   residue 35"
FT   gene            complement(598771..599604)
FT                   /locus_tag="Syncc9605_0619"
FT   CDS_pept        complement(598771..599604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34393.1"
FT                   /translation="MRVLALSPGSLEEQLDRLPALADTCQKLNATLQVACDPQQAAPWK
FT                   LLPCLEKLVPFSFKANPTLADWANLLGCVREPDFQICINFAEGQQVNLMLSMSHIPKRL
FT                   AVEGFACTDQVSFGPGWRPQRLNPFLQALGLELEADQFRLPLAAEALEEAREALPSGDG
FT                   PLLLLSPSGQGDDWPAAEWHKLPETIKSRLPALRSMVLPTGLSLTKRAALVANADVVLS
FT                   SCPVSQRLATYCGTPLVALGAEAEDLPERQEIRCLGRSQELATLQSSDVLTALGF"
FT   gene            599716..600357
FT                   /locus_tag="Syncc9605_0620"
FT   CDS_pept        599716..600357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0620"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34394"
FT                   /db_xref="GOA:Q3ALY8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34394.1"
FT                   /translation="MGADRNKLLLPLAGRPVIAWTIEAALRSERIEWIGIVGQEVDREA
FT                   ILAVLDEPSKPVHWIQGGSTRQESVLCGLAGLPEQARHVLIHDGARCLAEPKLFDRCAA
FT                   VVEDGTALIAATPVSDTIKRVGSDGVIRDTPDRSELWAAQTPQGFAVDQLRRGHAEAVA
FT                   QGWTVTDDASLYERLGWPVQVLDAGPANIKVTTPFDLTVAEAVLALRSAG"
FT   gene            complement(600341..601225)
FT                   /locus_tag="Syncc9605_0621"
FT   CDS_pept        complement(600341..601225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34395"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34395.1"
FT                   /translation="MRITPAPPLKTGDRVACVAASSALQDDIKLQEGIAVLQSWGLDVQ
FT                   PQTLASRRWGYFAGGDDTRHADLHPAEPAALLACARGGWGAARLLEQPIRWQSGWLLGF
FT                   SDVTALLWARQAAGFAGGIHGPLLTTLAEEPHWSRDRLRNLLFGNAVPDLQGRSGGGGV
FT                   GSGPLLVANLTVATHLLGSPFVPPLKGAVLVLEDVGEAPYRLDRMLTQWRLNGSLQGLA
FT                   GLAFGNFEGCADETRDASECFNLEQVLEERTADLGIPRVMDLPVGHRSGNAALPMGAMA
FT                   RLDGQSGRLSLLT"
FT   gene            complement(601225..602124)
FT                   /locus_tag="Syncc9605_0622"
FT   CDS_pept        complement(601225..602124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0622"
FT                   /product="probable 4-hydroxybenzoate-octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34396"
FT                   /db_xref="GOA:Q3ALY6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34396.1"
FT                   /translation="MIVISSSARLQPWIELLRWNKPTGRLILLIPAGWALWLNPTAPPS
FT                   LVLILQILLGGLAVSGAGCIANDLWDQRFDGKVERTKRRPLARGALQRGPAFALLLTLL
FT                   GLSLAVVLSLPADSLRLCLALACTAVLPILGYPSAKRWFAFPQVILALCWGFAVLIPWA
FT                   AATASLSWSPVLVCSWVATVVWTFGFDTVYAMADRRDDASLGLRSSALSLGSSVVPVVR
FT                   GCYLVTAITLAMAAWSAQIPAPFWLLWLLATVFMQLSCNPLNQQDAPMSTYGKHFAQQV
FT                   QAGTLLWLGLVLARGWGA"
FT   gene            602206..603843
FT                   /locus_tag="Syncc9605_0623"
FT   CDS_pept        602206..603843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0623"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34397"
FT                   /db_xref="GOA:Q3ALY5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34397.1"
FT                   /translation="MLDAKAPAQPTEQTNGVPQAVNADLRRIAAIDIGTNSFHLLVAAV
FT                   DPKLRTFRIIQAEKATTRLGERDPETGELTEAAMQRGLETLRQFRDLAASHRVEQIVTA
FT                   ATSAVREAPNGRDFLQTILDDLGMEVDLVSGPEEARLIYLGVLSGMPFGDRPHLLLDIG
FT                   GGSTELILADGRDARALTSTRVGAVRLQRDFVRDDPMPPQRRSFLRAFIQGSLEPAVDK
FT                   VRRRIKPGEIPVLVATSGTAMAIGSLAASEEERPPRKLHGYRVTRQCLDKVVDRLITMT
FT                   PAQRRELASINDRRAEIIVPGALILQTTMKMLGVEDFVLSERALREGLIVDWMLRQGLL
FT                   EDRFSFQSSIRQRTVIHQVQRFAVNQSRAERVASHALSLYDATRGVMHDDSGEGRELLW
FT                   AAAMLHSCGQHINISAYHKHTWYLIRHGELLGYSEAEHLMVAAIARYHRRSLPKKRHES
FT                   WQLVATRDNRRCVQQMALLLRLAAALDRRPEPVISALRIHAVNGTLDLEIVPERINQNV
FT                   SLEQWSLESCAEVVKEAVGVELRVSVQG"
FT   gene            complement(603827..604645)
FT                   /locus_tag="Syncc9605_0624"
FT   CDS_pept        complement(603827..604645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0624"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34398"
FT                   /db_xref="GOA:Q3ALY4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34398.1"
FT                   /translation="MNEPSLVDDQGKATGLVEAGRQLAEARAAAGLTQNQLASQMHMGE
FT                   EQLAALERGDQAELPEPVFIKAMVRRLSSHLGLDADAMVQALGPLNTSEPKRPDPRATT
FT                   RGITPQLQRAVNPLPLVALAGLAGLGFVVWSNASEFKRFAQSLRPANPTLEPSEANLEP
FT                   SEANLEPSEANLEVAEVSDESDALIVPAPPTAELGLTISSREPSWIALRREGIVEFEGL
FT                   LNGERRVENPELVEIYAGRPDLVQLSSPNAETRTLGAVNDIRWIPLNPER"
FT   gene            complement(604748..604819)
FT                   /gene="tRNA-Val1"
FT                   /locus_tag="Syncc9605_R0024"
FT   tRNA            complement(604748..604819)
FT                   /gene="tRNA-Val1"
FT                   /locus_tag="Syncc9605_R0024"
FT                   /product="tRNA-Val"
FT   gene            complement(604845..605606)
FT                   /locus_tag="Syncc9605_0625"
FT   CDS_pept        complement(604845..605606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0625"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34399"
FT                   /db_xref="GOA:Q3ALY3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34399.1"
FT                   /translation="MSHVVSFVGAGPGAPDLLTLRAAERLNKADVLVWTDSLVCPAIAD
FT                   LAPASCERIRTSTTTLEDLIPLLIDRQRQGKRVVRLHDGDTALYSAINEQICALSDAEI
FT                   PVEVIPGISAYQAAAAGLASELTLPGVVQTIVLSRAGGRTGVPEREQLDRLAALRASLC
FT                   IYLSARHVEEVQTTLLQHYPADTPVAIGHRVSWPDQMLTVVPLREMAAVSRERNLIRTT
FT                   LYVVSPALAGGPQRSRLYSPDHDHLFRPMAQ"
FT   gene            complement(605603..606481)
FT                   /locus_tag="Syncc9605_0626"
FT   CDS_pept        complement(605603..606481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0626"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34400"
FT                   /db_xref="GOA:Q3ALY2"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34400.1"
FT                   /translation="MAVEALFPLATFQSPGEFLPHTENWFLPLRWYGLLIATAVLIGLN
FT                   LSSRLAKLRQLENGLISDLLPLLVLFAVIGARIYYVAFEWHNYASHPLKALAIWEGGIA
FT                   IHGALLAGTLTLILFCRWRRQPFWDVLDVLVPSVALGQAIGRWGNFFNSEAFGVPTDLP
FT                   WKLFIQAQSRPVIYGTLEFFHPTFLYESIWNLLLFGLLVLLFRRGLKAPGMLPSGAMSC
FT                   VYLVGYSLGRVWIEGLRIDPLCIGSLPPACDGGIRIAQLMSCTLVALGMIGLWWLYGRK
FT                   QPLPDPSGQRS"
FT   gene            complement(606487..607467)
FT                   /locus_tag="Syncc9605_0627"
FT   CDS_pept        complement(606487..607467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0627"
FT                   /product="apocytochrome f"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34401"
FT                   /db_xref="GOA:Q3ALY1"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34401.1"
FT                   /translation="MGLIFPFPTPASPHRPMRRHLSLFLGSLVIGLALLIAPAASWAYP
FT                   FWAQQNYDSPREATGKIVCANCHLAKKLTQAEVPQSVLPDSVFTASVRVPYENGLQEIG
FT                   ADGSDVGLQVGAVVMLPDGFTLAPQDRWTDEIKEETEGVYFTQYSDEQPNILLVGPIPG
FT                   DEHQEIVFPVLSPDPATDSNIHFGKYQIHVGGNRGRGQVYPTGDKSNNTIYTAPASGTI
FT                   ASIEPGDNGASVVSIKAADGSSVSETIPVGPEVLVSVGDSIEAGTALTNDPNVGGFGQV
FT                   DAEIVLQNPVRIYGLLAFFAAVALAQIMLVLKKRQIEKVQAAEGV"
FT   sig_peptide     complement(607336..607467)
FT                   /locus_tag="Syncc9605_0627"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.990 at
FT                   residue 44"
FT   gene            complement(607458..607994)
FT                   /locus_tag="Syncc9605_0628"
FT   CDS_pept        complement(607458..607994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0628"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34402"
FT                   /db_xref="GOA:Q3ALY0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34402.1"
FT                   /translation="MTQLSSSDVPGMGRRQFMNLLTFGSVTGVALGALYPVANYFIPPK
FT                   AAGSGGGTSAKDELGNPITASGWLSSHPEGDRSLVQGLKGDPTYLIVEGEDAIGSYGIN
FT                   AICTHLGCVVPWNSGANKFMCPCHGSQYDSTGKVVRGPAPLSLALANVSVENDNVFVSQ
FT                   WTETDFRTGDKPWWA"
FT   gene            608042..608458
FT                   /locus_tag="Syncc9605_0629"
FT   CDS_pept        608042..608458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34403"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34403.1"
FT                   /translation="MPVKLCNDWCLPVPASSASVLEIAKPVPEPPLSVDEVIACLRQRW
FT                   RATYDLQLVVRRRRLYLQVMWAYLEQQSFPMDLEAYRQHLGEVLDVVNRLGLAGEVRQW
FT                   LGSTRDKPRLGKALSLPLEATGPEAETLIKEFLV"
FT   gene            complement(608439..609242)
FT                   /locus_tag="Syncc9605_0630"
FT   CDS_pept        complement(608439..609242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0630"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34404"
FT                   /db_xref="GOA:Q3ALX8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34404.1"
FT                   /translation="MSERPEGPPALQPPPPIRIGRPPGDADLPNEVEMPLVDHLEELRQ
FT                   RVLRSLLAVVVAALTCLLGVKPLVRLLEAPASGIHFLQLAPGEFLFVSLKVAGYAGLTL
FT                   ALPYVLFQILAFVLPGLTIRERRLIAPAVAGSAVLFMTGLAFAWWALVPAALRFLVSYG
FT                   ADVVEPLWSIERYLDFVLLLMLATGLAFQLPVLQLLLGALGLVRWRPMLGAWRWVVLGS
FT                   ALAGAVLTPSTDPITMLLLAGAITALFLIGVGLVALTESFRPETL"
FT   gene            complement(609269..610948)
FT                   /locus_tag="Syncc9605_0631"
FT   CDS_pept        complement(609269..610948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0631"
FT                   /product="secreted protein MPB70 precursor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34405"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34405.1"
FT                   /translation="MDLTTLRAVLWDLRPKLLPSRFEKAQQPGPATIQLGCRSLEGMVW
FT                   LELSWQADAPRLVEVNPPPRSGSGSTFAQQLQHSLRQLALVELHQSGFERVVEFRFAQR
FT                   PGEPIQRVLVLELMGRHSNLLLLDEQRRIIALGRQVRDHQSRVRPLSTGDSYSPPPMLQ
FT                   GLAPDRTEGFERWRERLSLVPIPLRKALQQTYQGISPALALQLAGDHVNTPVDSLDARH
FT                   WNHLFERWSLWLDQLEREQFALVVENDGRYRVWGSPRGEVHPQPALALTLGSLHQHCQE
FT                   QRALARVSHDLRQRLERWRSKEQSAQEDQHQRLSATDGHGALQRQADALLCLGNPSRDQ
FT                   VDEAQSLYRRAKKLRRSRPILEQRLEHHQQRLELISESETFIEDQLSATWQDGSARLSA
FT                   LNDLREELDELLQPKERRRSTRQQRQRDQPKPLELTTPGGLKVQVGRNHRQNDWISLRQ
FT                   ARSGDLWFHAQECPGSHVVLKSSNGLAEESDLSMATDLAAYFSRARGNTRVAVVMVPTD
FT                   QLQRIPGAGPGTVRHGQAEIRWGDPQGAEERLLAPSLSPHSG"
FT   gene            611035..611592
FT                   /locus_tag="Syncc9605_0632"
FT   CDS_pept        611035..611592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0632"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34406"
FT                   /db_xref="GOA:Q3ALX6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34406.1"
FT                   /translation="MSTSGKLTLITGPSGVGKGTLVNQLLERHPQIWLSVSATTRSPRQ
FT                   GEQDGINYFFHSRAGFEALVEQGGFLEWAEFAGNCYGTPRGPVEQQMAAGRPVLLEIEL
FT                   EGARQVRRSFPDGFQIFLAPPSFDELERRIRGRGTDSEDAIQRRLTRAREELEAQQEFD
FT                   AVVINDDLESALNQVETLMGLG"
FT   gene            complement(611708..611824)
FT                   /locus_tag="Syncc9605_0633"
FT   CDS_pept        complement(611708..611824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0633"
FT                   /product="photosystem I reaction centre subunit IX (PsaJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34407"
FT                   /db_xref="GOA:Q3ALX5"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34407.1"
FT                   /translation="MNKFLTAAPVVAAIWFTATAGILIEWNRFFPDLLFHPM"
FT   sig_peptide     complement(611762..611824)
FT                   /locus_tag="Syncc9605_0633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            complement(611857..612333)
FT                   /locus_tag="Syncc9605_0634"
FT   CDS_pept        complement(611857..612333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0634"
FT                   /product="photosystem I reaction center subunit III (PsaF)"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34408"
FT                   /db_xref="GOA:Q3ALX4"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34408.1"
FT                   /translation="MRRLFAVVLSALLVFGFAPVAKADVAGLTPCSESARFQQRAAAAT
FT                   TPQAKARFEMYSQASCGDDGLPHLIVDGRWSHAGDFVYPGIMFLYVAGCIGWAGREYLK
FT                   ATRGKNAAQYEIFIDRSIAIKSLLAAATWPLAAFGEFTSGKLLEDDSKVTVSPR"
FT   sig_peptide     complement(612262..612333)
FT                   /locus_tag="Syncc9605_0634"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.960 at
FT                   residue 24"
FT   gene            612411..613484
FT                   /locus_tag="Syncc9605_0635"
FT   CDS_pept        612411..613484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0635"
FT                   /product="metalloendopeptidase, putative, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34409"
FT                   /db_xref="GOA:Q3ALX3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34409.1"
FT                   /translation="MHAVLALETSCDESAAAVLRRHADGRIDVLASRIASQVEEHARWG
FT                   GVVPEIASRRHVEALPGLVEAVVDEAGVTLGQLDAIAATITPGLAGALMVASVTGRTLA
FT                   ALHQRPFLGVHHLEGHLASVMLGDVPQQAPYLVLLVSGGHTELILVAEDGGMTRLGRSH
FT                   DDAAGEAFDKVARLLGLGYPGGPAIQAVAETGDATRFRLPKGRISLPGGGFHPYDFSFS
FT                   GLKTAMLRTVETLRQTTDSLPLADLAASFEQVVADVLVQRSLRCAADHGVQQLVMVGGV
FT                   AANRRLRQSMLEQGNQRGIAVSIAPLAFCTDNAAMIGAAALMRLGQNAACTSFESGVAA
FT                   RWPLDQANALYTPDPPF"
FT   gene            613500..613703
FT                   /locus_tag="Syncc9605_0636"
FT   CDS_pept        613500..613703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0636"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34410"
FT                   /db_xref="GOA:Q3ALX2"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34410.1"
FT                   /translation="MDALFGLCVVVQPETRSDAPEPVEADELNAWKRGFTPQAEIWNGR
FT                   LAMIGLSAGIAVVLLVRVFSGG"
FT   gene            complement(613704..614942)
FT                   /locus_tag="Syncc9605_0637"
FT   CDS_pept        complement(613704..614942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0637"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34411"
FT                   /db_xref="GOA:Q3ALX1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34411.1"
FT                   /translation="MRNPCQFQHRDDPEDRSLAINVAQPVFPPSFPPRPTSGQSSGRSR
FT                   EVHNPGPRAAADGSGSPSLEDIVRIAHDAGHSDVHLGVGKVPRYRARGDMQGTEWPVTR
FT                   AEVFQGWLQEILTPQQIDGFNRDKEFDGSHAFRFVRVRINLMDSLRGPAMVLRLIPQTI
FT                   LTMEQLHLPSVLQSLAARPKGLILVTGPTGSGKSTTLAAMIDWINRNEARHILTIKDPV
FT                   EFVHESRRSLIRHLEVGLHTLKFHNALRAALREDPDVILVGEIRDQETLSTALEAAQTG
FT                   HLVFGTLHTNSAVKTMERVLGMYPPEEQETVRRSLSESLLGVIAQGLIKTTDGKRAAYH
FT                   DILISTDACKDYIQRGALDEVEEIMERSGFDGMVTTNQSLLALVEADRIDGDQAVAASL
FT                   KPNELAQALRGRS"
FT   gene            614993..616105
FT                   /locus_tag="Syncc9605_0638"
FT   CDS_pept        614993..616105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0638"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34412"
FT                   /db_xref="GOA:Q3ALX0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34412.1"
FT                   /translation="MAEQPRVTIVLGTRPEAIKLAPVIRTFQACDALQTRVVLTGQHRE
FT                   MVGQVMDLFHLQADQDLNLMTPRQTLTHVTCAALQGLREDFQAYLPQLVLVQGDTTTAF
FT                   AAGLAAFYEQIPVGHVEAGLRTDNLLDPFPEEANRRLLSQIATLHFAPTLKAQSNLKAS
FT                   GVVGEIFVTGNTVIDALLLMAESAPDVRFDGLDWDQQRVILATVHRRENWGERLNDIAA
FT                   GMLQVLERYPDTALLLPMHRNPTVREPLQALLGSHPRVVLTEPLDYDRLVAAMKGCSLL
FT                   LTDSGGLQEEAPALGKPVLVLRRTTERPEAVDAGTARLVGTDPDVILEETSRLLGDATA
FT                   YQEMSRAVNPFGDGHASERILELCRRQLGV"
FT   gene            616074..616676
FT                   /locus_tag="Syncc9605_0639"
FT   CDS_pept        616074..616676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34413"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34413.1"
FT                   /translation="MSSVADSSASEASLSSDGFYRWWLRRRLGTGEGCLLFVGLNPSRA
FT                   DGQHDDPTLRRLIGFARHWGYRELLVLNLFARMSPSPAALLRVKDPIGGLNDAILNRWF
FT                   NHWSRTSGVDLWCGWGANGARWDRTQLVLGNIQRLLPQRRRSVPNSPHPLMLGQTASGQ
FT                   PRHPLYALGNACLHPFLWADPEPIRHPVGTMADVLPR"
FT   gene            616911..618176
FT                   /locus_tag="Syncc9605_0640"
FT   CDS_pept        616911..618176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0640"
FT                   /product="putative Na+/H+ antiporter, CPA1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34414"
FT                   /db_xref="GOA:Q3ALW8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ALW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB34414.1"
FT                   /translation="MTPERLGLLWGVTVSSGAAARFLAAKSEFPGVVLLLLSGLLIGRS
FT                   GLGWVEPLDLGSGLGTVVGLLVSLVLFDGGLNLRLPGDTIKATVQRIAALRLLISLGGG
FT                   LLAAHWLAGLSWSLAAVFSAIVLATGPTVVTPLVRQIRLAPPLGEVLEAEGLVLEPIGA
FT                   VLALLLLELVLGNLHGWREVMLGLLYRLGGGVLIGASVGWLLSELLRRLKPDQLKGLPL
FT                   QLSLGLLFLMYGVSEWMLPESALPASVAAGIVVGRRPGPHTAELDSLIQELAQLAITML
FT                   FPLLAADVSWAELSPLGWGGILCVLSLMLVVRPIGVGLATIGLPYKLEQRLFLGWLAPR
FT                   GIVTAAVASLFAIRLEQAGILGAGRLQGLVFLTILMTVGLQGLTAQPLARALGLVEADD
FT                   DEPASAEAAAQSRQVLTDSGQQ"
FT   sig_peptide     616911..616973
FT                   /locus_tag="Syncc9605_0640"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.727) with cleavage site probability 0.403 at
FT                   residue 21"
FT   gene            complement(618120..619553)
FT                   /locus_tag="Syncc9605_0641"
FT   CDS_pept        complement(618120..619553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Syncc9605_0641"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Syncc9605_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABB34415"
FT                   /db_xref="GOA:Q3ALW7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ALW7"
FT                   /inference="non-experimental evidence, no additional
FT