(data stored in ACNUC8465 zone)

EMBL: CP000113

ID   CP000113; SV 1; circular; genomic DNA; STD; PRO; 9139763 BP.
AC   CP000113;
PR   Project:PRJNA1421;
DT   08-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
DE   Myxococcus xanthus DK 1622, complete genome.
KW   .
OS   Myxococcus xanthus DK 1622
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Cystobacterineae; Myxococcaceae; Myxococcus.
RN   [1]
RC   Erratum:[Proc Natl Acad Sci U S A. 2006 Dec 19;103(51):19605. Eisen, J
RC   [corrected to Eisen, J A]]
RP   1-9139763
RX   DOI; 10.1073/pnas.0607335103.
RX   PUBMED; 17015832.
RA   Goldman B.S., Nierman W.C., Kaiser D., Slater S.C., Durkin A.S.,
RA   Eisen J.A., Ronning C.M., Barbazuk W.B., Blanchard M., Field C.,
RA   Halling C., Hinkle G., Iartchuk O., Kim H.S., Mackenzie C., Madupu R.,
RA   Miller N., Shvartsbeyn A., Sullivan S.A., Vaudin M., Wiegand R.,
RA   Kaplan H.B.;
RT   "Evolution of sensory complexity recorded in a myxobacterial genome";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(41):15200-15205(2006).
RN   [2]
RP   1-9139763
RA   Nierman W.C.;
RT   ;
RL   Submitted (29-AUG-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
DR   MD5; bfa8e4244740ad8ab08f3823f4abb8df.
DR   BioSample; SAMN02604018.
DR   EnsemblGenomes-Gn; EBG00001183981.
DR   EnsemblGenomes-Gn; EBG00001183982.
DR   EnsemblGenomes-Gn; EBG00001183983.
DR   EnsemblGenomes-Gn; EBG00001183984.
DR   EnsemblGenomes-Gn; EBG00001183985.
DR   EnsemblGenomes-Gn; EBG00001183986.
DR   EnsemblGenomes-Gn; EBG00001183987.
DR   EnsemblGenomes-Gn; EBG00001183988.
DR   EnsemblGenomes-Gn; EBG00001183989.
DR   EnsemblGenomes-Gn; EBG00001183990.
DR   EnsemblGenomes-Gn; EBG00001183991.
DR   EnsemblGenomes-Gn; EBG00001183992.
DR   EnsemblGenomes-Gn; EBG00001183993.
DR   EnsemblGenomes-Gn; EBG00001183994.
DR   EnsemblGenomes-Gn; EBG00001183995.
DR   EnsemblGenomes-Gn; EBG00001183996.
DR   EnsemblGenomes-Gn; EBG00001183997.
DR   EnsemblGenomes-Gn; EBG00001183998.
DR   EnsemblGenomes-Gn; EBG00001183999.
DR   EnsemblGenomes-Gn; EBG00001184000.
DR   EnsemblGenomes-Gn; EBG00001184001.
DR   EnsemblGenomes-Gn; EBG00001184002.
DR   EnsemblGenomes-Gn; EBG00001184003.
DR   EnsemblGenomes-Gn; EBG00001184004.
DR   EnsemblGenomes-Gn; EBG00001184005.
DR   EnsemblGenomes-Gn; EBG00001184006.
DR   EnsemblGenomes-Gn; EBG00001184007.
DR   EnsemblGenomes-Gn; EBG00001184008.
DR   EnsemblGenomes-Gn; EBG00001184009.
DR   EnsemblGenomes-Gn; EBG00001184010.
DR   EnsemblGenomes-Gn; EBG00001184011.
DR   EnsemblGenomes-Gn; EBG00001184012.
DR   EnsemblGenomes-Gn; EBG00001184013.
DR   EnsemblGenomes-Gn; EBG00001184014.
DR   EnsemblGenomes-Gn; EBG00001184015.
DR   EnsemblGenomes-Gn; EBG00001184016.
DR   EnsemblGenomes-Gn; EBG00001184017.
DR   EnsemblGenomes-Gn; EBG00001184018.
DR   EnsemblGenomes-Gn; EBG00001184019.
DR   EnsemblGenomes-Gn; EBG00001184020.
DR   EnsemblGenomes-Gn; EBG00001184021.
DR   EnsemblGenomes-Gn; EBG00001184022.
DR   EnsemblGenomes-Gn; EBG00001184023.
DR   EnsemblGenomes-Gn; EBG00001184024.
DR   EnsemblGenomes-Gn; EBG00001184025.
DR   EnsemblGenomes-Gn; EBG00001184026.
DR   EnsemblGenomes-Gn; EBG00001184027.
DR   EnsemblGenomes-Gn; EBG00001184028.
DR   EnsemblGenomes-Gn; EBG00001184029.
DR   EnsemblGenomes-Gn; EBG00001184030.
DR   EnsemblGenomes-Gn; EBG00001184031.
DR   EnsemblGenomes-Gn; EBG00001184032.
DR   EnsemblGenomes-Gn; EBG00001184033.
DR   EnsemblGenomes-Gn; EBG00001184034.
DR   EnsemblGenomes-Gn; EBG00001184035.
DR   EnsemblGenomes-Gn; EBG00001184036.
DR   EnsemblGenomes-Gn; EBG00001184037.
DR   EnsemblGenomes-Gn; EBG00001184038.
DR   EnsemblGenomes-Gn; EBG00001184039.
DR   EnsemblGenomes-Gn; EBG00001184040.
DR   EnsemblGenomes-Gn; EBG00001184041.
DR   EnsemblGenomes-Gn; EBG00001184042.
DR   EnsemblGenomes-Gn; EBG00001184043.
DR   EnsemblGenomes-Gn; EBG00001184044.
DR   EnsemblGenomes-Gn; EBG00001184045.
DR   EnsemblGenomes-Gn; EBG00001184046.
DR   EnsemblGenomes-Gn; EBG00001184047.
DR   EnsemblGenomes-Gn; EBG00001184048.
DR   EnsemblGenomes-Gn; EBG00001184049.
DR   EnsemblGenomes-Gn; EBG00001184050.
DR   EnsemblGenomes-Gn; EBG00001184051.
DR   EnsemblGenomes-Gn; EBG00001184052.
DR   EnsemblGenomes-Gn; EBG00001184053.
DR   EnsemblGenomes-Gn; EBG00001184054.
DR   EnsemblGenomes-Gn; EBG00001184055.
DR   EnsemblGenomes-Gn; EBG00001184056.
DR   EnsemblGenomes-Gn; EBG00001184057.
DR   EnsemblGenomes-Gn; EBG00001184058.
DR   EnsemblGenomes-Gn; EBG00001184059.
DR   EnsemblGenomes-Gn; EBG00001184060.
DR   EnsemblGenomes-Gn; EBG00001184061.
DR   EnsemblGenomes-Gn; EBG00001184062.
DR   EnsemblGenomes-Gn; EBG00001184063.
DR   EnsemblGenomes-Gn; EBG00001184064.
DR   EnsemblGenomes-Gn; EBG00001184065.
DR   EnsemblGenomes-Gn; EBG00001184066.
DR   EnsemblGenomes-Gn; EBG00001184067.
DR   EnsemblGenomes-Gn; EBG00001184068.
DR   EnsemblGenomes-Gn; EBG00001184069.
DR   EnsemblGenomes-Gn; EBG00001184070.
DR   EnsemblGenomes-Gn; EBG00001184071.
DR   EnsemblGenomes-Gn; EBG00001184072.
DR   EnsemblGenomes-Gn; EBG00001184073.
DR   EnsemblGenomes-Gn; EBG00001184074.
DR   EnsemblGenomes-Gn; EBG00001184075.
DR   EnsemblGenomes-Gn; EBG00001184076.
DR   EnsemblGenomes-Gn; EBG00001184077.
DR   EnsemblGenomes-Gn; EBG00001184078.
DR   EnsemblGenomes-Gn; EBG00001184079.
DR   EnsemblGenomes-Gn; EBG00001184080.
DR   EnsemblGenomes-Gn; EBG00001184081.
DR   EnsemblGenomes-Gn; EBG00001184082.
DR   EnsemblGenomes-Gn; EBG00001184083.
DR   EnsemblGenomes-Gn; EBG00001184084.
DR   EnsemblGenomes-Gn; EBG00001184085.
DR   EnsemblGenomes-Gn; EBG00001184086.
DR   EnsemblGenomes-Gn; EBG00001184087.
DR   EnsemblGenomes-Gn; EBG00001184088.
DR   EnsemblGenomes-Gn; EBG00001184089.
DR   EnsemblGenomes-Gn; EBG00001184090.
DR   EnsemblGenomes-Gn; EBG00001184091.
DR   EnsemblGenomes-Gn; EBG00001184092.
DR   EnsemblGenomes-Gn; EBG00001184093.
DR   EnsemblGenomes-Gn; EBG00001184094.
DR   EnsemblGenomes-Gn; EBG00001184095.
DR   EnsemblGenomes-Gn; EBG00001184096.
DR   EnsemblGenomes-Gn; EBG00001184097.
DR   EnsemblGenomes-Gn; EBG00001184098.
DR   EnsemblGenomes-Gn; EBG00001184099.
DR   EnsemblGenomes-Gn; EBG00001184100.
DR   EnsemblGenomes-Gn; EBG00001184101.
DR   EnsemblGenomes-Gn; EBG00001184102.
DR   EnsemblGenomes-Gn; EBG00001184103.
DR   EnsemblGenomes-Gn; EBG00001184104.
DR   EnsemblGenomes-Gn; EBG00001184105.
DR   EnsemblGenomes-Gn; EBG00001184106.
DR   EnsemblGenomes-Gn; EBG00001184107.
DR   EnsemblGenomes-Gn; EBG00001184108.
DR   EnsemblGenomes-Gn; EBG00001184109.
DR   EnsemblGenomes-Gn; EBG00001184110.
DR   EnsemblGenomes-Gn; EBG00001184111.
DR   EnsemblGenomes-Gn; EBG00001184112.
DR   EnsemblGenomes-Gn; EBG00001184113.
DR   EnsemblGenomes-Gn; EBG00001184114.
DR   EnsemblGenomes-Gn; EBG00001184115.
DR   EnsemblGenomes-Gn; EBG00001184116.
DR   EnsemblGenomes-Gn; EBG00001184117.
DR   EnsemblGenomes-Gn; EBG00001184118.
DR   EnsemblGenomes-Gn; EBG00001184119.
DR   EnsemblGenomes-Gn; EBG00001184120.
DR   EnsemblGenomes-Gn; EBG00001184121.
DR   EnsemblGenomes-Gn; EBG00001184122.
DR   EnsemblGenomes-Gn; EBG00001184123.
DR   EnsemblGenomes-Gn; EBG00001184124.
DR   EnsemblGenomes-Gn; EBG00001184125.
DR   EnsemblGenomes-Gn; EBG00001184126.
DR   EnsemblGenomes-Gn; EBG00001184127.
DR   EnsemblGenomes-Gn; EBG00001184128.
DR   EnsemblGenomes-Gn; EBG00001184129.
DR   EnsemblGenomes-Gn; EBG00001184130.
DR   EnsemblGenomes-Gn; EBG00001184131.
DR   EnsemblGenomes-Gn; EBG00001184132.
DR   EnsemblGenomes-Gn; EBG00001184133.
DR   EnsemblGenomes-Gn; EBG00001184134.
DR   EnsemblGenomes-Gn; EBG00001184135.
DR   EnsemblGenomes-Gn; EBG00001184136.
DR   EnsemblGenomes-Gn; EBG00001184137.
DR   EnsemblGenomes-Gn; EBG00001184138.
DR   EnsemblGenomes-Gn; EBG00001184139.
DR   EnsemblGenomes-Gn; EBG00001184140.
DR   EnsemblGenomes-Gn; EBG00001184141.
DR   EnsemblGenomes-Gn; EBG00001184142.
DR   EnsemblGenomes-Gn; EBG00001184143.
DR   EnsemblGenomes-Gn; EBG00001184144.
DR   EnsemblGenomes-Gn; EBG00001184145.
DR   EnsemblGenomes-Gn; EBG00001184146.
DR   EnsemblGenomes-Gn; EBG00001184147.
DR   EnsemblGenomes-Gn; EBG00001184148.
DR   EnsemblGenomes-Gn; EBG00001184149.
DR   EnsemblGenomes-Gn; EBG00001184150.
DR   EnsemblGenomes-Gn; EBG00001184151.
DR   EnsemblGenomes-Gn; MXAN_0281.
DR   EnsemblGenomes-Gn; MXAN_0319.
DR   EnsemblGenomes-Gn; MXAN_0320.
DR   EnsemblGenomes-Gn; MXAN_0321.
DR   EnsemblGenomes-Gn; MXAN_0322.
DR   EnsemblGenomes-Gn; MXAN_0323.
DR   EnsemblGenomes-Gn; MXAN_0381.
DR   EnsemblGenomes-Gn; MXAN_0382.
DR   EnsemblGenomes-Gn; MXAN_0388.
DR   EnsemblGenomes-Gn; MXAN_0424.
DR   EnsemblGenomes-Gn; MXAN_0786.
DR   EnsemblGenomes-Gn; MXAN_1487.
DR   EnsemblGenomes-Gn; MXAN_1488.
DR   EnsemblGenomes-Gn; MXAN_1489.
DR   EnsemblGenomes-Gn; MXAN_1490.
DR   EnsemblGenomes-Gn; MXAN_1491.
DR   EnsemblGenomes-Gn; MXAN_1908.
DR   EnsemblGenomes-Gn; MXAN_1935.
DR   EnsemblGenomes-Gn; MXAN_1936.
DR   EnsemblGenomes-Gn; MXAN_1938.
DR   EnsemblGenomes-Gn; MXAN_1939.
DR   EnsemblGenomes-Gn; MXAN_1940.
DR   EnsemblGenomes-Gn; MXAN_2006.
DR   EnsemblGenomes-Gn; MXAN_2007.
DR   EnsemblGenomes-Gn; MXAN_2008.
DR   EnsemblGenomes-Gn; MXAN_2009.
DR   EnsemblGenomes-Gn; MXAN_2011.
DR   EnsemblGenomes-Gn; MXAN_2012.
DR   EnsemblGenomes-Gn; MXAN_2672.
DR   EnsemblGenomes-Gn; MXAN_2673.
DR   EnsemblGenomes-Gn; MXAN_2819.
DR   EnsemblGenomes-Gn; MXAN_2823.
DR   EnsemblGenomes-Gn; MXAN_2824.
DR   EnsemblGenomes-Gn; MXAN_2825.
DR   EnsemblGenomes-Gn; MXAN_2826.
DR   EnsemblGenomes-Gn; MXAN_3047.
DR   EnsemblGenomes-Gn; MXAN_3064.
DR   EnsemblGenomes-Gn; MXAN_3065.
DR   EnsemblGenomes-Gn; MXAN_3066.
DR   EnsemblGenomes-Gn; MXAN_3067.
DR   EnsemblGenomes-Gn; MXAN_3070.
DR   EnsemblGenomes-Gn; MXAN_3184.
DR   EnsemblGenomes-Gn; MXAN_3185.
DR   EnsemblGenomes-Gn; MXAN_3477.
DR   EnsemblGenomes-Gn; MXAN_3494.
DR   EnsemblGenomes-Gn; MXAN_3560.
DR   EnsemblGenomes-Gn; MXAN_3561.
DR   EnsemblGenomes-Gn; MXAN_3562.
DR   EnsemblGenomes-Gn; MXAN_3590.
DR   EnsemblGenomes-Gn; MXAN_3597.
DR   EnsemblGenomes-Gn; MXAN_3737.
DR   EnsemblGenomes-Gn; MXAN_3741.
DR   EnsemblGenomes-Gn; MXAN_3742.
DR   EnsemblGenomes-Gn; MXAN_4326.
DR   EnsemblGenomes-Gn; MXAN_4408.
DR   EnsemblGenomes-Gn; MXAN_4472.
DR   EnsemblGenomes-Gn; MXAN_4624.
DR   EnsemblGenomes-Gn; MXAN_4625.
DR   EnsemblGenomes-Gn; MXAN_4701.
DR   EnsemblGenomes-Gn; MXAN_4702.
DR   EnsemblGenomes-Gn; MXAN_4703.
DR   EnsemblGenomes-Gn; MXAN_4704.
DR   EnsemblGenomes-Gn; MXAN_4797.
DR   EnsemblGenomes-Gn; MXAN_4853.
DR   EnsemblGenomes-Gn; MXAN_4913.
DR   EnsemblGenomes-Gn; MXAN_5007.
DR   EnsemblGenomes-Gn; MXAN_5206.
DR   EnsemblGenomes-Gn; MXAN_5320.
DR   EnsemblGenomes-Gn; MXAN_5381.
DR   EnsemblGenomes-Gn; MXAN_5382.
DR   EnsemblGenomes-Gn; MXAN_5383.
DR   EnsemblGenomes-Gn; MXAN_6295.
DR   EnsemblGenomes-Gn; MXAN_7341.
DR   EnsemblGenomes-Gn; MXAN_7342.
DR   EnsemblGenomes-Gn; MXAN_7343.
DR   EnsemblGenomes-Gn; MXAN_7344.
DR   EnsemblGenomes-Gn; MXAN_7345.
DR   EnsemblGenomes-Tr; EBT00001762943.
DR   EnsemblGenomes-Tr; EBT00001762945.
DR   EnsemblGenomes-Tr; EBT00001762947.
DR   EnsemblGenomes-Tr; EBT00001762949.
DR   EnsemblGenomes-Tr; EBT00001762951.
DR   EnsemblGenomes-Tr; EBT00001762953.
DR   EnsemblGenomes-Tr; EBT00001762954.
DR   EnsemblGenomes-Tr; EBT00001762956.
DR   EnsemblGenomes-Tr; EBT00001762958.
DR   EnsemblGenomes-Tr; EBT00001762959.
DR   EnsemblGenomes-Tr; EBT00001762960.
DR   EnsemblGenomes-Tr; EBT00001762961.
DR   EnsemblGenomes-Tr; EBT00001762964.
DR   EnsemblGenomes-Tr; EBT00001762966.
DR   EnsemblGenomes-Tr; EBT00001762967.
DR   EnsemblGenomes-Tr; EBT00001762969.
DR   EnsemblGenomes-Tr; EBT00001762971.
DR   EnsemblGenomes-Tr; EBT00001762973.
DR   EnsemblGenomes-Tr; EBT00001762974.
DR   EnsemblGenomes-Tr; EBT00001762976.
DR   EnsemblGenomes-Tr; EBT00001762979.
DR   EnsemblGenomes-Tr; EBT00001762980.
DR   EnsemblGenomes-Tr; EBT00001762982.
DR   EnsemblGenomes-Tr; EBT00001762983.
DR   EnsemblGenomes-Tr; EBT00001762985.
DR   EnsemblGenomes-Tr; EBT00001762986.
DR   EnsemblGenomes-Tr; EBT00001762987.
DR   EnsemblGenomes-Tr; EBT00001762989.
DR   EnsemblGenomes-Tr; EBT00001762991.
DR   EnsemblGenomes-Tr; EBT00001762992.
DR   EnsemblGenomes-Tr; EBT00001762994.
DR   EnsemblGenomes-Tr; EBT00001762996.
DR   EnsemblGenomes-Tr; EBT00001762997.
DR   EnsemblGenomes-Tr; EBT00001763000.
DR   EnsemblGenomes-Tr; EBT00001763002.
DR   EnsemblGenomes-Tr; EBT00001763004.
DR   EnsemblGenomes-Tr; EBT00001763006.
DR   EnsemblGenomes-Tr; EBT00001763008.
DR   EnsemblGenomes-Tr; EBT00001763009.
DR   EnsemblGenomes-Tr; EBT00001763011.
DR   EnsemblGenomes-Tr; EBT00001763012.
DR   EnsemblGenomes-Tr; EBT00001763013.
DR   EnsemblGenomes-Tr; EBT00001763014.
DR   EnsemblGenomes-Tr; EBT00001763015.
DR   EnsemblGenomes-Tr; EBT00001763016.
DR   EnsemblGenomes-Tr; EBT00001763017.
DR   EnsemblGenomes-Tr; EBT00001763018.
DR   EnsemblGenomes-Tr; EBT00001763019.
DR   EnsemblGenomes-Tr; EBT00001763020.
DR   EnsemblGenomes-Tr; EBT00001763021.
DR   EnsemblGenomes-Tr; EBT00001763022.
DR   EnsemblGenomes-Tr; EBT00001763023.
DR   EnsemblGenomes-Tr; EBT00001763024.
DR   EnsemblGenomes-Tr; EBT00001763025.
DR   EnsemblGenomes-Tr; EBT00001763026.
DR   EnsemblGenomes-Tr; EBT00001763027.
DR   EnsemblGenomes-Tr; EBT00001763028.
DR   EnsemblGenomes-Tr; EBT00001763029.
DR   EnsemblGenomes-Tr; EBT00001763030.
DR   EnsemblGenomes-Tr; EBT00001763031.
DR   EnsemblGenomes-Tr; EBT00001763032.
DR   EnsemblGenomes-Tr; EBT00001763033.
DR   EnsemblGenomes-Tr; EBT00001763034.
DR   EnsemblGenomes-Tr; EBT00001763035.
DR   EnsemblGenomes-Tr; EBT00001763036.
DR   EnsemblGenomes-Tr; EBT00001763037.
DR   EnsemblGenomes-Tr; EBT00001763038.
DR   EnsemblGenomes-Tr; EBT00001763039.
DR   EnsemblGenomes-Tr; EBT00001763040.
DR   EnsemblGenomes-Tr; EBT00001763041.
DR   EnsemblGenomes-Tr; EBT00001763042.
DR   EnsemblGenomes-Tr; EBT00001763043.
DR   EnsemblGenomes-Tr; EBT00001763044.
DR   EnsemblGenomes-Tr; EBT00001763045.
DR   EnsemblGenomes-Tr; EBT00001763046.
DR   EnsemblGenomes-Tr; EBT00001763047.
DR   EnsemblGenomes-Tr; EBT00001763048.
DR   EnsemblGenomes-Tr; EBT00001763049.
DR   EnsemblGenomes-Tr; EBT00001763050.
DR   EnsemblGenomes-Tr; EBT00001763051.
DR   EnsemblGenomes-Tr; EBT00001763052.
DR   EnsemblGenomes-Tr; EBT00001763053.
DR   EnsemblGenomes-Tr; EBT00001763054.
DR   EnsemblGenomes-Tr; EBT00001763055.
DR   EnsemblGenomes-Tr; EBT00001763056.
DR   EnsemblGenomes-Tr; EBT00001763057.
DR   EnsemblGenomes-Tr; EBT00001763058.
DR   EnsemblGenomes-Tr; EBT00001763059.
DR   EnsemblGenomes-Tr; EBT00001763060.
DR   EnsemblGenomes-Tr; EBT00001763061.
DR   EnsemblGenomes-Tr; EBT00001763062.
DR   EnsemblGenomes-Tr; EBT00001763063.
DR   EnsemblGenomes-Tr; EBT00001763064.
DR   EnsemblGenomes-Tr; EBT00001763065.
DR   EnsemblGenomes-Tr; EBT00001763066.
DR   EnsemblGenomes-Tr; EBT00001763067.
DR   EnsemblGenomes-Tr; EBT00001763068.
DR   EnsemblGenomes-Tr; EBT00001763069.
DR   EnsemblGenomes-Tr; EBT00001763070.
DR   EnsemblGenomes-Tr; EBT00001763071.
DR   EnsemblGenomes-Tr; EBT00001763072.
DR   EnsemblGenomes-Tr; EBT00001763073.
DR   EnsemblGenomes-Tr; EBT00001763074.
DR   EnsemblGenomes-Tr; EBT00001763075.
DR   EnsemblGenomes-Tr; EBT00001763076.
DR   EnsemblGenomes-Tr; EBT00001763077.
DR   EnsemblGenomes-Tr; EBT00001763078.
DR   EnsemblGenomes-Tr; EBT00001763079.
DR   EnsemblGenomes-Tr; EBT00001763080.
DR   EnsemblGenomes-Tr; EBT00001763081.
DR   EnsemblGenomes-Tr; EBT00001763082.
DR   EnsemblGenomes-Tr; EBT00001763083.
DR   EnsemblGenomes-Tr; EBT00001763084.
DR   EnsemblGenomes-Tr; EBT00001763085.
DR   EnsemblGenomes-Tr; EBT00001763086.
DR   EnsemblGenomes-Tr; EBT00001763087.
DR   EnsemblGenomes-Tr; EBT00001763088.
DR   EnsemblGenomes-Tr; EBT00001763089.
DR   EnsemblGenomes-Tr; EBT00001763090.
DR   EnsemblGenomes-Tr; EBT00001763091.
DR   EnsemblGenomes-Tr; EBT00001763092.
DR   EnsemblGenomes-Tr; EBT00001763093.
DR   EnsemblGenomes-Tr; EBT00001763094.
DR   EnsemblGenomes-Tr; EBT00001763095.
DR   EnsemblGenomes-Tr; EBT00001763096.
DR   EnsemblGenomes-Tr; EBT00001763097.
DR   EnsemblGenomes-Tr; EBT00001763098.
DR   EnsemblGenomes-Tr; EBT00001763099.
DR   EnsemblGenomes-Tr; EBT00001763100.
DR   EnsemblGenomes-Tr; EBT00001763101.
DR   EnsemblGenomes-Tr; EBT00001763102.
DR   EnsemblGenomes-Tr; EBT00001763103.
DR   EnsemblGenomes-Tr; EBT00001763104.
DR   EnsemblGenomes-Tr; EBT00001763105.
DR   EnsemblGenomes-Tr; EBT00001763106.
DR   EnsemblGenomes-Tr; EBT00001763107.
DR   EnsemblGenomes-Tr; EBT00001763108.
DR   EnsemblGenomes-Tr; EBT00001763109.
DR   EnsemblGenomes-Tr; EBT00001763110.
DR   EnsemblGenomes-Tr; EBT00001763111.
DR   EnsemblGenomes-Tr; EBT00001763112.
DR   EnsemblGenomes-Tr; EBT00001763113.
DR   EnsemblGenomes-Tr; EBT00001763114.
DR   EnsemblGenomes-Tr; EBT00001763115.
DR   EnsemblGenomes-Tr; EBT00001763116.
DR   EnsemblGenomes-Tr; EBT00001763117.
DR   EnsemblGenomes-Tr; EBT00001763118.
DR   EnsemblGenomes-Tr; EBT00001763119.
DR   EnsemblGenomes-Tr; EBT00001763120.
DR   EnsemblGenomes-Tr; EBT00001763121.
DR   EnsemblGenomes-Tr; EBT00001763122.
DR   EnsemblGenomes-Tr; EBT00001763123.
DR   EnsemblGenomes-Tr; EBT00001763124.
DR   EnsemblGenomes-Tr; EBT00001763125.
DR   EnsemblGenomes-Tr; EBT00001763126.
DR   EnsemblGenomes-Tr; EBT00001763127.
DR   EnsemblGenomes-Tr; EBT00001763128.
DR   EnsemblGenomes-Tr; EBT00001763129.
DR   EnsemblGenomes-Tr; EBT00001763130.
DR   EnsemblGenomes-Tr; EBT00001763131.
DR   EnsemblGenomes-Tr; EBT00001763132.
DR   EnsemblGenomes-Tr; EBT00001763133.
DR   EnsemblGenomes-Tr; EBT00001763134.
DR   EnsemblGenomes-Tr; EBT00001763135.
DR   EnsemblGenomes-Tr; EBT00001763136.
DR   EnsemblGenomes-Tr; EBT00001763137.
DR   EnsemblGenomes-Tr; EBT00001763138.
DR   EnsemblGenomes-Tr; EBT00001763139.
DR   EnsemblGenomes-Tr; EBT00001763140.
DR   EnsemblGenomes-Tr; EBT00001763141.
DR   EnsemblGenomes-Tr; EBT00001763142.
DR   EnsemblGenomes-Tr; MXAN_0281-1.
DR   EnsemblGenomes-Tr; MXAN_0319-1.
DR   EnsemblGenomes-Tr; MXAN_0320-1.
DR   EnsemblGenomes-Tr; MXAN_0321-1.
DR   EnsemblGenomes-Tr; MXAN_0322-1.
DR   EnsemblGenomes-Tr; MXAN_0323-1.
DR   EnsemblGenomes-Tr; MXAN_0381-1.
DR   EnsemblGenomes-Tr; MXAN_0382-1.
DR   EnsemblGenomes-Tr; MXAN_0388-1.
DR   EnsemblGenomes-Tr; MXAN_0424-1.
DR   EnsemblGenomes-Tr; MXAN_0786-1.
DR   EnsemblGenomes-Tr; MXAN_1487-1.
DR   EnsemblGenomes-Tr; MXAN_1488-1.
DR   EnsemblGenomes-Tr; MXAN_1489-1.
DR   EnsemblGenomes-Tr; MXAN_1490-1.
DR   EnsemblGenomes-Tr; MXAN_1491-1.
DR   EnsemblGenomes-Tr; MXAN_1908-1.
DR   EnsemblGenomes-Tr; MXAN_1935-1.
DR   EnsemblGenomes-Tr; MXAN_1936-1.
DR   EnsemblGenomes-Tr; MXAN_1938-1.
DR   EnsemblGenomes-Tr; MXAN_1939-1.
DR   EnsemblGenomes-Tr; MXAN_1940-1.
DR   EnsemblGenomes-Tr; MXAN_2006-1.
DR   EnsemblGenomes-Tr; MXAN_2007-1.
DR   EnsemblGenomes-Tr; MXAN_2008-1.
DR   EnsemblGenomes-Tr; MXAN_2009-1.
DR   EnsemblGenomes-Tr; MXAN_2011-1.
DR   EnsemblGenomes-Tr; MXAN_2012-1.
DR   EnsemblGenomes-Tr; MXAN_2672-1.
DR   EnsemblGenomes-Tr; MXAN_2673-1.
DR   EnsemblGenomes-Tr; MXAN_2819-1.
DR   EnsemblGenomes-Tr; MXAN_2823-1.
DR   EnsemblGenomes-Tr; MXAN_2824-1.
DR   EnsemblGenomes-Tr; MXAN_2825-1.
DR   EnsemblGenomes-Tr; MXAN_2826-1.
DR   EnsemblGenomes-Tr; MXAN_3047-1.
DR   EnsemblGenomes-Tr; MXAN_3064-1.
DR   EnsemblGenomes-Tr; MXAN_3065-1.
DR   EnsemblGenomes-Tr; MXAN_3066-1.
DR   EnsemblGenomes-Tr; MXAN_3067-1.
DR   EnsemblGenomes-Tr; MXAN_3070-1.
DR   EnsemblGenomes-Tr; MXAN_3184-1.
DR   EnsemblGenomes-Tr; MXAN_3185-1.
DR   EnsemblGenomes-Tr; MXAN_3477-1.
DR   EnsemblGenomes-Tr; MXAN_3494-1.
DR   EnsemblGenomes-Tr; MXAN_3560-1.
DR   EnsemblGenomes-Tr; MXAN_3561-1.
DR   EnsemblGenomes-Tr; MXAN_3562-1.
DR   EnsemblGenomes-Tr; MXAN_3590-1.
DR   EnsemblGenomes-Tr; MXAN_3597-1.
DR   EnsemblGenomes-Tr; MXAN_3737-1.
DR   EnsemblGenomes-Tr; MXAN_3741-1.
DR   EnsemblGenomes-Tr; MXAN_3742-1.
DR   EnsemblGenomes-Tr; MXAN_4326-1.
DR   EnsemblGenomes-Tr; MXAN_4408-1.
DR   EnsemblGenomes-Tr; MXAN_4472-1.
DR   EnsemblGenomes-Tr; MXAN_4624-1.
DR   EnsemblGenomes-Tr; MXAN_4625-1.
DR   EnsemblGenomes-Tr; MXAN_4701-1.
DR   EnsemblGenomes-Tr; MXAN_4702-1.
DR   EnsemblGenomes-Tr; MXAN_4703-1.
DR   EnsemblGenomes-Tr; MXAN_4704-1.
DR   EnsemblGenomes-Tr; MXAN_4797-1.
DR   EnsemblGenomes-Tr; MXAN_4853-1.
DR   EnsemblGenomes-Tr; MXAN_4913-1.
DR   EnsemblGenomes-Tr; MXAN_5007-1.
DR   EnsemblGenomes-Tr; MXAN_5206-1.
DR   EnsemblGenomes-Tr; MXAN_5320-1.
DR   EnsemblGenomes-Tr; MXAN_5381-1.
DR   EnsemblGenomes-Tr; MXAN_5382-1.
DR   EnsemblGenomes-Tr; MXAN_5383-1.
DR   EnsemblGenomes-Tr; MXAN_6295-1.
DR   EnsemblGenomes-Tr; MXAN_7341-1.
DR   EnsemblGenomes-Tr; MXAN_7342-1.
DR   EnsemblGenomes-Tr; MXAN_7343-1.
DR   EnsemblGenomes-Tr; MXAN_7344-1.
DR   EnsemblGenomes-Tr; MXAN_7345-1.
DR   EuropePMC; PMC1472437; 16707573.
DR   EuropePMC; PMC1622800; 17015832.
DR   EuropePMC; PMC1698203; 16997953.
DR   EuropePMC; PMC1855723; 17189369.
DR   EuropePMC; PMC1855853; 17293425.
DR   EuropePMC; PMC1913320; 17369305.
DR   EuropePMC; PMC2168950; 17905995.
DR   EuropePMC; PMC2655515; 19151139.
DR   EuropePMC; PMC3169522; 21931562.
DR   EuropePMC; PMC3256650; 22037403.
DR   EuropePMC; PMC3408162; 22661709.
DR   EuropePMC; PMC3531105; 23104377.
DR   EuropePMC; PMC4184826; 25280065.
DR   EuropePMC; PMC4784028; 26773087.
DR   EuropePMC; PMC5030687; 27046334.
DR   EuropePMC; PMC5288833; 27986719.
DR   EuropePMC; PMC5857379; 29345219.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01336; CRISPR-DR23.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01812; Pxr.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000113.
DR   SILVA-SSU; CP000113.
FH   Key             Location/Qualifiers
FT   source          1..9139763
FT                   /organism="Myxococcus xanthus DK 1622"
FT                   /strain="DK 1622"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:246197"
FT   gene            87..1439
FT                   /gene="dnaA"
FT                   /locus_tag="MXAN_0001"
FT   CDS_pept        87..1439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MXAN_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90646"
FT                   /db_xref="GOA:Q1DGD6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD6"
FT                   /protein_id="ABF90646.1"
FT   gene            1519..3420
FT                   /locus_tag="MXAN_0002"
FT   CDS_pept        1519..3420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93122"
FT                   /db_xref="InterPro:IPR011030"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD5"
FT                   /protein_id="ABF93122.1"
FT   gene            complement(3553..3990)
FT                   /locus_tag="MXAN_0003"
FT   CDS_pept        complement(3553..3990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0003"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86638"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD4"
FT                   /protein_id="ABF86638.1"
FT   gene            complement(4009..4620)
FT                   /locus_tag="MXAN_0004"
FT   CDS_pept        complement(4009..4620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91172"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD3"
FT                   /protein_id="ABF91172.1"
FT   gene            complement(4634..5485)
FT                   /locus_tag="MXAN_0005"
FT   CDS_pept        complement(4634..5485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0005"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91414"
FT                   /db_xref="GOA:Q1DGD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD2"
FT                   /protein_id="ABF91414.1"
FT                   VD"
FT   gene            5500..8561
FT                   /pseudo
FT                   /locus_tag="MXAN_0006"
FT                   /note="peptidase, M16 (pitrilysin) family, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            complement(8667..8975)
FT                   /locus_tag="MXAN_0008"
FT   CDS_pept        complement(8667..8975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD1"
FT                   /protein_id="ABF86679.1"
FT   gene            complement(9261..10496)
FT                   /locus_tag="MXAN_0009"
FT   CDS_pept        complement(9261..10496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0009"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86434"
FT                   /db_xref="GOA:Q1DGD0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD0"
FT                   /protein_id="ABF86434.1"
FT                   LLRPQRFDGAVA"
FT   gene            complement(10660..12276)
FT                   /locus_tag="MXAN_0010"
FT   CDS_pept        complement(10660..12276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0010"
FT                   /product="CapA family protein"
FT                   /note="identified by similarity to SP:P19579"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88172"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC9"
FT                   /protein_id="ABF88172.1"
FT   gene            complement(12409..12978)
FT                   /locus_tag="MXAN_0012"
FT   CDS_pept        complement(12409..12978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0012"
FT                   /product="DoxD-like family protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92697"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC8"
FT                   /protein_id="ABF92697.1"
FT   gene            13054..14049
FT                   /locus_tag="MXAN_0013"
FT   CDS_pept        13054..14049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86971"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC7"
FT                   /protein_id="ABF86971.1"
FT   gene            complement(14066..14845)
FT                   /locus_tag="MXAN_0014"
FT   CDS_pept        complement(14066..14845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87511"
FT                   /db_xref="GOA:Q1DGC6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC6"
FT                   /protein_id="ABF87511.1"
FT   gene            15080..16390
FT                   /locus_tag="MXAN_0015"
FT   CDS_pept        15080..16390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07804;
FT                   match to protein family HMM PF07805"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92663"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC5"
FT                   /protein_id="ABF92663.1"
FT   gene            complement(16412..18307)
FT                   /locus_tag="MXAN_0016"
FT   CDS_pept        complement(16412..18307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0016"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="identified by match to protein family HMM TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86069"
FT                   /db_xref="GOA:Q1DGC4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC4"
FT                   /protein_id="ABF86069.1"
FT   gene            complement(18526..19494)
FT                   /gene="gshB"
FT                   /locus_tag="MXAN_0017"
FT   CDS_pept        complement(18526..19494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="MXAN_0017"
FT                   /product="glutathione synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P04425; match to
FT                   protein family HMM PF02951"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90737"
FT                   /db_xref="GOA:Q1DGC3"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC3"
FT                   /protein_id="ABF90737.1"
FT   gene            complement(19574..21286)
FT                   /locus_tag="MXAN_0018"
FT   CDS_pept        complement(19574..21286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0018"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P54738; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90490"
FT                   /db_xref="GOA:Q1DGC2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC2"
FT                   /protein_id="ABF90490.1"
FT   gene            22471..24672
FT                   /locus_tag="MXAN_0019"
FT   CDS_pept        22471..24672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87696"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC1"
FT                   /protein_id="ABF87696.1"
FT   gene            complement(24666..25397)
FT                   /locus_tag="MXAN_0020"
FT   CDS_pept        complement(24666..25397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86164"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC0"
FT                   /protein_id="ABF86164.1"
FT   gene            complement(25822..27387)
FT                   /locus_tag="MXAN_0021"
FT   CDS_pept        complement(25822..27387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89030"
FT                   /db_xref="GOA:Q1DGB9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB9"
FT                   /protein_id="ABF89030.1"
FT                   TQQP"
FT   gene            complement(27440..28207)
FT                   /locus_tag="MXAN_0022"
FT   CDS_pept        complement(27440..28207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0022"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90975"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB8"
FT                   /protein_id="ABF90975.1"
FT   gene            complement(28264..31071)
FT                   /gene="pkn13"
FT                   /locus_tag="MXAN_0023"
FT   CDS_pept        complement(28264..31071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn13"
FT                   /locus_tag="MXAN_0023"
FT                   /product="serine/threonine kinase PKN13"
FT                   /note="identified by similarity to SP:P54738; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92033"
FT                   /db_xref="GOA:Q1DGB7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB7"
FT                   /protein_id="ABF92033.1"
FT                   LLSDP"
FT   gene            31391..33286
FT                   /locus_tag="MXAN_0024"
FT   CDS_pept        31391..33286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0024"
FT                   /product="3'-5' exoribonuclease, VacB/RNase II family"
FT                   /note="identified by match to protein family HMM PF00773;
FT                   match to protein family HMM PF08206; match to protein
FT                   family HMM TIGR00358"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89465"
FT                   /db_xref="GOA:Q1DGB6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB6"
FT                   /protein_id="ABF89465.1"
FT   gene            33255..33941
FT                   /locus_tag="MXAN_0025"
FT   CDS_pept        33255..33941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB5"
FT                   /protein_id="ABF89578.1"
FT                   VTDVGD"
FT   gene            33951..34370
FT                   /locus_tag="MXAN_0026"
FT   CDS_pept        33951..34370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB4"
FT                   /protein_id="ABF87179.1"
FT   gene            complement(34381..35274)
FT                   /locus_tag="MXAN_0027"
FT   CDS_pept        complement(34381..35274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86134"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB3"
FT                   /protein_id="ABF86134.1"
FT                   TAKDLTWKTDGLPIAG"
FT   gene            complement(35219..35986)
FT                   /locus_tag="MXAN_0028"
FT   CDS_pept        complement(35219..35986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0028"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92882"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB2"
FT                   /protein_id="ABF92882.1"
FT   gene            35989..38070
FT                   /locus_tag="MXAN_0029"
FT   CDS_pept        35989..38070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88713"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB1"
FT                   /protein_id="ABF88713.1"
FT   gene            complement(38087..39049)
FT                   /locus_tag="MXAN_0030"
FT   CDS_pept        complement(38087..39049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE10517.1; match to
FT                   protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91152"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB0"
FT                   /protein_id="ABF91152.1"
FT   gene            39368..39937
FT                   /locus_tag="MXAN_0031"
FT   CDS_pept        39368..39937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0031"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA9"
FT                   /protein_id="ABF88733.1"
FT   gene            39934..40524
FT                   /locus_tag="MXAN_0032"
FT   CDS_pept        39934..40524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86291"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA8"
FT                   /protein_id="ABF86291.1"
FT   gene            40722..41213
FT                   /locus_tag="MXAN_0033"
FT   CDS_pept        40722..41213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87042"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA7"
FT                   /protein_id="ABF87042.1"
FT                   "
FT   gene            complement(41220..41990)
FT                   /locus_tag="MXAN_0034"
FT   CDS_pept        complement(41220..41990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0034"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by match to protein family HMM PF00702"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89271"
FT                   /db_xref="GOA:Q1DGA6"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA6"
FT                   /protein_id="ABF89271.1"
FT   gene            complement(42049..43059)
FT                   /locus_tag="MXAN_0035"
FT   CDS_pept        complement(42049..43059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0035"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR01728"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88636"
FT                   /db_xref="GOA:Q1DGA5"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA5"
FT                   /protein_id="ABF88636.1"
FT   gene            complement(43139..43900)
FT                   /locus_tag="MXAN_0036"
FT   CDS_pept        complement(43139..43900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0036"
FT                   /product="putative aliphatic sulfonates ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to PIR:B96913; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89477"
FT                   /db_xref="GOA:Q1DGA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA4"
FT                   /protein_id="ABF89477.1"
FT   gene            complement(43910..44689)
FT                   /locus_tag="MXAN_0037"
FT   CDS_pept        complement(43910..44689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0037"
FT                   /product="putative aliphatic sulfonates ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to GB:BAD39859.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90578"
FT                   /db_xref="GOA:Q1DGA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA3"
FT                   /protein_id="ABF90578.1"
FT   gene            44867..45361
FT                   /locus_tag="MXAN_0038"
FT   CDS_pept        44867..45361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87699"
FT                   /db_xref="GOA:Q1DGA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA2"
FT                   /protein_id="ABF87699.1"
FT                   G"
FT   gene            complement(45388..46008)
FT                   /locus_tag="MXAN_0039"
FT   CDS_pept        complement(45388..46008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92651"
FT                   /db_xref="GOA:Q1DGA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA1"
FT                   /protein_id="ABF92651.1"
FT   gene            46167..47252
FT                   /locus_tag="MXAN_0040"
FT   CDS_pept        46167..47252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0040"
FT                   /product="putative glucose 1-dehydrogenase"
FT                   /note="identified by similarity to GB:CAC42505.1; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89793"
FT                   /db_xref="GOA:Q1DGA0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA0"
FT                   /protein_id="ABF89793.1"
FT   gene            47274..49139
FT                   /locus_tag="MXAN_0041"
FT   CDS_pept        47274..49139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0041"
FT                   /product="glycosyl hydrolase, family 15"
FT                   /note="identified by match to protein family HMM PF00723"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91930"
FT                   /db_xref="GOA:Q1DG99"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG99"
FT                   /protein_id="ABF91930.1"
FT   gene            complement(49156..51831)
FT                   /locus_tag="MXAN_0042"
FT   CDS_pept        complement(49156..51831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86870"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG98"
FT                   /protein_id="ABF86870.1"
FT   gene            complement(51872..53212)
FT                   /locus_tag="MXAN_0043"
FT   CDS_pept        complement(51872..53212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02270"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86677"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG97"
FT                   /protein_id="ABF86677.1"
FT   gene            complement(53209..53673)
FT                   /locus_tag="MXAN_0044"
FT   CDS_pept        complement(53209..53673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR36573.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89886"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG96"
FT                   /protein_id="ABF89886.1"
FT   gene            53785..54915
FT                   /locus_tag="MXAN_0045"
FT   CDS_pept        53785..54915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0045"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00109"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89850"
FT                   /db_xref="GOA:Q1DG95"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG95"
FT                   /protein_id="ABF89850.1"
FT   gene            complement(54872..55510)
FT                   /locus_tag="MXAN_0046"
FT   CDS_pept        complement(54872..55510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88597"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG94"
FT                   /protein_id="ABF88597.1"
FT   gene            complement(55489..56160)
FT                   /locus_tag="MXAN_0047"
FT   CDS_pept        complement(55489..56160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88834"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG93"
FT                   /protein_id="ABF88834.1"
FT                   L"
FT   gene            complement(56126..56482)
FT                   /locus_tag="MXAN_0048"
FT   CDS_pept        complement(56126..56482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85984"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG92"
FT                   /protein_id="ABF85984.1"
FT                   LRWLEEDGEVDEES"
FT   gene            complement(56489..57073)
FT                   /locus_tag="MXAN_0049"
FT   CDS_pept        complement(56489..57073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86786"
FT                   /db_xref="PDB:6A4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG91"
FT                   /protein_id="ABF86786.1"
FT   gene            complement(57099..57983)
FT                   /locus_tag="MXAN_0050"
FT   CDS_pept        complement(57099..57983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93012"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG90"
FT                   /protein_id="ABF93012.1"
FT                   KKAKSRYEWGSLY"
FT   gene            58046..58831
FT                   /locus_tag="MXAN_0051"
FT   CDS_pept        58046..58831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86022"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG89"
FT                   /protein_id="ABF86022.1"
FT   gene            complement(58837..59880)
FT                   /locus_tag="MXAN_0052"
FT   CDS_pept        complement(58837..59880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR36577.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92174"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG88"
FT                   /protein_id="ABF92174.1"
FT                   GQPVGTD"
FT   gene            59886..60509
FT                   /locus_tag="MXAN_0053"
FT   CDS_pept        59886..60509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90175"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG87"
FT                   /protein_id="ABF90175.1"
FT   gene            complement(60556..60996)
FT                   /locus_tag="MXAN_0054"
FT   CDS_pept        complement(60556..60996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91155"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG86"
FT                   /protein_id="ABF91155.1"
FT   gene            61027..62271
FT                   /locus_tag="MXAN_0055"
FT   CDS_pept        61027..62271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92796"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG85"
FT                   /protein_id="ABF92796.1"
FT                   EVREVEAHRREDAAR"
FT   gene            complement(62304..64466)
FT                   /gene="ppk"
FT                   /locus_tag="MXAN_0056"
FT   CDS_pept        complement(62304..64466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="MXAN_0056"
FT                   /product="polyphosphate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q9S646; match to
FT                   protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87163"
FT                   /db_xref="GOA:Q1DG84"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG84"
FT                   /protein_id="ABF87163.1"
FT   gene            64622..65146
FT                   /locus_tag="MXAN_0057"
FT   CDS_pept        64622..65146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0057"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88496"
FT                   /db_xref="GOA:Q1DG83"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG83"
FT                   /protein_id="ABF88496.1"
FT                   ADAAPVPAQEG"
FT   gene            65246..65800
FT                   /locus_tag="MXAN_0058"
FT   CDS_pept        65246..65800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG82"
FT                   /protein_id="ABF89425.1"
FT   gene            complement(65872..68061)
FT                   /locus_tag="MXAN_0059"
FT   CDS_pept        complement(65872..68061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0059"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG81"
FT                   /protein_id="ABF91046.1"
FT   gene            68306..70582
FT                   /locus_tag="MXAN_0060"
FT   CDS_pept        68306..70582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0060"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01590; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91721"
FT                   /db_xref="GOA:Q1DG80"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG80"
FT                   /protein_id="ABF91721.1"
FT                   IPLHS"
FT   gene            complement(70592..71488)
FT                   /locus_tag="MXAN_0061"
FT   CDS_pept        complement(70592..71488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0061"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87364"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG79"
FT                   /protein_id="ABF87364.1"
FT                   ERSPLRTFVDTRPPLHA"
FT   gene            complement(71629..71988)
FT                   /locus_tag="MXAN_0062"
FT   CDS_pept        complement(71629..71988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86884"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG78"
FT                   /protein_id="ABF86884.1"
FT                   GNVREERTAEHLQQL"
FT   gene            complement(72317..73297)
FT                   /locus_tag="MXAN_0063"
FT   CDS_pept        complement(72317..73297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89589"
FT                   /db_xref="GOA:Q1DG77"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR011752"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG77"
FT                   /protein_id="ABF89589.1"
FT   gene            complement(73389..74741)
FT                   /locus_tag="MXAN_0064"
FT   CDS_pept        complement(73389..74741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0064"
FT                   /product="conserved hypothetical protein, UPF0027 family"
FT                   /note="identified by match to protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85892"
FT                   /db_xref="GOA:Q1DG76"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG76"
FT                   /protein_id="ABF85892.1"
FT   gene            complement(74587..76128)
FT                   /locus_tag="MXAN_0067"
FT   CDS_pept        complement(74587..76128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92472"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG75"
FT                   /protein_id="ABF92472.1"
FT   gene            75019..75351
FT                   /locus_tag="MXAN_0065"
FT   CDS_pept        75019..75351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG74"
FT                   /protein_id="ABF87454.1"
FT                   SKSVSM"
FT   gene            complement(75119..75514)
FT                   /locus_tag="MXAN_0066"
FT   CDS_pept        complement(75119..75514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89122"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG73"
FT                   /protein_id="ABF89122.1"
FT   gene            75585..76625
FT                   /locus_tag="MXAN_0068"
FT   CDS_pept        75585..76625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0068"
FT                   /product="putative DNA-binding regulatory protein"
FT                   /note="identified by match to protein family HMM TIGR02233;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91919"
FT                   /db_xref="GOA:Q1DG72"
FT                   /db_xref="InterPro:IPR011745"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG72"
FT                   /protein_id="ABF91919.1"
FT                   SSPGAS"
FT   gene            complement(76505..77938)
FT                   /locus_tag="MXAN_0069"
FT   CDS_pept        complement(76505..77938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0069"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GB:AAS80587.1; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91381"
FT                   /db_xref="GOA:Q1DG71"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG71"
FT                   /protein_id="ABF91381.1"
FT   gene            78128..79564
FT                   /locus_tag="MXAN_0070"
FT   CDS_pept        78128..79564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0070"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92448"
FT                   /db_xref="GOA:Q1DG70"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG70"
FT                   /protein_id="ABF92448.1"
FT   gene            complement(79567..80331)
FT                   /locus_tag="MXAN_0071"
FT   CDS_pept        complement(79567..80331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86180"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG69"
FT                   /protein_id="ABF86180.1"
FT   gene            complement(80456..80920)
FT                   /locus_tag="MXAN_0072"
FT   CDS_pept        complement(80456..80920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0072"
FT                   /product="thioesterase family domain protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89765"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG68"
FT                   /protein_id="ABF89765.1"
FT   gene            complement(80917..81369)
FT                   /locus_tag="MXAN_0073"
FT   CDS_pept        complement(80917..81369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0073"
FT                   /product="thioesterase family domain protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87294"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG67"
FT                   /protein_id="ABF87294.1"
FT   gene            complement(81438..82439)
FT                   /locus_tag="MXAN_0074"
FT   CDS_pept        complement(81438..82439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89372"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG66"
FT                   /protein_id="ABF89372.1"
FT   gene            82834..86007
FT                   /locus_tag="MXAN_0075"
FT   CDS_pept        82834..86007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0075"
FT                   /product="WD40-like repeat/amidohydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07676; match to protein
FT                   family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92182"
FT                   /db_xref="GOA:Q1DG65"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG65"
FT                   /protein_id="ABF92182.1"
FT                   EHTHTHACD"
FT   gene            86056..86520
FT                   /locus_tag="MXAN_0076"
FT   CDS_pept        86056..86520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0076"
FT                   /product="Appr-1-p processing enzyme family domain protein"
FT                   /note="identified by match to protein family HMM PF01661"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93018"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG64"
FT                   /protein_id="ABF93018.1"
FT   gene            86696..87862
FT                   /locus_tag="MXAN_0077"
FT   CDS_pept        86696..87862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87038"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG63"
FT                   /protein_id="ABF87038.1"
FT   gene            complement(87914..88792)
FT                   /locus_tag="MXAN_0078"
FT   CDS_pept        complement(87914..88792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0078"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91415"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG62"
FT                   /protein_id="ABF91415.1"
FT                   APRILGGESKE"
FT   gene            complement(88836..89504)
FT                   /locus_tag="MXAN_0079"
FT   CDS_pept        complement(88836..89504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0079"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90617"
FT                   /db_xref="GOA:Q1DG61"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG61"
FT                   /protein_id="ABF90617.1"
FT                   "
FT   gene            89549..91279
FT                   /locus_tag="MXAN_0080"
FT   CDS_pept        89549..91279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07287"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91640"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG60"
FT                   /protein_id="ABF91640.1"
FT                   "
FT   gene            91284..92900
FT                   /gene="accB"
FT                   /locus_tag="MXAN_0081"
FT   CDS_pept        91284..92900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="MXAN_0081"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase"
FT                   /note="identified by similarity to GB:BAB16296.1; match to
FT                   protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85865"
FT                   /db_xref="GOA:Q1DG59"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG59"
FT                   /protein_id="ABF85865.1"
FT   gene            92915..94909
FT                   /gene="accC"
FT                   /locus_tag="MXAN_0082"
FT   CDS_pept        92915..94909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="MXAN_0082"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02785; match to protein family HMM PF02786;
FT                   match to protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88267"
FT                   /db_xref="GOA:Q1DG58"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG58"
FT                   /protein_id="ABF88267.1"
FT   gene            95005..96057
FT                   /locus_tag="MXAN_0083"
FT   CDS_pept        95005..96057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88858"
FT                   /db_xref="GOA:Q1DG57"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG57"
FT                   /protein_id="ABF88858.1"
FT                   AVASGLLVRP"
FT   gene            96070..96987
FT                   /locus_tag="MXAN_0084"
FT   CDS_pept        96070..96987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90165"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG56"
FT                   /protein_id="ABF90165.1"
FT   gene            96996..97583
FT                   /locus_tag="MXAN_0085"
FT   CDS_pept        96996..97583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90992"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG55"
FT                   /protein_id="ABF90992.1"
FT   gene            97598..98335
FT                   /locus_tag="MXAN_0086"
FT   CDS_pept        97598..98335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91490"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG54"
FT                   /protein_id="ABF91490.1"
FT   gene            complement(98351..99553)
FT                   /locus_tag="MXAN_0087"
FT   CDS_pept        complement(98351..99553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0087"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90296"
FT                   /db_xref="GOA:Q1DG53"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG53"
FT                   /protein_id="ABF90296.1"
FT                   A"
FT   gene            99616..100686
FT                   /locus_tag="MXAN_0088"
FT   CDS_pept        99616..100686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0088"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88620"
FT                   /db_xref="GOA:Q1DG52"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG52"
FT                   /protein_id="ABF88620.1"
FT                   APTALPEETPRGPLPR"
FT   gene            100774..101418
FT                   /locus_tag="MXAN_0089"
FT   CDS_pept        100774..101418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0089"
FT                   /product="glutathione S-transferase domain protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88395"
FT                   /db_xref="GOA:Q1DG51"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG51"
FT                   /protein_id="ABF88395.1"
FT   gene            101508..102089
FT                   /locus_tag="MXAN_0090"
FT   CDS_pept        101508..102089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0090"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87302"
FT                   /db_xref="GOA:Q1DG50"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG50"
FT                   /protein_id="ABF87302.1"
FT   gene            102329..103465
FT                   /locus_tag="MXAN_0091"
FT   CDS_pept        102329..103465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0091"
FT                   /product="efflux transporter, HAE1 family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92664"
FT                   /db_xref="GOA:Q1DG49"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG49"
FT                   /protein_id="ABF92664.1"
FT   gene            103480..106620
FT                   /locus_tag="MXAN_0092"
FT   CDS_pept        103480..106620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0092"
FT                   /product="efflux transporter, HAE1 family, inner membrane
FT                   component"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91617"
FT                   /db_xref="GOA:Q1DG48"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG48"
FT                   /protein_id="ABF91617.1"
FT   gene            complement(106672..107040)
FT                   /locus_tag="MXAN_0093"
FT   CDS_pept        complement(106672..107040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:B75015; match to
FT                   protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90324"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG47"
FT                   /protein_id="ABF90324.1"
FT                   ITMLGGRLLPQDSAQRRS"
FT   gene            complement(107033..108109)
FT                   /locus_tag="MXAN_0094"
FT   CDS_pept        complement(107033..108109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0094"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92802"
FT                   /db_xref="GOA:Q1DG46"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG46"
FT                   /protein_id="ABF92802.1"
FT                   LRARGDIQPYGYRESLYE"
FT   gene            complement(108152..110458)
FT                   /locus_tag="MXAN_0095"
FT   CDS_pept        complement(108152..110458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0095"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88787"
FT                   /db_xref="GOA:Q1DG45"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG45"
FT                   /protein_id="ABF88787.1"
FT                   HQGLGQLLGASRGSE"
FT   gene            complement(110594..111340)
FT                   /locus_tag="MXAN_0096"
FT   CDS_pept        complement(110594..111340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO78078.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87776"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG44"
FT                   /protein_id="ABF87776.1"
FT   gene            complement(111354..112583)
FT                   /locus_tag="MXAN_0097"
FT   CDS_pept        complement(111354..112583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0097"
FT                   /product="HipA-like protein"
FT                   /note="identified by similarity to SP:P23874; match to
FT                   protein family HMM PF07804; match to protein family HMM
FT                   PF07805"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90242"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG43"
FT                   /protein_id="ABF90242.1"
FT                   WKRVPLLQGQ"
FT   gene            complement(112585..114258)
FT                   /locus_tag="MXAN_0098"
FT   CDS_pept        complement(112585..114258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP07931.1; match to
FT                   protein family HMM PF03235"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91082"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG42"
FT                   /protein_id="ABF91082.1"
FT   gene            114381..114485
FT                   /locus_tag="MXAN_0099"
FT   CDS_pept        114381..114485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG41"
FT                   /protein_id="ABF92039.1"
FT   gene            114710..116215
FT                   /locus_tag="MXAN_0100"
FT   CDS_pept        114710..116215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0100"
FT                   /product="peptidase, M28D (aminopeptidase ES-62) subfamily"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by similarity to GB:AAC28365.1;
FT                   similarity to GB:AAD31418.1; match to protein family HMM
FT                   PF01546; match to protein family HMM PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91586"
FT                   /db_xref="GOA:Q1DG40"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG40"
FT                   /protein_id="ABF91586.1"
FT   gene            116347..117471
FT                   /locus_tag="MXAN_0101"
FT   CDS_pept        116347..117471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG39"
FT                   /protein_id="ABF90511.1"
FT   gene            117468..118238
FT                   /locus_tag="MXAN_0102"
FT   CDS_pept        117468..118238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG38"
FT                   /protein_id="ABF89119.1"
FT   gene            118283..118753
FT                   /locus_tag="MXAN_0103"
FT   CDS_pept        118283..118753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG37"
FT                   /protein_id="ABF88349.1"
FT   gene            complement(118762..119688)
FT                   /locus_tag="MXAN_0104"
FT   CDS_pept        complement(118762..119688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0104"
FT                   /product="aminoglycoside phosphotransferase family protein"
FT                   /note="identified by similarity to GB:AAC14693.1; match to
FT                   protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88549"
FT                   /db_xref="GOA:Q1DG36"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG36"
FT                   /protein_id="ABF88549.1"
FT   gene            complement(119698..121449)
FT                   /locus_tag="MXAN_0105"
FT   CDS_pept        complement(119698..121449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0105"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92428"
FT                   /db_xref="GOA:Q1DG35"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG35"
FT                   /protein_id="ABF92428.1"
FT                   RASAPEQ"
FT   gene            121721..123724
FT                   /locus_tag="MXAN_0106"
FT   CDS_pept        121721..123724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0106"
FT                   /product="FG-GAP repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01839"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92646"
FT                   /db_xref="GOA:Q1DG34"
FT                   /db_xref="InterPro:IPR001695"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG34"
FT                   /protein_id="ABF92646.1"
FT   gene            124014..125240
FT                   /locus_tag="MXAN_0107"
FT   CDS_pept        124014..125240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0107"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91382"
FT                   /db_xref="GOA:Q1DG33"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG33"
FT                   /protein_id="ABF91382.1"
FT                   DPVEALRHE"
FT   gene            125263..126480
FT                   /locus_tag="MXAN_0108"
FT   CDS_pept        125263..126480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0108"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90302"
FT                   /db_xref="GOA:Q1DG32"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG32"
FT                   /protein_id="ABF90302.1"
FT                   EAMRTD"
FT   gene            complement(126904..127737)
FT                   /locus_tag="MXAN_0109"
FT   CDS_pept        complement(126904..127737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88612"
FT                   /db_xref="GOA:Q1DG31"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG31"
FT                   /protein_id="ABF88612.1"
FT   gene            127779..129026
FT                   /gene="cls"
FT                   /locus_tag="MXAN_0110"
FT   CDS_pept        127779..129026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="MXAN_0110"
FT                   /product="cardiolipin synthase"
FT                   /note="identified by similarity to SP:P31071; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86832"
FT                   /db_xref="GOA:Q1DG30"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG30"
FT                   /protein_id="ABF86832.1"
FT                   LQKLGERLPWFIGSFL"
FT   gene            129078..130409
FT                   /locus_tag="MXAN_0111"
FT   CDS_pept        129078..130409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88401"
FT                   /db_xref="GOA:Q1DG29"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG29"
FT                   /protein_id="ABF88401.1"
FT   gene            130502..131032
FT                   /locus_tag="MXAN_0112"
FT   CDS_pept        130502..131032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0112"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86038"
FT                   /db_xref="GOA:Q1DG28"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG28"
FT                   /protein_id="ABF86038.1"
FT                   VFLEGYVLRFKKD"
FT   gene            complement(131035..132717)
FT                   /locus_tag="MXAN_0113"
FT   CDS_pept        complement(131035..132717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89797"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG27"
FT                   /protein_id="ABF89797.1"
FT   gene            132926..134035
FT                   /locus_tag="MXAN_0114"
FT   CDS_pept        132926..134035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0114"
FT                   /product="transglycosylase SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86219"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG26"
FT                   /protein_id="ABF86219.1"
FT   gene            complement(134069..134875)
FT                   /locus_tag="MXAN_0115"
FT   CDS_pept        complement(134069..134875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92726"
FT                   /db_xref="InterPro:IPR022118"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG25"
FT                   /protein_id="ABF92726.1"
FT   gene            complement(134929..136269)
FT                   /locus_tag="MXAN_0116"
FT   CDS_pept        complement(134929..136269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0116"
FT                   /product="sigma-54 dependent transcriptional regulator, Fis
FT                   family"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF00498; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87993"
FT                   /db_xref="GOA:Q1DG24"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG24"
FT                   /protein_id="ABF87993.1"
FT   gene            complement(136328..139102)
FT                   /locus_tag="MXAN_0117"
FT   CDS_pept        complement(136328..139102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0117"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P33973; match to
FT                   protein family HMM PF00069; match to protein family HMM
FT                   PF00515; match to protein family HMM PF07719; match to
FT                   protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90109"
FT                   /db_xref="GOA:Q1DG23"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG23"
FT                   /protein_id="ABF90109.1"
FT   gene            complement(139252..139824)
FT                   /locus_tag="MXAN_0118"
FT   CDS_pept        complement(139252..139824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88992"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG22"
FT                   /protein_id="ABF88992.1"
FT   gene            complement(139837..141180)
FT                   /locus_tag="MXAN_0119"
FT   CDS_pept        complement(139837..141180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0119"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89431"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG21"
FT                   /protein_id="ABF89431.1"
FT   gene            141430..141840
FT                   /locus_tag="MXAN_0120"
FT   CDS_pept        141430..141840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG20"
FT                   /protein_id="ABF85849.1"
FT   gene            142019..143503
FT                   /gene="mmsA"
FT                   /locus_tag="MXAN_0121"
FT   CDS_pept        142019..143503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="MXAN_0121"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91275"
FT                   /db_xref="GOA:Q1DG19"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG19"
FT                   /protein_id="ABF91275.1"
FT   gene            143467..144831
FT                   /locus_tag="MXAN_0122"
FT   CDS_pept        143467..144831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0122"
FT                   /product="putative GTP cyclohydrolase II"
FT                   /note="identified by similarity to SP:P17620; match to
FT                   protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92890"
FT                   /db_xref="GOA:Q1DG18"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG18"
FT                   /protein_id="ABF92890.1"
FT   gene            144824..146035
FT                   /locus_tag="MXAN_0123"
FT   CDS_pept        144824..146035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC52503.1; match to
FT                   protein family HMM PF07958"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89632"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG17"
FT                   /protein_id="ABF89632.1"
FT                   GTVF"
FT   gene            146048..146683
FT                   /gene="upp"
FT                   /locus_tag="MXAN_0124"
FT   CDS_pept        146048..146683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="MXAN_0124"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P50926; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86250"
FT                   /db_xref="GOA:Q1DG16"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DG16"
FT                   /protein_id="ABF86250.1"
FT   gene            146722..147303
FT                   /locus_tag="MXAN_0125"
FT   CDS_pept        146722..147303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92705"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG15"
FT                   /protein_id="ABF92705.1"
FT   gene            147385..148707
FT                   /locus_tag="MXAN_0126"
FT   CDS_pept        147385..148707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0126"
FT                   /product="CapA family protein"
FT                   /note="identified by similarity to SP:P19579"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90603"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG14"
FT                   /protein_id="ABF90603.1"
FT   gene            148704..148829
FT                   /locus_tag="MXAN_0127"
FT   CDS_pept        148704..148829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0127"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91672"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG13"
FT                   /protein_id="ABF91672.1"
FT   gene            148831..150870
FT                   /locus_tag="MXAN_0128"
FT   CDS_pept        148831..150870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0128"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92929"
FT                   /db_xref="InterPro:IPR021655"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG12"
FT                   /protein_id="ABF92929.1"
FT   gene            150949..151809
FT                   /locus_tag="MXAN_0129"
FT   CDS_pept        150949..151809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87432"
FT                   /db_xref="GOA:Q1DG11"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG11"
FT                   /protein_id="ABF87432.1"
FT                   QGGAR"
FT   gene            151806..153659
FT                   /locus_tag="MXAN_0130"
FT   CDS_pept        151806..153659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0130"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92599"
FT                   /db_xref="InterPro:IPR021655"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG10"
FT                   /protein_id="ABF92599.1"
FT   gene            complement(153663..154964)
FT                   /locus_tag="MXAN_0131"
FT   CDS_pept        complement(153663..154964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0131"
FT                   /product="chloride transporter, chloride channel (ClC)
FT                   family"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86382"
FT                   /db_xref="GOA:Q1DG09"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG09"
FT                   /protein_id="ABF86382.1"
FT   gene            155186..156238
FT                   /locus_tag="MXAN_0133"
FT   CDS_pept        155186..156238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91130"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG08"
FT                   /protein_id="ABF91130.1"
FT                   ESAKFNPARP"
FT   gene            complement(155197..155292)
FT                   /locus_tag="MXAN_0132"
FT   CDS_pept        complement(155197..155292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0132"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG07"
FT                   /protein_id="ABF90001.1"
FT                   /translation="MVHDVFWLRVLAIALPPTVKAAHMATTDIPL"
FT   gene            complement(156342..157364)
FT                   /locus_tag="MXAN_0134"
FT   CDS_pept        complement(156342..157364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92100"
FT                   /db_xref="GOA:Q1DG06"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG06"
FT                   /protein_id="ABF92100.1"
FT                   "
FT   gene            157340..157993
FT                   /locus_tag="MXAN_0135"
FT   CDS_pept        157340..157993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87680"
FT                   /db_xref="GOA:Q1DG05"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG05"
FT                   /protein_id="ABF87680.1"
FT   gene            157990..159615
FT                   /gene="lnt"
FT                   /locus_tag="MXAN_0136"
FT   CDS_pept        157990..159615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="MXAN_0136"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM TIGR00546"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90513"
FT                   /db_xref="GOA:Q1DG04"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG04"
FT                   /protein_id="ABF90513.1"
FT   gene            complement(159737..160612)
FT                   /locus_tag="MXAN_0137"
FT   CDS_pept        complement(159737..160612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85964"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG03"
FT                   /protein_id="ABF85964.1"
FT                   VRAMLGARLA"
FT   gene            complement(160655..162178)
FT                   /locus_tag="MXAN_0138"
FT   CDS_pept        complement(160655..162178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E98192; match to
FT                   protein family HMM PF00732; match to protein family HMM
FT                   PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93161"
FT                   /db_xref="GOA:Q1DG02"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG02"
FT                   /protein_id="ABF93161.1"
FT   gene            162330..163220
FT                   /locus_tag="MXAN_0139"
FT   CDS_pept        162330..163220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8ZN39"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90905"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG01"
FT                   /protein_id="ABF90905.1"
FT                   NAALLARGTSATDAR"
FT   gene            complement(163224..164681)
FT                   /locus_tag="MXAN_0140"
FT   CDS_pept        complement(163224..164681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0140"
FT                   /product="RNA-directed DNA polymerase domain protein"
FT                   /note="identified by match to protein family HMM PF00078"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87722"
FT                   /db_xref="GOA:Q1DG00"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG00"
FT                   /protein_id="ABF87722.1"
FT   gene            complement(165082..166935)
FT                   /locus_tag="MXAN_0141"
FT   CDS_pept        complement(165082..166935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0141"
FT                   /product="SWIM zinc finger domain protein"
FT                   /note="identified by match to protein family HMM PF04434"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86122"
FT                   /db_xref="GOA:Q1DFZ9"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ9"
FT                   /protein_id="ABF86122.1"
FT   gene            complement(166932..173471)
FT                   /locus_tag="MXAN_0142"
FT   CDS_pept        complement(166932..173471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0142"
FT                   /product="WD domain G-beta repeat/PBS lyase HEAT-like
FT                   repeat protein"
FT                   /note="identified by match to protein family HMM PF00400;
FT                   match to protein family HMM PF02985; match to protein
FT                   family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87134"
FT                   /db_xref="GOA:Q1DFZ8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ8"
FT                   /protein_id="ABF87134.1"
FT                   ARNRKEGNPS"
FT   gene            complement(173554..174441)
FT                   /locus_tag="MXAN_0143"
FT   CDS_pept        complement(173554..174441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0143"
FT                   /product="cupin family protein"
FT                   /note="identified by match to protein family HMM PF08007"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86248"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ7"
FT                   /protein_id="ABF86248.1"
FT                   RFYLRSTGIRGNGR"
FT   gene            complement(174457..177189)
FT                   /locus_tag="MXAN_0144"
FT   CDS_pept        complement(174457..177189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ6"
FT                   /protein_id="ABF86168.1"
FT   gene            complement(177208..178092)
FT                   /locus_tag="MXAN_0145"
FT   CDS_pept        complement(177208..178092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0145"
FT                   /product="scramblase family protein-like protein"
FT                   /note="identified by match to protein family HMM PF03803"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91625"
FT                   /db_xref="GOA:Q1DFZ5"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ5"
FT                   /protein_id="ABF91625.1"
FT                   GLDLFDALMFWKK"
FT   gene            complement(178112..181291)
FT                   /locus_tag="MXAN_0146"
FT   CDS_pept        complement(178112..181291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86669"
FT                   /db_xref="GOA:Q1DFZ4"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ4"
FT                   /protein_id="ABF86669.1"
FT                   RDVQVTPRPLP"
FT   gene            complement(181382..182230)
FT                   /locus_tag="MXAN_0147"
FT   CDS_pept        complement(181382..182230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0147"
FT                   /product="putative acetyltransferase"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92813"
FT                   /db_xref="GOA:Q1DFZ3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ3"
FT                   /protein_id="ABF92813.1"
FT                   A"
FT   gene            complement(182235..185459)
FT                   /locus_tag="MXAN_0148"
FT   CDS_pept        complement(182235..185459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM05750.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87684"
FT                   /db_xref="GOA:Q1DFZ2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ2"
FT                   /protein_id="ABF87684.1"
FT   gene            complement(185456..186709)
FT                   /locus_tag="MXAN_0149"
FT   CDS_pept        complement(185456..186709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0149"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90224"
FT                   /db_xref="GOA:Q1DFZ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ1"
FT                   /protein_id="ABF90224.1"
FT                   VVQAGLHGVESLHEEETS"
FT   gene            complement(186938..187396)
FT                   /locus_tag="MXAN_0150"
FT   CDS_pept        complement(186938..187396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0150"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:O06794"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90328"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ0"
FT                   /protein_id="ABF90328.1"
FT   gene            complement(187417..188298)
FT                   /locus_tag="MXAN_0151"
FT   CDS_pept        complement(187417..188298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0151"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91861"
FT                   /db_xref="GOA:Q1DFY9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY9"
FT                   /protein_id="ABF91861.1"
FT                   LEYGLLVLRRVD"
FT   gene            complement(188295..189032)
FT                   /locus_tag="MXAN_0152"
FT   CDS_pept        complement(188295..189032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89458"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY8"
FT                   /protein_id="ABF89458.1"
FT   gene            complement(189029..190387)
FT                   /locus_tag="MXAN_0153"
FT   CDS_pept        complement(189029..190387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0153"
FT                   /product="ATPase domain protein"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86249"
FT                   /db_xref="GOA:Q1DFY7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY7"
FT                   /protein_id="ABF86249.1"
FT   gene            complement(190384..190608)
FT                   /locus_tag="MXAN_0154"
FT   CDS_pept        complement(190384..190608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY6"
FT                   /protein_id="ABF91785.1"
FT   gene            190980..191867
FT                   /locus_tag="MXAN_0155"
FT   CDS_pept        190980..191867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0155"
FT                   /product="transporter, EamA family"
FT                   /note="identified by similarity to SP:P36545; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88367"
FT                   /db_xref="GOA:Q1DFY5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY5"
FT                   /protein_id="ABF88367.1"
FT                   SATSRKPVEAVAAS"
FT   gene            191845..192618
FT                   /locus_tag="MXAN_0156"
FT   CDS_pept        191845..192618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92352"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY4"
FT                   /protein_id="ABF92352.1"
FT   gene            complement(192619..193419)
FT                   /locus_tag="MXAN_0157"
FT   CDS_pept        complement(192619..193419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86524"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY3"
FT                   /protein_id="ABF86524.1"
FT   gene            193489..194274
FT                   /locus_tag="MXAN_0158"
FT   CDS_pept        193489..194274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0158"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87570"
FT                   /db_xref="GOA:Q1DFY2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY2"
FT                   /protein_id="ABF87570.1"
FT   gene            194300..194734
FT                   /locus_tag="MXAN_0159"
FT   CDS_pept        194300..194734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY1"
FT                   /protein_id="ABF89784.1"
FT   gene            complement(194842..195537)
FT                   /locus_tag="MXAN_0160"
FT   CDS_pept        complement(194842..195537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0160"
FT                   /product="oxidoreductase, molybdopterin-binding"
FT                   /note="identified by match to protein family HMM PF00174"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92835"
FT                   /db_xref="GOA:Q1DFY0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY0"
FT                   /protein_id="ABF92835.1"
FT                   RGYEWFAGV"
FT   gene            complement(195530..196189)
FT                   /locus_tag="MXAN_0161"
FT   CDS_pept        complement(195530..196189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO57075.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86553"
FT                   /db_xref="GOA:Q1DFX9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX9"
FT                   /protein_id="ABF86553.1"
FT   gene            196477..197580
FT                   /locus_tag="MXAN_0162"
FT   CDS_pept        196477..197580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN50873.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89475"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX8"
FT                   /protein_id="ABF89475.1"
FT   gene            197644..197778
FT                   /gene="kdpF"
FT                   /locus_tag="MXAN_0163"
FT   CDS_pept        197644..197778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpF"
FT                   /locus_tag="MXAN_0163"
FT                   /product="K+-transporting ATPase, F subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR02115"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88567"
FT                   /db_xref="GOA:Q1DFX7"
FT                   /db_xref="InterPro:IPR011726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX7"
FT                   /protein_id="ABF88567.1"
FT   gene            197788..199509
FT                   /gene="kdpA"
FT                   /locus_tag="MXAN_0164"
FT   CDS_pept        197788..199509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="MXAN_0164"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P03959; match to
FT                   protein family HMM PF03814; match to protein family HMM
FT                   TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90399"
FT                   /db_xref="GOA:Q1DFX6"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX6"
FT                   /protein_id="ABF90399.1"
FT   gene            199511..201571
FT                   /gene="kdpB"
FT                   /locus_tag="MXAN_0165"
FT   CDS_pept        199511..201571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="MXAN_0165"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to GB:AAB96336.1; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00702; match to protein family HMM TIGR01494; match to
FT                   protein family HMM TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92970"
FT                   /db_xref="GOA:Q1DFX5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX5"
FT                   /protein_id="ABF92970.1"
FT   gene            201586..202221
FT                   /gene="kdpC"
FT                   /locus_tag="MXAN_0166"
FT   CDS_pept        201586..202221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="MXAN_0166"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91913"
FT                   /db_xref="GOA:Q1DFX4"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFX4"
FT                   /protein_id="ABF91913.1"
FT   gene            202310..203479
FT                   /locus_tag="MXAN_0167"
FT   CDS_pept        202310..203479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0167"
FT                   /product="osmosensitive K+ channel His kinase sensor
FT                   domain/universal stress domain protein"
FT                   /note="identified by match to protein family HMM PF00582;
FT                   match to protein family HMM PF02702"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89157"
FT                   /db_xref="GOA:Q1DFX3"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX3"
FT                   /protein_id="ABF89157.1"
FT   gene            203476..205323
FT                   /locus_tag="MXAN_0168"
FT   CDS_pept        203476..205323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0168"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88089"
FT                   /db_xref="GOA:Q1DFX2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX2"
FT                   /protein_id="ABF88089.1"
FT   gene            205493..205831
FT                   /locus_tag="MXAN_0169"
FT   CDS_pept        205493..205831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91488"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX1"
FT                   /protein_id="ABF91488.1"
FT                   IVSVWRKS"
FT   gene            205828..206334
FT                   /locus_tag="MXAN_0170"
FT   CDS_pept        205828..206334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0170"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAO28816.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90667"
FT                   /db_xref="GOA:Q1DFX0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX0"
FT                   /protein_id="ABF90667.1"
FT                   LTAAC"
FT   gene            complement(206411..206995)
FT                   /locus_tag="MXAN_0171"
FT   CDS_pept        complement(206411..206995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0171"
FT                   /product="cation-binding protein, hemerythrin HHE family"
FT                   /note="identified by match to protein family HMM PF01814"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89881"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW9"
FT                   /protein_id="ABF89881.1"
FT   gene            complement(207019..208380)
FT                   /locus_tag="MXAN_0172"
FT   CDS_pept        complement(207019..208380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0172"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89084"
FT                   /db_xref="GOA:Q1DFW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW8"
FT                   /protein_id="ABF89084.1"
FT   gene            208434..208928
FT                   /locus_tag="MXAN_0173"
FT   CDS_pept        208434..208928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91938"
FT                   /db_xref="GOA:Q1DFW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW7"
FT                   /protein_id="ABF91938.1"
FT                   R"
FT   gene            209306..210898
FT                   /locus_tag="MXAN_0174"
FT   CDS_pept        209306..210898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0174"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to GB:AAM52211.1; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91199"
FT                   /db_xref="GOA:Q1DFW6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW6"
FT                   /protein_id="ABF91199.1"
FT                   LGQLHELSTGFRV"
FT   gene            complement(210960..212615)
FT                   /gene="fhs"
FT                   /locus_tag="MXAN_0175"
FT   CDS_pept        complement(210960..212615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="MXAN_0175"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q59925; match to
FT                   protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87836"
FT                   /db_xref="GOA:Q1DFW5"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFW5"
FT                   /protein_id="ABF87836.1"
FT   gene            213061..214989
FT                   /locus_tag="MXAN_0176"
FT   CDS_pept        213061..214989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0176"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92027"
FT                   /db_xref="GOA:Q1DFW4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW4"
FT                   /protein_id="ABF92027.1"
FT                   TVPLAST"
FT   gene            complement(214997..215878)
FT                   /locus_tag="MXAN_0177"
FT   CDS_pept        complement(214997..215878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0177"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86280"
FT                   /db_xref="GOA:Q1DFW3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW3"
FT                   /protein_id="ABF86280.1"
FT                   ARQRQAAQALPR"
FT   gene            complement(215875..216486)
FT                   /locus_tag="MXAN_0178"
FT   CDS_pept        complement(215875..216486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0178"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86915"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW2"
FT                   /protein_id="ABF86915.1"
FT   gene            complement(216504..217208)
FT                   /locus_tag="MXAN_0179"
FT   CDS_pept        complement(216504..217208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0179"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87384"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW1"
FT                   /protein_id="ABF87384.1"
FT                   CGHTPPSPSLQA"
FT   gene            complement(217450..218832)
FT                   /locus_tag="MXAN_0180"
FT   CDS_pept        complement(217450..218832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0180"
FT                   /product="sigma-54 dependent transcriptional regulator, Fis
FT                   family"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88905"
FT                   /db_xref="GOA:Q1DFW0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFW0"
FT                   /protein_id="ABF88905.1"
FT                   ER"
FT   gene            complement(218766..220097)
FT                   /locus_tag="MXAN_0181"
FT   CDS_pept        complement(218766..220097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89174"
FT                   /db_xref="GOA:Q1DFV9"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV9"
FT                   /protein_id="ABF89174.1"
FT   gene            complement(220189..222891)
FT                   /locus_tag="MXAN_0182"
FT   CDS_pept        complement(220189..222891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0182"
FT                   /product="asmA family protein"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86523"
FT                   /db_xref="GOA:Q1DFV8"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV8"
FT                   /protein_id="ABF86523.1"
FT   gene            complement(223256..223675)
FT                   /locus_tag="MXAN_0183"
FT   CDS_pept        complement(223256..223675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV7"
FT                   /protein_id="ABF90526.1"
FT   gene            complement(223688..224407)
FT                   /locus_tag="MXAN_0184"
FT   CDS_pept        complement(223688..224407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91521"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV6"
FT                   /protein_id="ABF91521.1"
FT                   KPSNKAAGIVTPVGGLD"
FT   gene            complement(224504..226126)
FT                   /locus_tag="MXAN_0185"
FT   CDS_pept        complement(224504..226126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0185"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90673"
FT                   /db_xref="InterPro:IPR030916"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV5"
FT                   /protein_id="ABF90673.1"
FT   gene            226126..228057
FT                   /locus_tag="MXAN_0186"
FT   CDS_pept        226126..228057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0186"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF05960"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89929"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV4"
FT                   /protein_id="ABF89929.1"
FT                   GDTAPSLE"
FT   gene            complement(228066..228584)
FT                   /pseudo
FT                   /locus_tag="MXAN_0187"
FT                   /note="fibril protein, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAB95228.1"
FT   gene            complement(228610..229587)
FT                   /locus_tag="MXAN_0188"
FT   CDS_pept        complement(228610..229587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV3"
FT                   /protein_id="ABF91498.1"
FT   gene            complement(229700..231832)
FT                   /locus_tag="MXAN_0189"
FT   CDS_pept        complement(229700..231832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87630"
FT                   /db_xref="GOA:Q1DFV2"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV2"
FT                   /protein_id="ABF87630.1"
FT                   GVDADFIRKMRGTGSK"
FT   gene            complement(231829..232260)
FT                   /locus_tag="MXAN_0190"
FT   CDS_pept        complement(231829..232260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD71733.1; match to
FT                   protein family HMM PF03965"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86806"
FT                   /db_xref="GOA:Q1DFV1"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV1"
FT                   /protein_id="ABF86806.1"
FT   gene            complement(232374..233132)
FT                   /locus_tag="MXAN_0191"
FT   CDS_pept        complement(232374..233132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0191"
FT                   /product="fatty acid hydroxylase"
FT                   /note="identified by match to protein family HMM PF04116"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89872"
FT                   /db_xref="GOA:Q1DFV0"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFV0"
FT                   /protein_id="ABF89872.1"
FT   gene            233488..233817
FT                   /locus_tag="MXAN_0192"
FT   CDS_pept        233488..233817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90794"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU9"
FT                   /protein_id="ABF90794.1"
FT                   SRKKK"
FT   gene            complement(233826..234929)
FT                   /locus_tag="MXAN_0193"
FT   CDS_pept        complement(233826..234929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89338"
FT                   /db_xref="GOA:Q1DFU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU8"
FT                   /protein_id="ABF89338.1"
FT   gene            complement(234948..236216)
FT                   /locus_tag="MXAN_0194"
FT   CDS_pept        complement(234948..236216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0194"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89436"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU7"
FT                   /protein_id="ABF89436.1"
FT   gene            complement(236498..239401)
FT                   /locus_tag="MXAN_0195"
FT   CDS_pept        complement(236498..239401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0195"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF01590;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90749"
FT                   /db_xref="GOA:Q1DFU6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU6"
FT                   /protein_id="ABF90749.1"
FT   gene            239406..241313
FT                   /locus_tag="MXAN_0196"
FT   CDS_pept        239406..241313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0196"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89736"
FT                   /db_xref="GOA:Q1DFU5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU5"
FT                   /protein_id="ABF89736.1"
FT                   "
FT   gene            complement(241318..243834)
FT                   /locus_tag="MXAN_0197"
FT   CDS_pept        complement(241318..243834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0197"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90162"
FT                   /db_xref="GOA:Q1DFU4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU4"
FT                   /protein_id="ABF90162.1"
FT   gene            complement(243905..244420)
FT                   /locus_tag="MXAN_0198"
FT   CDS_pept        complement(243905..244420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0198"
FT                   /product="GreA/GreB domain protein"
FT                   /note="identified by match to protein family HMM PF01272"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91602"
FT                   /db_xref="GOA:Q1DFU3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU3"
FT                   /protein_id="ABF91602.1"
FT                   EWTVLEVA"
FT   gene            244507..244788
FT                   /locus_tag="MXAN_0199"
FT   CDS_pept        244507..244788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0199"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92219"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU2"
FT                   /protein_id="ABF92219.1"
FT   gene            244803..245759
FT                   /locus_tag="MXAN_0200"
FT   CDS_pept        244803..245759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0200"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:CAD14704.1; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88094"
FT                   /db_xref="GOA:Q1DFU1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU1"
FT                   /protein_id="ABF88094.1"
FT   gene            complement(245784..246728)
FT                   /locus_tag="MXAN_0201"
FT   CDS_pept        complement(245784..246728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0201"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88697"
FT                   /db_xref="GOA:Q1DFU0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU0"
FT                   /protein_id="ABF88697.1"
FT   gene            247025..248320
FT                   /locus_tag="MXAN_0202"
FT   CDS_pept        247025..248320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0202"
FT                   /product="amine oxidase, flavin-containing"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86334"
FT                   /db_xref="GOA:Q1DFT9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT9"
FT                   /protein_id="ABF86334.1"
FT   gene            248324..249289
FT                   /locus_tag="MXAN_0203"
FT   CDS_pept        248324..249289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0203"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88408"
FT                   /db_xref="GOA:Q1DFT8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT8"
FT                   /protein_id="ABF88408.1"
FT   gene            complement(249306..249956)
FT                   /locus_tag="MXAN_0204"
FT   CDS_pept        complement(249306..249956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25443.1; match to
FT                   protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87762"
FT                   /db_xref="GOA:Q1DFT7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT7"
FT                   /protein_id="ABF87762.1"
FT   gene            complement(250000..250842)
FT                   /gene="lgt"
FT                   /locus_tag="MXAN_0205"
FT   CDS_pept        complement(250000..250842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="MXAN_0205"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by similarity to SP:O34752; match to
FT                   protein family HMM PF01790"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88766"
FT                   /db_xref="GOA:Q1DFT6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT6"
FT                   /protein_id="ABF88766.1"
FT   gene            251454..252881
FT                   /locus_tag="MXAN_0206"
FT   CDS_pept        251454..252881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0206"
FT                   /product="peptidase, S8A (subtilisin) subfamily"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89812"
FT                   /db_xref="GOA:Q1DFT5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT5"
FT                   /protein_id="ABF89812.1"
FT                   LPRSGTHKTGKGLAVFR"
FT   gene            252891..253361
FT                   /locus_tag="MXAN_0207"
FT   CDS_pept        252891..253361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90834"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT4"
FT                   /protein_id="ABF90834.1"
FT   gene            253657..254592
FT                   /locus_tag="MXAN_0208"
FT   CDS_pept        253657..254592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0208"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAH29861.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89553"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT3"
FT                   /protein_id="ABF89553.1"
FT   gene            complement(254674..255570)
FT                   /locus_tag="MXAN_0209"
FT   CDS_pept        complement(254674..255570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0209"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88772"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT2"
FT                   /protein_id="ABF88772.1"
FT                   DAGYVEQNGTCAPAPAP"
FT   gene            255625..258021
FT                   /locus_tag="MXAN_0210"
FT   CDS_pept        255625..258021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0210"
FT                   /product="transglycosylase SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91805"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT1"
FT                   /protein_id="ABF91805.1"
FT   gene            complement(258083..258829)
FT                   /locus_tag="MXAN_0211"
FT   CDS_pept        complement(258083..258829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0211"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92986"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT0"
FT                   /protein_id="ABF92986.1"
FT   gene            complement(258998..260218)
FT                   /locus_tag="MXAN_0212"
FT   CDS_pept        complement(258998..260218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0212"
FT                   /product="aminotransferase, class I and II family protein"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88889"
FT                   /db_xref="GOA:Q1DFS9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS9"
FT                   /protein_id="ABF88889.1"
FT                   VIAAELG"
FT   gene            complement(260222..260698)
FT                   /locus_tag="MXAN_0213"
FT   CDS_pept        complement(260222..260698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0213"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89470"
FT                   /db_xref="GOA:Q1DFS8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS8"
FT                   /protein_id="ABF89470.1"
FT   gene            261610..262353
FT                   /locus_tag="MXAN_0214"
FT   CDS_pept        261610..262353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0214"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88337"
FT                   /db_xref="GOA:Q1DFS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS7"
FT                   /protein_id="ABF88337.1"
FT   gene            262363..263358
FT                   /locus_tag="MXAN_0215"
FT   CDS_pept        262363..263358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0215"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92307"
FT                   /db_xref="GOA:Q1DFS6"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS6"
FT                   /protein_id="ABF92307.1"
FT   gene            263385..264944
FT                   /locus_tag="MXAN_0216"
FT   CDS_pept        263385..264944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0216"
FT                   /product="putative long-chain-fatty-acid-CoA ligase"
FT                   /note="identified by similarity to GB:AAK18166.1; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91731"
FT                   /db_xref="GOA:Q1DFS5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS5"
FT                   /protein_id="ABF91731.1"
FT                   RH"
FT   gene            264981..265670
FT                   /locus_tag="MXAN_0217"
FT   CDS_pept        264981..265670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0217"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87788"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS4"
FT                   /protein_id="ABF87788.1"
FT                   QRYTIGG"
FT   gene            complement(265667..267412)
FT                   /locus_tag="MXAN_0218"
FT   CDS_pept        complement(265667..267412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0218"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90402"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS3"
FT                   /protein_id="ABF90402.1"
FT                   QRDSH"
FT   gene            265715..267541
FT                   /locus_tag="MXAN_0219"
FT   CDS_pept        265715..267541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86577"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS2"
FT                   /protein_id="ABF86577.1"
FT   gene            267544..268734
FT                   /locus_tag="MXAN_0220"
FT   CDS_pept        267544..268734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0220"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90107"
FT                   /db_xref="GOA:Q1DFS1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS1"
FT                   /protein_id="ABF90107.1"
FT   gene            complement(268797..269801)
FT                   /locus_tag="MXAN_0221"
FT   CDS_pept        complement(268797..269801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0221"
FT                   /product="lipase"
FT                   /note="identified by match to protein family HMM PF01674"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86273"
FT                   /db_xref="GOA:Q1DFS0"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFS0"
FT                   /protein_id="ABF86273.1"
FT   gene            269920..270957
FT                   /locus_tag="MXAN_0222"
FT   CDS_pept        269920..270957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0222"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87627"
FT                   /db_xref="GOA:Q1DFR9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR9"
FT                   /protein_id="ABF87627.1"
FT                   LVLVP"
FT   gene            complement(270967..271611)
FT                   /locus_tag="MXAN_0223"
FT   CDS_pept        complement(270967..271611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92086"
FT                   /db_xref="GOA:Q1DFR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR8"
FT                   /protein_id="ABF92086.1"
FT   gene            complement(271678..273312)
FT                   /locus_tag="MXAN_0224"
FT   CDS_pept        complement(271678..273312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91520"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR7"
FT                   /protein_id="ABF91520.1"
FT   gene            273221..274738
FT                   /locus_tag="MXAN_0225"
FT   CDS_pept        273221..274738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0225"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /note="identified by similarity to GB:CAC18323.1; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92283"
FT                   /db_xref="GOA:Q1DFR6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR6"
FT                   /protein_id="ABF92283.1"
FT   gene            274970..275068
FT                   /locus_tag="MXAN_0226"
FT   CDS_pept        274970..275068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0226"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88888"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR5"
FT                   /protein_id="ABF88888.1"
FT                   /translation="MGLWLALARRIVDAHGGARCWSAGLAWGPPWE"
FT   gene            complement(275249..276910)
FT                   /locus_tag="MXAN_0227"
FT   CDS_pept        complement(275249..276910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0227"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to GB:AAR34357.1; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88952"
FT                   /db_xref="GOA:Q1DFR4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR4"
FT                   /protein_id="ABF88952.1"
FT   gene            277365..277733
FT                   /locus_tag="MXAN_0228"
FT   CDS_pept        277365..277733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0228"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85907"
FT                   /db_xref="GOA:Q1DFR3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR3"
FT                   /protein_id="ABF85907.1"
FT                   EPAKVKLLGLVANALNRR"
FT   gene            complement(277754..279280)
FT                   /locus_tag="MXAN_0229"
FT   CDS_pept        complement(277754..279280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0229"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88790"
FT                   /db_xref="GOA:Q1DFR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR2"
FT                   /protein_id="ABF88790.1"
FT   gene            complement(279273..280814)
FT                   /locus_tag="MXAN_0230"
FT   CDS_pept        complement(279273..280814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0230"
FT                   /product="putative sensor histidine kinase/response
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89054"
FT                   /db_xref="GOA:Q1DFR1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR1"
FT                   /protein_id="ABF89054.1"
FT   gene            complement(280811..281515)
FT                   /locus_tag="MXAN_0231"
FT   CDS_pept        complement(280811..281515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90993"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR0"
FT                   /protein_id="ABF90993.1"
FT                   SEAGVSWEETRS"
FT   gene            complement(281523..282185)
FT                   /locus_tag="MXAN_0232"
FT   CDS_pept        complement(281523..282185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0232"
FT                   /product="B12 binding domain protein"
FT                   /note="identified by match to protein family HMM PF02310"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90394"
FT                   /db_xref="GOA:Q1DFQ9"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ9"
FT                   /protein_id="ABF90394.1"
FT   gene            282421..282969
FT                   /locus_tag="MXAN_0233"
FT   CDS_pept        282421..282969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0233"
FT                   /product="RNA polymerase sigma-70 factor, group 3"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93029"
FT                   /db_xref="GOA:Q1DFQ8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ8"
FT                   /protein_id="ABF93029.1"
FT   gene            282966..284365
FT                   /pseudo
FT                   /locus_tag="MXAN_0234"
FT                   /note="actD protein, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAK38652.1"
FT   gene            complement(284387..284848)
FT                   /locus_tag="MXAN_0235"
FT   CDS_pept        complement(284387..284848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0235"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ7"
FT                   /protein_id="ABF87968.1"
FT   gene            285058..286164
FT                   /gene="dnaN"
FT                   /locus_tag="MXAN_0236"
FT   CDS_pept        285058..286164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MXAN_0236"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91036"
FT                   /db_xref="GOA:Q1DFQ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ6"
FT                   /protein_id="ABF91036.1"
FT   gene            286244..287587
FT                   /locus_tag="MXAN_0237"
FT   CDS_pept        286244..287587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0237"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90918"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ5"
FT                   /protein_id="ABF90918.1"
FT   gene            complement(287684..288958)
FT                   /locus_tag="MXAN_0238"
FT   CDS_pept        complement(287684..288958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0238"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87352"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ4"
FT                   /protein_id="ABF87352.1"
FT   gene            complement(288955..289587)
FT                   /locus_tag="MXAN_0239"
FT   CDS_pept        complement(288955..289587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G75575"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91116"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ3"
FT                   /protein_id="ABF91116.1"
FT   gene            288958..289803
FT                   /locus_tag="MXAN_0240"
FT   CDS_pept        288958..289803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90198"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ2"
FT                   /protein_id="ABF90198.1"
FT                   "
FT   gene            289671..290000
FT                   /locus_tag="MXAN_0241"
FT   CDS_pept        289671..290000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ1"
FT                   /protein_id="ABF90052.1"
FT                   IFGPR"
FT   gene            290144..290809
FT                   /locus_tag="MXAN_0242"
FT   CDS_pept        290144..290809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0242"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02269"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93118"
FT                   /db_xref="InterPro:IPR011755"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ0"
FT                   /protein_id="ABF93118.1"
FT   gene            290816..291538
FT                   /locus_tag="MXAN_0243"
FT   CDS_pept        290816..291538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89001"
FT                   /db_xref="InterPro:IPR011750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP9"
FT                   /protein_id="ABF89001.1"
FT                   AMRRLGLEGIACQELPTR"
FT   gene            complement(291528..292637)
FT                   /locus_tag="MXAN_0244"
FT   CDS_pept        complement(291528..292637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D69820"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87754"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP8"
FT                   /protein_id="ABF87754.1"
FT   gene            292680..294749
FT                   /locus_tag="MXAN_0245"
FT   CDS_pept        292680..294749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0245"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85863"
FT                   /db_xref="GOA:Q1DFP7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP7"
FT                   /protein_id="ABF85863.1"
FT   gene            294790..295932
FT                   /gene="recF"
FT                   /locus_tag="MXAN_0246"
FT   CDS_pept        294790..295932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="MXAN_0246"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P29232; match to
FT                   protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92338"
FT                   /db_xref="GOA:Q1DFP6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFP6"
FT                   /protein_id="ABF92338.1"
FT   gene            complement(295935..296564)
FT                   /locus_tag="MXAN_0247"
FT   CDS_pept        complement(295935..296564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91737"
FT                   /db_xref="GOA:Q1DFP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP5"
FT                   /protein_id="ABF91737.1"
FT   gene            296597..297145
FT                   /locus_tag="MXAN_0248"
FT   CDS_pept        296597..297145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP4"
FT                   /protein_id="ABF87631.1"
FT   gene            297199..297951
FT                   /locus_tag="MXAN_0249"
FT   CDS_pept        297199..297951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0249"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02405;
FT                   match to protein family HMM TIGR00056"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90281"
FT                   /db_xref="GOA:Q1DFP3"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP3"
FT                   /protein_id="ABF90281.1"
FT   gene            297958..298776
FT                   /locus_tag="MXAN_0250"
FT   CDS_pept        297958..298776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0250"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90078"
FT                   /db_xref="GOA:Q1DFP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP2"
FT                   /protein_id="ABF90078.1"
FT   gene            298773..299981
FT                   /locus_tag="MXAN_0251"
FT   CDS_pept        298773..299981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0251"
FT                   /product="Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88972"
FT                   /db_xref="GOA:Q1DFP1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP1"
FT                   /protein_id="ABF88972.1"
FT                   AQP"
FT   gene            complement(299978..300706)
FT                   /locus_tag="MXAN_0252"
FT   CDS_pept        complement(299978..300706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0252"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88870"
FT                   /db_xref="InterPro:IPR011750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP0"
FT                   /protein_id="ABF88870.1"
FT   gene            complement(300732..301394)
FT                   /locus_tag="MXAN_0253"
FT   CDS_pept        complement(300732..301394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0253"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02269"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87951"
FT                   /db_xref="InterPro:IPR011755"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN9"
FT                   /protein_id="ABF87951.1"
FT   gene            301574..302950
FT                   /locus_tag="MXAN_0254"
FT   CDS_pept        301574..302950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0254"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93141"
FT                   /db_xref="GOA:Q1DFN8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN8"
FT                   /protein_id="ABF93141.1"
FT                   "
FT   gene            303331..304626
FT                   /locus_tag="MXAN_0255"
FT   CDS_pept        303331..304626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0255"
FT                   /product="peptidase homolog, M20 family"
FT                   /note="Lacks one of five conserved zinc-binding residues
FT                   characteristic of the M20 family, so peptidase activity is
FT                   questionable.; identified by match to protein family HMM
FT                   PF01546; match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85949"
FT                   /db_xref="GOA:Q1DFN7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN7"
FT                   /protein_id="ABF85949.1"
FT   gene            304826..305986
FT                   /locus_tag="MXAN_0256"
FT   CDS_pept        304826..305986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0256"
FT                   /product="aminotransferase, class V"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85889"
FT                   /db_xref="GOA:Q1DFN6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN6"
FT                   /protein_id="ABF85889.1"
FT   gene            306148..306810
FT                   /locus_tag="MXAN_0257"
FT   CDS_pept        306148..306810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89386"
FT                   /db_xref="InterPro:IPR011751"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN5"
FT                   /protein_id="ABF89386.1"
FT   gene            306903..307325
FT                   /locus_tag="MXAN_0258"
FT   CDS_pept        306903..307325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0258"
FT                   /product="ATPase domain protein"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88152"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN4"
FT                   /protein_id="ABF88152.1"
FT   gene            307322..307690
FT                   /locus_tag="MXAN_0259"
FT   CDS_pept        307322..307690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0259"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93003"
FT                   /db_xref="GOA:Q1DFN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN3"
FT                   /protein_id="ABF93003.1"
FT                   KPVDVDTLLDAVSRHLTA"
FT   gene            307792..309939
FT                   /locus_tag="MXAN_0260"
FT   CDS_pept        307792..309939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0260"
FT                   /product="putative cation transporter/universal stress
FT                   family protein"
FT                   /note="identified by similarity to GB:AAM80527.1; match to
FT                   protein family HMM PF00582; match to protein family HMM
FT                   PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92456"
FT                   /db_xref="GOA:Q1DFN2"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN2"
FT                   /protein_id="ABF92456.1"
FT   gene            309939..310757
FT                   /locus_tag="MXAN_0261"
FT   CDS_pept        309939..310757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0261"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87764"
FT                   /db_xref="GOA:Q1DFN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN1"
FT                   /protein_id="ABF87764.1"
FT   gene            complement(310759..311613)
FT                   /locus_tag="MXAN_0262"
FT   CDS_pept        complement(310759..311613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0262"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87314"
FT                   /db_xref="GOA:Q1DFN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN0"
FT                   /protein_id="ABF87314.1"
FT                   TSP"
FT   gene            311616..312074
FT                   /locus_tag="MXAN_0263"
FT   CDS_pept        311616..312074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88391"
FT                   /db_xref="GOA:Q1DFM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM9"
FT                   /protein_id="ABF88391.1"
FT   gene            312232..314679
FT                   /gene="gyrB"
FT                   /locus_tag="MXAN_0264"
FT   CDS_pept        312232..314679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MXAN_0264"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87299"
FT                   /db_xref="GOA:Q1DFM8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM8"
FT                   /protein_id="ABF87299.1"
FT                   LDI"
FT   gene            complement(314955..317783)
FT                   /locus_tag="MXAN_0265"
FT   CDS_pept        complement(314955..317783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0265"
FT                   /product="serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88830"
FT                   /db_xref="GOA:Q1DFM7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM7"
FT                   /protein_id="ABF88830.1"
FT                   AEALKGSRRSER"
FT   gene            317893..319128
FT                   /locus_tag="MXAN_0266"
FT   CDS_pept        317893..319128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90982"
FT                   /db_xref="GOA:Q1DFM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM6"
FT                   /protein_id="ABF90982.1"
FT                   RLSLIRALGGER"
FT   gene            319125..320228
FT                   /locus_tag="MXAN_0267"
FT   CDS_pept        319125..320228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0267"
FT                   /product="metallophosphoesterase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90884"
FT                   /db_xref="GOA:Q1DFM5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM5"
FT                   /protein_id="ABF90884.1"
FT   gene            320326..320850
FT                   /locus_tag="MXAN_0268"
FT   CDS_pept        320326..320850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86883"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM4"
FT                   /protein_id="ABF86883.1"
FT                   HHTGNGMLSEA"
FT   gene            complement(320920..322092)
FT                   /locus_tag="MXAN_0269"
FT   CDS_pept        complement(320920..322092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0269"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by similarity to SP:P47734; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92393"
FT                   /db_xref="GOA:Q1DFM3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM3"
FT                   /protein_id="ABF92393.1"
FT   gene            complement(322104..322880)
FT                   /locus_tag="MXAN_0270"
FT   CDS_pept        complement(322104..322880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G75281"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88561"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM2"
FT                   /protein_id="ABF88561.1"
FT   gene            complement(323188..324567)
FT                   /locus_tag="MXAN_0271"
FT   CDS_pept        complement(323188..324567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0271"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to GB:AAM97330.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM1"
FT                   /protein_id="ABF90893.1"
FT                   D"
FT   gene            complement(324589..327819)
FT                   /locus_tag="MXAN_0272"
FT   CDS_pept        complement(324589..327819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0272"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89166"
FT                   /db_xref="GOA:Q1DFM0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM0"
FT                   /protein_id="ABF89166.1"
FT   gene            complement(327897..328322)
FT                   /locus_tag="MXAN_0273"
FT   CDS_pept        complement(327897..328322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0273"
FT                   /product="tonB system transport protein, ExbD/TolR family"
FT                   /note="identified by similarity to SP:P05829; match to
FT                   protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89022"
FT                   /db_xref="GOA:Q1DFL9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL9"
FT                   /protein_id="ABF89022.1"
FT   gene            complement(328334..328741)
FT                   /locus_tag="MXAN_0274"
FT   CDS_pept        complement(328334..328741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0274"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87962"
FT                   /db_xref="GOA:Q1DFL8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL8"
FT                   /protein_id="ABF87962.1"
FT   gene            complement(328725..329477)
FT                   /locus_tag="MXAN_0275"
FT   CDS_pept        complement(328725..329477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0275"
FT                   /product="tonB system transport protein ExbB/TolQ"
FT                   /note="identified by similarity to SP:P18783; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92421"
FT                   /db_xref="GOA:Q1DFL7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL7"
FT                   /protein_id="ABF92421.1"
FT   gene            complement(329523..330332)
FT                   /gene="tonB"
FT                   /locus_tag="MXAN_0276"
FT   CDS_pept        complement(329523..330332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="MXAN_0276"
FT                   /product="ferric siderophore transporter, periplasmic
FT                   energy transduction protein TonB"
FT                   /note="identified by similarity to GB:AAF04082.1; match to
FT                   protein family HMM PF03544; match to protein family HMM
FT                   TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91400"
FT                   /db_xref="GOA:Q1DFL6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL6"
FT                   /protein_id="ABF91400.1"
FT   gene            complement(330389..331708)
FT                   /locus_tag="MXAN_0277"
FT   CDS_pept        complement(330389..331708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0277"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87275"
FT                   /db_xref="GOA:Q1DFL5"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL5"
FT                   /protein_id="ABF87275.1"
FT   gene            complement(331739..333130)
FT                   /locus_tag="MXAN_0278"
FT   CDS_pept        complement(331739..333130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0278"
FT                   /product="mercuric reductase, truncated"
FT                   /note="identified by similarity to SP:P16171; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF01134; match to protein family HMM PF01266; match to
FT                   protein family HMM PF02852; match to protein family HMM
FT                   PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92860"
FT                   /db_xref="GOA:Q1DFL4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL4"
FT                   /protein_id="ABF92860.1"
FT                   EAYGL"
FT   gene            333632..333994
FT                   /locus_tag="MXAN_0279"
FT   CDS_pept        333632..333994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0279"
FT                   /product="putative ribosome-binding factor A"
FT                   /note="identified by similarity to SP:P09170; match to
FT                   protein family HMM PF02033"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89724"
FT                   /db_xref="GOA:Q1DFL3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL3"
FT                   /protein_id="ABF89724.1"
FT                   IGVSEHTPGAAEEGES"
FT   gene            333994..335148
FT                   /locus_tag="MXAN_0280"
FT   CDS_pept        333994..335148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC19645.1; match to
FT                   protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90287"
FT                   /db_xref="GOA:Q1DFL2"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL2"
FT                   /protein_id="ABF90287.1"
FT   gene            335354..335427
FT                   /locus_tag="MXAN_0281"
FT   tRNA            335354..335427
FT                   /locus_tag="MXAN_0281"
FT                   /product="tRNA-Gln"
FT   gene            335489..336016
FT                   /locus_tag="MXAN_0282"
FT   CDS_pept        335489..336016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q57729; match to
FT                   protein family HMM PF07998"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92317"
FT                   /db_xref="GOA:Q1DFL1"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL1"
FT                   /protein_id="ABF92317.1"
FT                   NLCRNELQKLNR"
FT   gene            336107..337069
FT                   /locus_tag="MXAN_0283"
FT   CDS_pept        336107..337069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0283"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91743"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL0"
FT                   /protein_id="ABF91743.1"
FT   gene            337202..337726
FT                   /locus_tag="MXAN_0284"
FT   CDS_pept        337202..337726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB49508.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK9"
FT                   /protein_id="ABF87016.1"
FT                   HRIKGGTVEIN"
FT   gene            337885..338379
FT                   /locus_tag="MXAN_0285"
FT   CDS_pept        337885..338379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0285"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86462"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK8"
FT                   /protein_id="ABF86462.1"
FT                   P"
FT   gene            complement(338479..340686)
FT                   /locus_tag="MXAN_0286"
FT   CDS_pept        complement(338479..340686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0286"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89509"
FT                   /db_xref="GOA:Q1DFK7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK7"
FT                   /protein_id="ABF89509.1"
FT   gene            341231..341392
FT                   /locus_tag="MXAN_0287"
FT   CDS_pept        341231..341392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88571"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK6"
FT                   /protein_id="ABF88571.1"
FT                   WGGWAAAE"
FT   gene            341568..342905
FT                   /locus_tag="MXAN_0288"
FT   CDS_pept        341568..342905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0288"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90600"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK5"
FT                   /protein_id="ABF90600.1"
FT   gene            343105..345429
FT                   /locus_tag="MXAN_0289"
FT   CDS_pept        343105..345429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0289"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAK22204.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91045"
FT                   /db_xref="GOA:Q1DFK4"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK4"
FT                   /protein_id="ABF91045.1"
FT   gene            345476..346057
FT                   /locus_tag="MXAN_0290"
FT   CDS_pept        345476..346057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91905.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90040"
FT                   /db_xref="GOA:Q1DFK3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK3"
FT                   /protein_id="ABF90040.1"
FT   gene            346071..346442
FT                   /locus_tag="MXAN_0291"
FT   CDS_pept        346071..346442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87461"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK2"
FT                   /protein_id="ABF87461.1"
FT   gene            complement(346571..347986)
FT                   /locus_tag="MXAN_0292"
FT   CDS_pept        complement(346571..347986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0292"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85905"
FT                   /db_xref="GOA:Q1DFK1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK1"
FT                   /protein_id="ABF85905.1"
FT                   TIPREAGRTTSAQ"
FT   gene            348152..348445
FT                   /locus_tag="MXAN_0293"
FT   CDS_pept        348152..348445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90896"
FT                   /db_xref="GOA:Q1DFK0"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK0"
FT                   /protein_id="ABF90896.1"
FT   gene            348442..348816
FT                   /locus_tag="MXAN_0294"
FT   CDS_pept        348442..348816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ9"
FT                   /protein_id="ABF89097.1"
FT   gene            complement(348818..349735)
FT                   /locus_tag="MXAN_0295"
FT   CDS_pept        complement(348818..349735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0295"
FT                   /product="peptidase, S1C (protease Do) subfamily"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88284"
FT                   /db_xref="GOA:Q1DFJ8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ8"
FT                   /protein_id="ABF88284.1"
FT   gene            complement(349748..350689)
FT                   /locus_tag="MXAN_0296"
FT   CDS_pept        complement(349748..350689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0296"
FT                   /product="peptidase, S1C (protease Do) subfamily"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90831"
FT                   /db_xref="GOA:Q1DFJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ7"
FT                   /protein_id="ABF90831.1"
FT   gene            complement(350749..351768)
FT                   /locus_tag="MXAN_0297"
FT   CDS_pept        complement(350749..351768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90917"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ6"
FT                   /protein_id="ABF90917.1"
FT   gene            351910..352929
FT                   /locus_tag="MXAN_0298"
FT   CDS_pept        351910..352929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92407"
FT                   /db_xref="GOA:Q1DFJ5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ5"
FT                   /protein_id="ABF92407.1"
FT   gene            complement(352948..353805)
FT                   /locus_tag="MXAN_0299"
FT   CDS_pept        complement(352948..353805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86112"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ4"
FT                   /protein_id="ABF86112.1"
FT                   LERR"
FT   gene            complement(353802..354995)
FT                   /locus_tag="MXAN_0300"
FT   CDS_pept        complement(353802..354995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0300"
FT                   /product="glycosyltransferase, MGT family"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM TIGR01426"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91222"
FT                   /db_xref="GOA:Q1DFJ3"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ3"
FT                   /protein_id="ABF91222.1"
FT   gene            complement(354980..356287)
FT                   /locus_tag="MXAN_0301"
FT   CDS_pept        complement(354980..356287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0301"
FT                   /product="putative asparagine synthetase"
FT                   /note="identified by match to protein family HMM PF00733"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92050"
FT                   /db_xref="GOA:Q1DFJ2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ2"
FT                   /protein_id="ABF92050.1"
FT   gene            356341..357129
FT                   /locus_tag="MXAN_0302"
FT   CDS_pept        356341..357129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0302"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90351"
FT                   /db_xref="GOA:Q1DFJ1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ1"
FT                   /protein_id="ABF90351.1"
FT   gene            complement(357157..358167)
FT                   /locus_tag="MXAN_0303"
FT   CDS_pept        complement(357157..358167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0303"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86494"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ0"
FT                   /protein_id="ABF86494.1"
FT   gene            complement(358250..360394)
FT                   /locus_tag="MXAN_0304"
FT   CDS_pept        complement(358250..360394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0304"
FT                   /product="putative sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86169"
FT                   /db_xref="GOA:Q1DFI9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI9"
FT                   /protein_id="ABF86169.1"
FT   gene            complement(360460..361779)
FT                   /locus_tag="MXAN_0305"
FT   CDS_pept        complement(360460..361779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92315"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI8"
FT                   /protein_id="ABF92315.1"
FT   gene            complement(361767..362339)
FT                   /locus_tag="MXAN_0306"
FT   CDS_pept        complement(361767..362339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92223"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI7"
FT                   /protein_id="ABF92223.1"
FT   gene            complement(362336..364003)
FT                   /locus_tag="MXAN_0307"
FT   CDS_pept        complement(362336..364003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88751"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI6"
FT                   /protein_id="ABF88751.1"
FT   gene            complement(364000..364857)
FT                   /locus_tag="MXAN_0308"
FT   CDS_pept        complement(364000..364857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI5"
FT                   /protein_id="ABF91401.1"
FT                   FVPE"
FT   gene            complement(364824..366359)
FT                   /locus_tag="MXAN_0309"
FT   CDS_pept        complement(364824..366359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0309"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF07726"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91483"
FT                   /db_xref="GOA:Q1DFI4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI4"
FT                   /protein_id="ABF91483.1"
FT   gene            364896..366398
FT                   /locus_tag="MXAN_0310"
FT   CDS_pept        364896..366398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89671"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI3"
FT                   /protein_id="ABF89671.1"
FT   gene            complement(366423..367052)
FT                   /locus_tag="MXAN_0311"
FT   CDS_pept        complement(366423..367052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0311"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91188"
FT                   /db_xref="GOA:Q1DFI2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI2"
FT                   /protein_id="ABF91188.1"
FT   gene            complement(367102..367470)
FT                   /locus_tag="MXAN_0312"
FT   CDS_pept        complement(367102..367470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86704"
FT                   /db_xref="GOA:Q1DFI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI1"
FT                   /protein_id="ABF86704.1"
FT                   VLLVLAVGFLLMSRLRGP"
FT   gene            complement(367920..368996)
FT                   /locus_tag="MXAN_0313"
FT   CDS_pept        complement(367920..368996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0313"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92758"
FT                   /db_xref="GOA:Q1DFI0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI0"
FT                   /protein_id="ABF92758.1"
FT                   GARLELPTDAPGHGVTLA"
FT   gene            369075..371150
FT                   /locus_tag="MXAN_0314"
FT   CDS_pept        369075..371150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0314"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89776"
FT                   /db_xref="GOA:Q1DFH9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH9"
FT                   /protein_id="ABF89776.1"
FT   gene            complement(371187..371873)
FT                   /locus_tag="MXAN_0315"
FT   CDS_pept        complement(371187..371873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN56441.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90090"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR037181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH8"
FT                   /protein_id="ABF90090.1"
FT                   REEVKL"
FT   gene            complement(371958..373157)
FT                   /locus_tag="MXAN_0316"
FT   CDS_pept        complement(371958..373157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04339"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92724"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH7"
FT                   /protein_id="ABF92724.1"
FT                   "
FT   gene            complement(373213..374007)
FT                   /locus_tag="MXAN_0317"
FT   CDS_pept        complement(373213..374007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0317"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91931"
FT                   /db_xref="GOA:Q1DFH6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH6"
FT                   /protein_id="ABF91931.1"
FT   gene            374231..375562
FT                   /locus_tag="MXAN_0318"
FT   CDS_pept        374231..375562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0318"
FT                   /product="putative
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase"
FT                   /note="identified by similarity to SP:P22805; match to
FT                   protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87044"
FT                   /db_xref="GOA:Q1DFH5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH5"
FT                   /protein_id="ABF87044.1"
FT   gene            376441..377980
FT                   /gene="rrsA"
FT                   /locus_tag="MXAN_0319"
FT   rRNA            376441..377980
FT                   /gene="rrsA"
FT                   /locus_tag="MXAN_0319"
FT                   /product="16S ribosomal RNA"
FT   gene            378191..378267
FT                   /locus_tag="MXAN_0320"
FT   tRNA            378191..378267
FT                   /locus_tag="MXAN_0320"
FT                   /product="tRNA-Ile"
FT   gene            378338..378410
FT                   /locus_tag="MXAN_0321"
FT   tRNA            378338..378410
FT                   /locus_tag="MXAN_0321"
FT                   /product="tRNA-Ala"
FT   gene            378685..381657
FT                   /gene="rrlA"
FT                   /locus_tag="MXAN_0322"
FT   rRNA            378685..381657
FT                   /gene="rrlA"
FT                   /locus_tag="MXAN_0322"
FT                   /product="23S ribosomal RNA"
FT   gene            381811..381926
FT                   /gene="rrfA"
FT                   /locus_tag="MXAN_0323"
FT   rRNA            381811..381926
FT                   /gene="rrfA"
FT                   /locus_tag="MXAN_0323"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(382003..382617)
FT                   /locus_tag="MXAN_0324"
FT   CDS_pept        complement(382003..382617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0324"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92241"
FT                   /db_xref="GOA:Q1DFH4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH4"
FT                   /protein_id="ABF92241.1"
FT   gene            complement(382638..383798)
FT                   /locus_tag="MXAN_0325"
FT   CDS_pept        complement(382638..383798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0325"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92234"
FT                   /db_xref="GOA:Q1DFH3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH3"
FT                   /protein_id="ABF92234.1"
FT   gene            complement(383935..384459)
FT                   /locus_tag="MXAN_0326"
FT   CDS_pept        complement(383935..384459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0326"
FT                   /product="phage tail collar domain protein"
FT                   /note="identified by match to protein family HMM PF07484"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91669"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH2"
FT                   /protein_id="ABF91669.1"
FT                   IALEGIYPSRN"
FT   gene            384701..386704
FT                   /locus_tag="MXAN_0327"
FT   CDS_pept        384701..386704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0327"
FT                   /product="collagen triple helix repeat protein"
FT                   /note="identified by match to protein family HMM PF01391"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90675"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH1"
FT                   /protein_id="ABF90675.1"
FT   gene            complement(386793..387302)
FT                   /locus_tag="MXAN_0328"
FT   CDS_pept        complement(386793..387302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0328"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89825"
FT                   /db_xref="GOA:Q1DFH0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH0"
FT                   /protein_id="ABF89825.1"
FT                   PAPHQD"
FT   gene            387369..387986
FT                   /locus_tag="MXAN_0330"
FT   CDS_pept        387369..387986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87013"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG9"
FT                   /protein_id="ABF87013.1"
FT   gene            388392..389147
FT                   /locus_tag="MXAN_0331"
FT   CDS_pept        388392..389147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91791.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88274"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG8"
FT                   /protein_id="ABF88274.1"
FT   gene            complement(389155..389745)
FT                   /gene="rimJ"
FT                   /locus_tag="MXAN_0332"
FT   CDS_pept        complement(389155..389745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="MXAN_0332"
FT                   /product="ribosomal protein alanine acetyltransferase"
FT                   /note="identified by similarity to SP:P09454; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87527"
FT                   /db_xref="GOA:Q1DFG7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG7"
FT                   /protein_id="ABF87527.1"
FT   gene            complement(389769..390998)
FT                   /locus_tag="MXAN_0333"
FT   CDS_pept        complement(389769..390998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0333"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86045"
FT                   /db_xref="GOA:Q1DFG6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025511"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG6"
FT                   /protein_id="ABF86045.1"
FT                   GAEPPTTPRR"
FT   gene            complement(391027..391536)
FT                   /locus_tag="MXAN_0334"
FT   CDS_pept        complement(391027..391536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0334"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:H75376"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86012"
FT                   /db_xref="InterPro:IPR025511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG5"
FT                   /protein_id="ABF86012.1"
FT                   LRRGQP"
FT   gene            391581..392465
FT                   /locus_tag="MXAN_0335"
FT   CDS_pept        391581..392465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0335"
FT                   /product="5'-3' exonuclease family protein"
FT                   /note="identified by match to protein family HMM PF01367;
FT                   match to protein family HMM PF02739"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88162"
FT                   /db_xref="GOA:Q1DFG4"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG4"
FT                   /protein_id="ABF88162.1"
FT                   LTTLKRRPKRWAP"
FT   gene            complement(392434..394530)
FT                   /locus_tag="MXAN_0336"
FT   CDS_pept        complement(392434..394530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0336"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87578"
FT                   /db_xref="GOA:Q1DFG3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG3"
FT                   /protein_id="ABF87578.1"
FT                   WDGA"
FT   gene            394712..395113
FT                   /locus_tag="MXAN_0337"
FT   CDS_pept        394712..395113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0337"
FT                   /product="protozoan/cyanobacterial globin family protein"
FT                   /note="identified by match to protein family HMM PF01152"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90973"
FT                   /db_xref="GOA:Q1DFG2"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG2"
FT                   /protein_id="ABF90973.1"
FT   gene            complement(395134..396063)
FT                   /locus_tag="MXAN_0338"
FT   CDS_pept        complement(395134..396063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0338"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89799"
FT                   /db_xref="GOA:Q1DFG1"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG1"
FT                   /protein_id="ABF89799.1"
FT   gene            396346..396891
FT                   /locus_tag="MXAN_0339"
FT   CDS_pept        396346..396891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0339"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG0"
FT                   /protein_id="ABF89393.1"
FT                   EFLAASPEEKAAILFLAL"
FT   gene            complement(396925..398613)
FT                   /locus_tag="MXAN_0340"
FT   CDS_pept        complement(396925..398613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0340"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01590; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88333"
FT                   /db_xref="GOA:Q1DFF9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF9"
FT                   /protein_id="ABF88333.1"
FT   gene            398696..400657
FT                   /gene="kup"
FT                   /locus_tag="MXAN_0341"
FT   CDS_pept        398696..400657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="MXAN_0341"
FT                   /product="potassium uptake protein"
FT                   /note="identified by similarity to SP:P30016; match to
FT                   protein family HMM PF02705"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87568"
FT                   /db_xref="GOA:Q1DFF8"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFF8"
FT                   /protein_id="ABF87568.1"
FT                   YFRIPPNRVVELGAQVEL"
FT   gene            400898..401953
FT                   /locus_tag="MXAN_0342"
FT   CDS_pept        400898..401953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86141"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF7"
FT                   /protein_id="ABF86141.1"
FT                   AELDVTYIRVD"
FT   gene            complement(401964..402560)
FT                   /locus_tag="MXAN_0343"
FT   CDS_pept        complement(401964..402560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86968"
FT                   /db_xref="InterPro:IPR011751"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF6"
FT                   /protein_id="ABF86968.1"
FT   gene            complement(402557..403294)
FT                   /locus_tag="MXAN_0344"
FT   CDS_pept        complement(402557..403294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0344"
FT                   /product="metallophosphoesterase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90576"
FT                   /db_xref="GOA:Q1DFF5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF5"
FT                   /protein_id="ABF90576.1"
FT   gene            403478..405337
FT                   /locus_tag="MXAN_0345"
FT   CDS_pept        403478..405337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0345"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91120"
FT                   /db_xref="GOA:Q1DFF4"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033803"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF4"
FT                   /protein_id="ABF91120.1"
FT   gene            405345..406445
FT                   /gene="tolB"
FT                   /locus_tag="MXAN_0346"
FT   CDS_pept        405345..406445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="MXAN_0346"
FT                   /product="tol-pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="identified by match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92118"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF3"
FT                   /protein_id="ABF92118.1"
FT   gene            complement(406435..409044)
FT                   /locus_tag="MXAN_0347"
FT   CDS_pept        complement(406435..409044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0347"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87410"
FT                   /db_xref="GOA:Q1DFF2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF2"
FT                   /protein_id="ABF87410.1"
FT   gene            complement(409118..410101)
FT                   /locus_tag="MXAN_0348"
FT   CDS_pept        complement(409118..410101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF1"
FT                   /protein_id="ABF91725.1"
FT   gene            410138..410857
FT                   /locus_tag="MXAN_0349"
FT   CDS_pept        410138..410857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF0"
FT                   /protein_id="ABF88544.1"
FT                   VLPGTTGRLEGRVAGRT"
FT   gene            410878..412500
FT                   /locus_tag="MXAN_0350"
FT   CDS_pept        410878..412500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0350"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89433"
FT                   /db_xref="GOA:Q1DFE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE9"
FT                   /protein_id="ABF89433.1"
FT   gene            complement(412565..413236)
FT                   /locus_tag="MXAN_0351"
FT   CDS_pept        complement(412565..413236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0351"
FT                   /product="thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86427"
FT                   /db_xref="GOA:Q1DFE8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE8"
FT                   /protein_id="ABF86427.1"
FT                   H"
FT   gene            complement(413402..414391)
FT                   /gene="rimK"
FT                   /locus_tag="MXAN_0352"
FT   CDS_pept        complement(413402..414391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="MXAN_0352"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="identified by similarity to SP:P17116; match to
FT                   protein family HMM TIGR00768"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90218"
FT                   /db_xref="GOA:Q1DFE7"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE7"
FT                   /protein_id="ABF90218.1"
FT   gene            414440..415900
FT                   /locus_tag="MXAN_0353"
FT   CDS_pept        414440..415900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0353"
FT                   /product="sigma-54 dependent transcriptional regulator, Fis
FT                   family"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF00498; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90782"
FT                   /db_xref="GOA:Q1DFE6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE6"
FT                   /protein_id="ABF90782.1"
FT   gene            415916..416851
FT                   /locus_tag="MXAN_0354"
FT   CDS_pept        415916..416851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0354"
FT                   /product="pilus biogenesis protein, TadE family"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89735"
FT                   /db_xref="GOA:Q1DFE5"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE5"
FT                   /protein_id="ABF89735.1"
FT   gene            416848..418464
FT                   /locus_tag="MXAN_0355"
FT   CDS_pept        416848..418464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0355"
FT                   /product="putative pilus biogenesis operon protein"
FT                   /note="This and adjacent genes have similarity to the TadE
FT                   family of pilus biogenesis genes."
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91767"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE4"
FT                   /protein_id="ABF91767.1"
FT   gene            418436..419482
FT                   /locus_tag="MXAN_0356"
FT   CDS_pept        418436..419482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0356"
FT                   /product="putative pilus biogenesis operon protein"
FT                   /note="This gene and two adjacent upstream genes have
FT                   similarity to the TadE family of pilus biogenesis genes."
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90474"
FT                   /db_xref="GOA:Q1DFE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE3"
FT                   /protein_id="ABF90474.1"
FT                   CFLGNECP"
FT   gene            419473..420297
FT                   /locus_tag="MXAN_0357"
FT   CDS_pept        419473..420297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86778"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE2"
FT                   /protein_id="ABF86778.1"
FT   gene            420764..423664
FT                   /gene="ileS"
FT                   /locus_tag="MXAN_0358"
FT   CDS_pept        420764..423664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="MXAN_0358"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00956; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   PF06827; match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86287"
FT                   /db_xref="GOA:Q1DFE1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE1"
FT                   /protein_id="ABF86287.1"
FT   gene            complement(423736..424383)
FT                   /locus_tag="MXAN_0359"
FT   CDS_pept        complement(423736..424383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0359"
FT                   /product="type 4 pilus biogenesis operon protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86374"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE0"
FT                   /protein_id="ABF86374.1"
FT   gene            complement(424386..425612)
FT                   /locus_tag="MXAN_0360"
FT   CDS_pept        complement(424386..425612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0360"
FT                   /product="type 4 pilus biogenesis operon protein"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87810"
FT                   /db_xref="GOA:Q1DFD9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD9"
FT                   /protein_id="ABF87810.1"
FT                   GLQPLLTEN"
FT   gene            complement(425609..426139)
FT                   /locus_tag="MXAN_0361"
FT   CDS_pept        complement(425609..426139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0361"
FT                   /product="type 4 pilus biogenesis operon protein"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92453"
FT                   /db_xref="GOA:Q1DFD8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD8"
FT                   /protein_id="ABF92453.1"
FT                   DRQVVVLQTRMAP"
FT   gene            complement(426136..430395)
FT                   /locus_tag="MXAN_0362"
FT   CDS_pept        complement(426136..430395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0362"
FT                   /product="putative pilus biogenesis operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86485"
FT                   /db_xref="InterPro:IPR025193"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD7"
FT                   /protein_id="ABF86485.1"
FT                   RSKVLIYAPSPDGRMPQ"
FT   gene            complement(430392..430901)
FT                   /locus_tag="MXAN_0363"
FT   CDS_pept        complement(430392..430901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90908"
FT                   /db_xref="GOA:Q1DFD6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD6"
FT                   /protein_id="ABF90908.1"
FT                   RSQGKK"
FT   gene            complement(430873..431673)
FT                   /locus_tag="MXAN_0364"
FT   CDS_pept        complement(430873..431673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92153"
FT                   /db_xref="GOA:Q1DFD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD5"
FT                   /protein_id="ABF92153.1"
FT   gene            complement(431829..432593)
FT                   /locus_tag="MXAN_0365"
FT   CDS_pept        complement(431829..432593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:B70934; match to
FT                   protein family HMM PF01927"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93016"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD4"
FT                   /protein_id="ABF93016.1"
FT   gene            432780..434201
FT                   /locus_tag="MXAN_0366"
FT   CDS_pept        432780..434201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0366"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90514"
FT                   /db_xref="GOA:Q1DFD3"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD3"
FT                   /protein_id="ABF90514.1"
FT                   MQHMGVVKDFLVPNF"
FT   gene            complement(434260..434706)
FT                   /locus_tag="MXAN_0367"
FT   CDS_pept        complement(434260..434706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88693"
FT                   /db_xref="GOA:Q1DFD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD2"
FT                   /protein_id="ABF88693.1"
FT   gene            434755..435351
FT                   /gene="lspA"
FT                   /locus_tag="MXAN_0368"
FT   CDS_pept        434755..435351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="MXAN_0368"
FT                   /product="signal peptidase II"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P17942; match to
FT                   protein family HMM PF01252; match to protein family HMM
FT                   TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86672"
FT                   /db_xref="GOA:Q1DFD1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD1"
FT                   /protein_id="ABF86672.1"
FT   gene            435385..435993
FT                   /gene="lspA"
FT                   /locus_tag="MXAN_0369"
FT   CDS_pept        435385..435993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="MXAN_0369"
FT                   /product="signal peptidase II"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P17942; match to
FT                   protein family HMM PF01252; match to protein family HMM
FT                   TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91893"
FT                   /db_xref="GOA:Q1DFD0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD0"
FT                   /protein_id="ABF91893.1"
FT   gene            436288..437385
FT                   /gene="lgt"
FT                   /locus_tag="MXAN_0370"
FT   CDS_pept        436288..437385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="MXAN_0370"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by similarity to SP:O34752; match to
FT                   protein family HMM PF01790"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91588"
FT                   /db_xref="GOA:Q1DFC9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC9"
FT                   /protein_id="ABF91588.1"
FT   gene            437427..438644
FT                   /locus_tag="MXAN_0371"
FT   CDS_pept        437427..438644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR33606.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92616"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC8"
FT                   /protein_id="ABF92616.1"
FT                   LKAVPK"
FT   gene            438875..439261
FT                   /locus_tag="MXAN_0372"
FT   CDS_pept        438875..439261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0372"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91645"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC7"
FT                   /protein_id="ABF91645.1"
FT   gene            439372..439464
FT                   /locus_tag="MXAN_0373"
FT   CDS_pept        439372..439464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0373"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC6"
FT                   /protein_id="ABF89168.1"
FT                   /translation="MAKMQPIFKPGEDGMLPSSLIERGLCRPAP"
FT   gene            complement(439471..440298)
FT                   /locus_tag="MXAN_0374"
FT   CDS_pept        complement(439471..440298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0374"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90256"
FT                   /db_xref="GOA:Q1DFC5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC5"
FT                   /protein_id="ABF90256.1"
FT   gene            440476..440766
FT                   /locus_tag="MXAN_0375"
FT   CDS_pept        440476..440766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0375"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC4"
FT                   /protein_id="ABF89156.1"
FT   gene            440766..441671
FT                   /locus_tag="MXAN_0376"
FT   CDS_pept        440766..441671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0376"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87765"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC3"
FT                   /protein_id="ABF87765.1"
FT   gene            complement(441692..442606)
FT                   /locus_tag="MXAN_0377"
FT   CDS_pept        complement(441692..442606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0377"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC2"
FT                   /protein_id="ABF92673.1"
FT   gene            complement(442651..443976)
FT                   /gene="mgtE"
FT                   /locus_tag="MXAN_0378"
FT   CDS_pept        complement(442651..443976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="MXAN_0378"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88562"
FT                   /db_xref="GOA:Q1DFC1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC1"
FT                   /protein_id="ABF88562.1"
FT   gene            complement(444118..445479)
FT                   /locus_tag="MXAN_0379"
FT   CDS_pept        complement(444118..445479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0379"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC0"
FT                   /protein_id="ABF92319.1"
FT   gene            445635..445781
FT                   /locus_tag="MXAN_0380"
FT   CDS_pept        445635..445781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92488"
FT                   /db_xref="GOA:Q1DFB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB9"
FT                   /protein_id="ABF92488.1"
FT                   PGL"
FT   gene            445878..445949
FT                   /locus_tag="MXAN_0381"
FT   tRNA            445878..445949
FT                   /locus_tag="MXAN_0381"
FT                   /product="tRNA-Gly"
FT   gene            445987..446060
FT                   /locus_tag="MXAN_0382"
FT   tRNA            445987..446060
FT                   /locus_tag="MXAN_0382"
FT                   /product="tRNA-Leu"
FT   gene            complement(446207..446629)
FT                   /locus_tag="MXAN_0383"
FT   CDS_pept        complement(446207..446629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86952"
FT                   /db_xref="GOA:Q1DFB8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB8"
FT                   /protein_id="ABF86952.1"
FT   gene            446752..447081
FT                   /gene="sugE"
FT                   /locus_tag="MXAN_0384"
FT   CDS_pept        446752..447081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="MXAN_0384"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   SugE"
FT                   /note="identified by similarity to SP:P30743; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91561"
FT                   /db_xref="GOA:Q1DFB7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB7"
FT                   /protein_id="ABF91561.1"
FT                   GGDAH"
FT   gene            447225..448637
FT                   /locus_tag="MXAN_0385"
FT   CDS_pept        447225..448637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0385"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90827"
FT                   /db_xref="GOA:Q1DFB6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB6"
FT                   /protein_id="ABF90827.1"
FT                   TTTTAAAALVAD"
FT   gene            complement(448779..449168)
FT                   /locus_tag="MXAN_0386"
FT   CDS_pept        complement(448779..449168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0386"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90142"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB5"
FT                   /protein_id="ABF90142.1"
FT   gene            complement(449257..450111)
FT                   /locus_tag="MXAN_0387"
FT   CDS_pept        complement(449257..450111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0387"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89346"
FT                   /db_xref="GOA:Q1DFB4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB4"
FT                   /protein_id="ABF89346.1"
FT                   LVG"
FT   gene            450580..450652
FT                   /locus_tag="MXAN_0388"
FT   tRNA            450580..450652
FT                   /locus_tag="MXAN_0388"
FT                   /product="tRNA-Arg"
FT   gene            450744..451706
FT                   /locus_tag="MXAN_0389"
FT   CDS_pept        450744..451706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AH2867"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB3"
FT                   /protein_id="ABF86908.1"
FT   gene            complement(451737..452234)
FT                   /locus_tag="MXAN_0390"
FT   CDS_pept        complement(451737..452234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0390"
FT                   /product="putative regulator of ribonuclease activity A"
FT                   /note="identified by similarity to SP:P32165; match to
FT                   protein family HMM PF03737; match to protein family HMM
FT                   TIGR01935"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87268"
FT                   /db_xref="GOA:Q1DFB2"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB2"
FT                   /protein_id="ABF87268.1"
FT                   LG"
FT   gene            complement(452250..453227)
FT                   /locus_tag="MXAN_0391"
FT   CDS_pept        complement(452250..453227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0391"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92168"
FT                   /db_xref="GOA:Q1DFB1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB1"
FT                   /protein_id="ABF92168.1"
FT   gene            complement(453321..454139)
FT                   /locus_tag="MXAN_0392"
FT   CDS_pept        complement(453321..454139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0392"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89753"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB0"
FT                   /protein_id="ABF89753.1"
FT   gene            454164..454442
FT                   /locus_tag="MXAN_0393"
FT   CDS_pept        454164..454442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0393"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA9"
FT                   /protein_id="ABF90416.1"
FT   gene            complement(454403..455488)
FT                   /locus_tag="MXAN_0394"
FT   CDS_pept        complement(454403..455488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91253"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA8"
FT                   /protein_id="ABF91253.1"
FT   gene            455680..456975
FT                   /gene="hemL"
FT                   /locus_tag="MXAN_0395"
FT   CDS_pept        455680..456975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="MXAN_0395"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P48247; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88666"
FT                   /db_xref="GOA:Q1DFA7"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFA7"
FT                   /protein_id="ABF88666.1"
FT   gene            457022..458950
FT                   /locus_tag="MXAN_0396"
FT   CDS_pept        457022..458950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0396"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="identified by similarity to SP:P54738; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89396"
FT                   /db_xref="GOA:Q1DFA6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA6"
FT                   /protein_id="ABF89396.1"
FT                   ALAWTLA"
FT   gene            complement(459182..459343)
FT                   /locus_tag="MXAN_0397"
FT   CDS_pept        complement(459182..459343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0397"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA5"
FT                   /protein_id="ABF90485.1"
FT                   ALPGQLSV"
FT   gene            459293..459472
FT                   /locus_tag="MXAN_0398"
FT   CDS_pept        459293..459472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89576"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA4"
FT                   /protein_id="ABF89576.1"
FT                   QPSLTAAAEVSSGR"
FT   gene            complement(459424..462051)
FT                   /locus_tag="MXAN_0399"
FT   CDS_pept        complement(459424..462051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0399"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01590; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89476"
FT                   /db_xref="GOA:Q1DFA3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA3"
FT                   /protein_id="ABF89476.1"
FT                   SEGW"
FT   gene            complement(462220..463455)
FT                   /locus_tag="MXAN_0400"
FT   CDS_pept        complement(462220..463455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0400"
FT                   /product="phosphatidylethanolamine-binding protein"
FT                   /note="identified by match to protein family HMM PF01161;
FT                   match to protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91105"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA2"
FT                   /protein_id="ABF91105.1"
FT                   HRGAESPGATPA"
FT   gene            463415..463825
FT                   /locus_tag="MXAN_0401"
FT   CDS_pept        463415..463825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92586"
FT                   /db_xref="GOA:Q1DFA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFA1"
FT                   /protein_id="ABF92586.1"
FT   gene            463924..464835
FT                   /gene="atpB"
FT                   /locus_tag="MXAN_0402"
FT   CDS_pept        463924..464835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="MXAN_0402"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87669"
FT                   /db_xref="GOA:Q1DFA0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFA0"
FT                   /protein_id="ABF87669.1"
FT   gene            464980..465210
FT                   /gene="atpE"
FT                   /locus_tag="MXAN_0403"
FT   CDS_pept        464980..465210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="MXAN_0403"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86931"
FT                   /db_xref="GOA:Q1DF99"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF99"
FT                   /protein_id="ABF86931.1"
FT   gene            465378..465896
FT                   /gene="atpF"
FT                   /locus_tag="MXAN_0404"
FT   CDS_pept        465378..465896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="MXAN_0404"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89279"
FT                   /db_xref="GOA:Q1DF98"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DF98"
FT                   /protein_id="ABF89279.1"
FT                   ATGAVRRTA"
FT   gene            465949..467058
FT                   /gene="ychF"
FT                   /locus_tag="MXAN_0405"
FT   CDS_pept        465949..467058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="MXAN_0405"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88488"
FT                   /db_xref="GOA:Q1DF97"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF97"
FT                   /protein_id="ABF88488.1"
FT   gene            complement(467150..467533)
FT                   /locus_tag="MXAN_0406"
FT   CDS_pept        complement(467150..467533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0406"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86322"
FT                   /db_xref="GOA:Q1DF96"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF96"
FT                   /protein_id="ABF86322.1"
FT   gene            complement(467571..468875)
FT                   /gene="citZ"
FT                   /locus_tag="MXAN_0407"
FT   CDS_pept        complement(467571..468875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citZ"
FT                   /locus_tag="MXAN_0407"
FT                   /product="citrate synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P39120"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86489"
FT                   /db_xref="GOA:Q1DF95"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF95"
FT                   /protein_id="ABF86489.1"
FT   gene            468955..469761
FT                   /locus_tag="MXAN_0408"
FT   CDS_pept        468955..469761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G75440; match to
FT                   protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91075"
FT                   /db_xref="GOA:Q1DF94"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF94"
FT                   /protein_id="ABF91075.1"
FT   gene            469778..470281
FT                   /locus_tag="MXAN_0409"
FT   CDS_pept        469778..470281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0409"
FT                   /product="cupin domain protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92306"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF93"
FT                   /protein_id="ABF92306.1"
FT                   GEER"
FT   gene            470295..470792
FT                   /locus_tag="MXAN_0410"
FT   CDS_pept        470295..470792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91782"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF92"
FT                   /protein_id="ABF91782.1"
FT                   GE"
FT   gene            470850..473210
FT                   /locus_tag="MXAN_0411"
FT   CDS_pept        470850..473210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90499"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF91"
FT                   /protein_id="ABF90499.1"
FT   gene            complement(473242..474039)
FT                   /locus_tag="MXAN_0412"
FT   CDS_pept        complement(473242..474039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0412"
FT                   /product="conserved hypothetical protein TIGR00266"
FT                   /note="identified by similarity to GB:AAQ57863.1; match to
FT                   protein family HMM PF01987; match to protein family HMM
FT                   TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88177"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF90"
FT                   /protein_id="ABF88177.1"
FT   gene            complement(474094..474864)
FT                   /locus_tag="MXAN_0413"
FT   CDS_pept        complement(474094..474864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87639"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF89"
FT                   /protein_id="ABF87639.1"
FT   gene            474876..476015
FT                   /locus_tag="MXAN_0414"
FT   CDS_pept        474876..476015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0414"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91132"
FT                   /db_xref="GOA:Q1DF88"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF88"
FT                   /protein_id="ABF91132.1"
FT   gene            476067..477161
FT                   /gene="pilT"
FT                   /locus_tag="MXAN_0415"
FT   CDS_pept        476067..477161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="MXAN_0415"
FT                   /product="twitching mobility protein"
FT                   /note="identified by similarity to SP:P24559; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90430"
FT                   /db_xref="GOA:Q1DF87"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF87"
FT                   /protein_id="ABF90430.1"
FT   gene            477341..477934
FT                   /locus_tag="MXAN_0416"
FT   CDS_pept        477341..477934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0416"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAS05823.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92558"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF86"
FT                   /protein_id="ABF92558.1"
FT   gene            477945..478718
FT                   /locus_tag="MXAN_0417"
FT   CDS_pept        477945..478718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0417"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM32628.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF85"
FT                   /protein_id="ABF86023.1"
FT   gene            complement(478915..479796)
FT                   /locus_tag="MXAN_0418"
FT   CDS_pept        complement(478915..479796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0418"
FT                   /product="LysM domain protein"
FT                   /note="identified by similarity to SP:O07532; match to
FT                   protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85982"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF84"
FT                   /protein_id="ABF85982.1"
FT                   NYPIMAVHQYQG"
FT   gene            479776..480420
FT                   /locus_tag="MXAN_0419"
FT   CDS_pept        479776..480420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD72796.1; match to
FT                   protein family HMM PF00782"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92955"
FT                   /db_xref="GOA:Q1DF83"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF83"
FT                   /protein_id="ABF92955.1"
FT   gene            480477..480698
FT                   /locus_tag="MXAN_0420"
FT   CDS_pept        480477..480698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF82"
FT                   /protein_id="ABF90068.1"
FT   gene            480798..481913
FT                   /locus_tag="MXAN_0421"
FT   CDS_pept        480798..481913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR35861.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF81"
FT                   /protein_id="ABF88416.1"
FT   gene            complement(481980..483794)
FT                   /locus_tag="MXAN_0422"
FT   CDS_pept        complement(481980..483794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0422"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92279"
FT                   /db_xref="GOA:Q1DF80"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF80"
FT                   /protein_id="ABF92279.1"
FT   gene            complement(483850..484974)
FT                   /locus_tag="MXAN_0423"
FT   CDS_pept        complement(483850..484974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0423"
FT                   /product="SPFH domain/band 7 family domain protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90706"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF79"
FT                   /protein_id="ABF90706.1"
FT   gene            complement(485283..485351)
FT                   /pseudo
FT                   /locus_tag="MXAN_0424"
FT   tRNA            complement(485283..485351)
FT                   /pseudo
FT                   /locus_tag="MXAN_0424"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            complement(485344..485913)
FT                   /locus_tag="MXAN_0425"
FT   CDS_pept        complement(485344..485913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91145"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF78"
FT                   /protein_id="ABF91145.1"
FT   gene            complement(486021..486389)
FT                   /locus_tag="MXAN_0426"
FT   CDS_pept        complement(486021..486389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF77"
FT                   /protein_id="ABF89296.1"
FT                   PGWASWPTTLPACRRTRP"
FT   gene            complement(486386..486607)
FT                   /locus_tag="MXAN_0427"
FT   CDS_pept        complement(486386..486607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87552"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF76"
FT                   /protein_id="ABF87552.1"
FT   gene            487152..487328
FT                   /locus_tag="MXAN_0428"
FT   CDS_pept        487152..487328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF75"
FT                   /protein_id="ABF88279.1"
FT                   LLYAPCLKEEIPH"
FT   gene            complement(487697..488458)
FT                   /locus_tag="MXAN_0429"
FT   CDS_pept        complement(487697..488458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF74"
FT                   /protein_id="ABF92426.1"
FT   gene            complement(489849..490181)
FT                   /locus_tag="MXAN_0430"
FT   CDS_pept        complement(489849..490181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88558"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF73"
FT                   /protein_id="ABF88558.1"
FT                   LGRPIQ"
FT   gene            complement(490426..491400)
FT                   /locus_tag="MXAN_0431"
FT   CDS_pept        complement(490426..491400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0431"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86067"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF72"
FT                   /protein_id="ABF86067.1"
FT   gene            complement(491641..492426)
FT                   /locus_tag="MXAN_0432"
FT   CDS_pept        complement(491641..492426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0432"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86854"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF71"
FT                   /protein_id="ABF86854.1"
FT   gene            complement(493172..493924)
FT                   /locus_tag="MXAN_0433"
FT   CDS_pept        complement(493172..493924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87234"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF70"
FT                   /protein_id="ABF87234.1"
FT   gene            complement(493937..496063)
FT                   /gene="glgX"
FT                   /locus_tag="MXAN_0434"
FT   CDS_pept        complement(493937..496063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="MXAN_0434"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02100"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91622"
FT                   /db_xref="GOA:Q1DF69"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF69"
FT                   /protein_id="ABF91622.1"
FT                   LIGRSLAVFRQVAD"
FT   gene            complement(496130..497401)
FT                   /locus_tag="MXAN_0435"
FT   CDS_pept        complement(496130..497401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF68"
FT                   /protein_id="ABF87086.1"
FT   gene            497605..497877
FT                   /locus_tag="MXAN_0436"
FT   CDS_pept        497605..497877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91540"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF67"
FT                   /protein_id="ABF91540.1"
FT   gene            complement(498027..498674)
FT                   /locus_tag="MXAN_0437"
FT   CDS_pept        complement(498027..498674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0437"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92252"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF66"
FT                   /protein_id="ABF92252.1"
FT   gene            complement(498689..499402)
FT                   /locus_tag="MXAN_0438"
FT   CDS_pept        complement(498689..499402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0438"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89952"
FT                   /db_xref="GOA:Q1DF65"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF65"
FT                   /protein_id="ABF89952.1"
FT                   RGDDRPRLVGPNSAD"
FT   gene            complement(499519..500040)
FT                   /locus_tag="MXAN_0439"
FT   CDS_pept        complement(499519..500040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0439"
FT                   /product="Erp domain protein"
FT                   /note="identified by similarity to GB:AAK82956.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF64"
FT                   /protein_id="ABF90784.1"
FT                   GVVNDGGTGF"
FT   gene            complement(500069..502543)
FT                   /locus_tag="MXAN_0440"
FT   CDS_pept        complement(500069..502543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0440"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91372"
FT                   /db_xref="GOA:Q1DF63"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF63"
FT                   /protein_id="ABF91372.1"
FT                   RQSGRGEPTHAS"
FT   gene            502511..505480
FT                   /locus_tag="MXAN_0441"
FT   CDS_pept        502511..505480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0441"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88222"
FT                   /db_xref="GOA:Q1DF62"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF62"
FT                   /protein_id="ABF88222.1"
FT                   "
FT   gene            505526..505810
FT                   /locus_tag="MXAN_0442"
FT   CDS_pept        505526..505810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0442"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF61"
FT                   /protein_id="ABF87590.1"
FT   gene            complement(505823..506695)
FT                   /locus_tag="MXAN_0443"
FT   CDS_pept        complement(505823..506695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91435"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF60"
FT                   /protein_id="ABF91435.1"
FT                   PADYPVIGC"
FT   gene            506898..507947
FT                   /locus_tag="MXAN_0444"
FT   CDS_pept        506898..507947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0444"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89085"
FT                   /db_xref="GOA:Q1DF59"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF59"
FT                   /protein_id="ABF89085.1"
FT                   GAAHGPAQG"
FT   gene            507979..508854
FT                   /locus_tag="MXAN_0445"
FT   CDS_pept        507979..508854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0445"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88188"
FT                   /db_xref="GOA:Q1DF58"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF58"
FT                   /protein_id="ABF88188.1"
FT                   WRRKATAGAP"
FT   gene            508945..510342
FT                   /locus_tag="MXAN_0446"
FT   CDS_pept        508945..510342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91076"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF57"
FT                   /protein_id="ABF91076.1"
FT                   LALFSGP"
FT   gene            511077..511481
FT                   /locus_tag="MXAN_0447"
FT   CDS_pept        511077..511481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0447"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90766"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF56"
FT                   /protein_id="ABF90766.1"
FT   gene            complement(511494..512075)
FT                   /locus_tag="MXAN_0448"
FT   CDS_pept        complement(511494..512075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0448"
FT                   /product="dual specificity phosphatase"
FT                   /note="identified by match to protein family HMM PF00782"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89944"
FT                   /db_xref="GOA:Q1DF55"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF55"
FT                   /protein_id="ABF89944.1"
FT   gene            complement(512072..513133)
FT                   /locus_tag="MXAN_0449"
FT   CDS_pept        complement(512072..513133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF54"
FT                   /protein_id="ABF89248.1"
FT                   VTGLMEVTLEGDL"
FT   gene            complement(513060..514295)
FT                   /locus_tag="MXAN_0450"
FT   CDS_pept        complement(513060..514295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0450"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88769"
FT                   /db_xref="GOA:Q1DF53"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF53"
FT                   /protein_id="ABF88769.1"
FT                   EDALMEQRPHAA"
FT   gene            complement(514303..515229)
FT                   /locus_tag="MXAN_0451"
FT   CDS_pept        complement(514303..515229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0451"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87736"
FT                   /db_xref="GOA:Q1DF52"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF52"
FT                   /protein_id="ABF87736.1"
FT   gene            complement(515207..516541)
FT                   /locus_tag="MXAN_0452"
FT   CDS_pept        complement(515207..516541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0452"
FT                   /product="putative myo-inositol-1-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF01658;
FT                   match to protein family HMM PF07994"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91224"
FT                   /db_xref="GOA:Q1DF51"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF51"
FT                   /protein_id="ABF91224.1"
FT   gene            complement(516941..517468)
FT                   /locus_tag="MXAN_0453"
FT   CDS_pept        complement(516941..517468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0453"
FT                   /product="putative general stress protein 26"
FT                   /note="identified by similarity to SP:P80238; match to
FT                   protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87816"
FT                   /db_xref="GOA:Q1DF50"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF50"
FT                   /protein_id="ABF87816.1"
FT                   KLDLDDSAPLPH"
FT   gene            517593..518087
FT                   /locus_tag="MXAN_0454"
FT   CDS_pept        517593..518087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF49"
FT                   /protein_id="ABF90856.1"
FT                   L"
FT   gene            518306..520036
FT                   /locus_tag="MXAN_0455"
FT   CDS_pept        518306..520036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0455"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAO76334.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91266"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF48"
FT                   /protein_id="ABF91266.1"
FT                   "
FT   gene            520101..521111
FT                   /locus_tag="MXAN_0456"
FT   CDS_pept        520101..521111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0456"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by similarity to SP:P12311; match to
FT                   protein family HMM TIGR02822"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91173"
FT                   /db_xref="GOA:Q1DF47"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF47"
FT                   /protein_id="ABF91173.1"
FT   gene            521331..521666
FT                   /locus_tag="MXAN_0457"
FT   CDS_pept        521331..521666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0457"
FT                   /product="putative sigma 54 modulation protein"
FT                   /note="identified by similarity to SP:P17161"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90070"
FT                   /db_xref="GOA:Q1DF46"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF46"
FT                   /protein_id="ABF90070.1"
FT                   ALNTHHG"
FT   gene            521962..522576
FT                   /locus_tag="MXAN_0458"
FT   CDS_pept        521962..522576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88136"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF45"
FT                   /protein_id="ABF88136.1"
FT   gene            522573..523982
FT                   /locus_tag="MXAN_0459"
FT   CDS_pept        522573..523982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0459"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87143"
FT                   /db_xref="GOA:Q1DF44"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF44"
FT                   /protein_id="ABF87143.1"
FT                   ELPAAAAAQAA"
FT   gene            523979..524746
FT                   /locus_tag="MXAN_0460"
FT   CDS_pept        523979..524746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0460"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89383"
FT                   /db_xref="GOA:Q1DF43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF43"
FT                   /protein_id="ABF89383.1"
FT   gene            524750..525478
FT                   /locus_tag="MXAN_0461"
FT   CDS_pept        524750..525478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0461"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87713"
FT                   /db_xref="GOA:Q1DF42"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF42"
FT                   /protein_id="ABF87713.1"
FT   gene            525475..525858
FT                   /locus_tag="MXAN_0462"
FT   CDS_pept        525475..525858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0462"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91004"
FT                   /db_xref="GOA:Q1DF41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF41"
FT                   /protein_id="ABF91004.1"
FT   gene            525874..527277
FT                   /gene="pepP"
FT                   /locus_tag="MXAN_0463"
FT   CDS_pept        525874..527277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="MXAN_0463"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P15034; match to
FT                   protein family HMM PF00557; match to protein family HMM
FT                   PF05195"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86100"
FT                   /db_xref="GOA:Q1DF40"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF40"
FT                   /protein_id="ABF86100.1"
FT                   SSARPAPGR"
FT   gene            complement(527240..527911)
FT                   /locus_tag="MXAN_0464"
FT   CDS_pept        complement(527240..527911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92613"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF39"
FT                   /protein_id="ABF92613.1"
FT                   S"
FT   gene            complement(527957..528550)
FT                   /locus_tag="MXAN_0465"
FT   CDS_pept        complement(527957..528550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87222"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF38"
FT                   /protein_id="ABF87222.1"
FT   gene            528601..530181
FT                   /locus_tag="MXAN_0466"
FT   CDS_pept        528601..530181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF37"
FT                   /protein_id="ABF89948.1"
FT                   EPIRFPFIF"
FT   gene            complement(530459..531499)
FT                   /gene="pdxA"
FT                   /locus_tag="MXAN_0467"
FT   CDS_pept        complement(530459..531499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="MXAN_0467"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91756"
FT                   /db_xref="GOA:Q1DF36"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF36"
FT                   /protein_id="ABF91756.1"
FT                   RPSPGR"
FT   gene            complement(531505..532482)
FT                   /locus_tag="MXAN_0468"
FT   CDS_pept        complement(531505..532482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0468"
FT                   /product="peptidylprolyl cis-trans isomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87646"
FT                   /db_xref="GOA:Q1DF35"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF35"
FT                   /protein_id="ABF87646.1"
FT   gene            complement(532538..533587)
FT                   /locus_tag="MXAN_0469"
FT   CDS_pept        complement(532538..533587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0469"
FT                   /product="putative foldase protein PrsA"
FT                   /note="identified by similarity to SP:P24327; match to
FT                   protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89263"
FT                   /db_xref="GOA:Q1DF34"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF34"
FT                   /protein_id="ABF89263.1"
FT                   PTPQQATAE"
FT   gene            complement(533643..534662)
FT                   /locus_tag="MXAN_0470"
FT   CDS_pept        complement(533643..534662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0470"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88220"
FT                   /db_xref="GOA:Q1DF33"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF33"
FT                   /protein_id="ABF88220.1"
FT   gene            534768..535109
FT                   /locus_tag="MXAN_0471"
FT   CDS_pept        534768..535109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86041"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF32"
FT                   /protein_id="ABF86041.1"
FT                   QGAQPHGAG"
FT   gene            535135..535407
FT                   /locus_tag="MXAN_0472"
FT   CDS_pept        535135..535407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0472"
FT                   /product="GIY-YIG catalytic domain protein"
FT                   /note="identified by match to protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91655"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF31"
FT                   /protein_id="ABF91655.1"
FT   gene            535425..535874
FT                   /locus_tag="MXAN_0473"
FT   CDS_pept        535425..535874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0473"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90680"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF30"
FT                   /protein_id="ABF90680.1"
FT   gene            complement(535562..536017)
FT                   /locus_tag="MXAN_0474"
FT   CDS_pept        complement(535562..536017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0474"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF29"
FT                   /protein_id="ABF89257.1"
FT   gene            complement(535893..536207)
FT                   /locus_tag="MXAN_0475"
FT   CDS_pept        complement(535893..536207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86203"
FT                   /db_xref="GOA:Q1DF28"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF28"
FT                   /protein_id="ABF86203.1"
FT                   "
FT   gene            536240..536578
FT                   /locus_tag="MXAN_0476"
FT   CDS_pept        536240..536578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92457"
FT                   /db_xref="GOA:Q1DF27"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF27"
FT                   /protein_id="ABF92457.1"
FT                   SRSPPSGF"
FT   gene            536595..537032
FT                   /locus_tag="MXAN_0477"
FT   CDS_pept        536595..537032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0477"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAB85612.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90684"
FT                   /db_xref="GOA:Q1DF26"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF26"
FT                   /protein_id="ABF90684.1"
FT   gene            complement(537051..537743)
FT                   /locus_tag="MXAN_0478"
FT   CDS_pept        complement(537051..537743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0478"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92817"
FT                   /db_xref="GOA:Q1DF25"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF25"
FT                   /protein_id="ABF92817.1"
FT                   WDPNARGV"
FT   gene            complement(537833..538666)
FT                   /locus_tag="MXAN_0479"
FT   CDS_pept        complement(537833..538666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0479"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89064"
FT                   /db_xref="GOA:Q1DF24"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF24"
FT                   /protein_id="ABF89064.1"
FT   gene            complement(538739..539125)
FT                   /gene="gloA"
FT                   /locus_tag="MXAN_0480"
FT   CDS_pept        complement(538739..539125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="MXAN_0480"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR00068"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85955"
FT                   /db_xref="GOA:Q1DF23"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF23"
FT                   /protein_id="ABF85955.1"
FT   gene            complement(539190..541517)
FT                   /locus_tag="MXAN_0481"
FT   CDS_pept        complement(539190..541517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0481"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86880"
FT                   /db_xref="GOA:Q1DF22"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF22"
FT                   /protein_id="ABF86880.1"
FT   gene            complement(541537..541929)
FT                   /locus_tag="MXAN_0482"
FT   CDS_pept        complement(541537..541929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93019"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF21"
FT                   /protein_id="ABF93019.1"
FT   gene            complement(541949..543139)
FT                   /locus_tag="MXAN_0483"
FT   CDS_pept        complement(541949..543139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0483"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86659"
FT                   /db_xref="GOA:Q1DF20"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF20"
FT                   /protein_id="ABF86659.1"
FT   gene            complement(543838..544407)
FT                   /locus_tag="MXAN_0484"
FT   CDS_pept        complement(543838..544407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF19"
FT                   /protein_id="ABF90466.1"
FT   gene            complement(544427..545782)
FT                   /locus_tag="MXAN_0485"
FT   CDS_pept        complement(544427..545782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0485"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91472"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF18"
FT                   /protein_id="ABF91472.1"
FT   gene            546168..546998
FT                   /locus_tag="MXAN_0486"
FT   CDS_pept        546168..546998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89882"
FT                   /db_xref="GOA:Q1DF17"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF17"
FT                   /protein_id="ABF89882.1"
FT   gene            complement(547636..547761)
FT                   /locus_tag="MXAN_0487"
FT   CDS_pept        complement(547636..547761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF16"
FT                   /protein_id="ABF92043.1"
FT   gene            complement(547771..548091)
FT                   /locus_tag="MXAN_0488"
FT   CDS_pept        complement(547771..548091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90828"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF15"
FT                   /protein_id="ABF90828.1"
FT                   DE"
FT   gene            complement(549148..549306)
FT                   /locus_tag="MXAN_0489"
FT   CDS_pept        complement(549148..549306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF14"
FT                   /protein_id="ABF86623.1"
FT                   RSGRGAP"
FT   gene            549305..549418
FT                   /locus_tag="MXAN_0490"
FT   CDS_pept        549305..549418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF13"
FT                   /protein_id="ABF91948.1"
FT   gene            550246..550485
FT                   /locus_tag="MXAN_0491"
FT   CDS_pept        550246..550485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0491"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="identified by match to protein family HMM PF02954;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86991"
FT                   /db_xref="GOA:Q1DF12"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF12"
FT                   /protein_id="ABF86991.1"
FT   gene            550495..551583
FT                   /locus_tag="MXAN_0492"
FT   CDS_pept        550495..551583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF11"
FT                   /protein_id="ABF88053.1"
FT   gene            complement(550527..552242)
FT                   /locus_tag="MXAN_0493"
FT   CDS_pept        complement(550527..552242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF10"
FT                   /protein_id="ABF87620.1"
FT   gene            552681..553145
FT                   /locus_tag="MXAN_0494"
FT   CDS_pept        552681..553145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0494"
FT                   /product="cation-binding protein, hemerythrin HHE family"
FT                   /note="identified by match to protein family HMM PF01814"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92946"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF09"
FT                   /protein_id="ABF92946.1"
FT   gene            553256..553453
FT                   /locus_tag="MXAN_0495"
FT   CDS_pept        553256..553453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF08"
FT                   /protein_id="ABF91663.1"
FT   gene            554072..554461
FT                   /locus_tag="MXAN_0496"
FT   CDS_pept        554072..554461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0496"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89756"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF07"
FT                   /protein_id="ABF89756.1"
FT   gene            554481..556259
FT                   /locus_tag="MXAN_0497"
FT   CDS_pept        554481..556259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF06"
FT                   /protein_id="ABF89332.1"
FT                   VSPAVPASAGRDSDDR"
FT   gene            complement(554628..556331)
FT                   /locus_tag="MXAN_0498"
FT   CDS_pept        complement(554628..556331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0498"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88336"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF05"
FT                   /protein_id="ABF88336.1"
FT   gene            complement(556423..557010)
FT                   /locus_tag="MXAN_0499"
FT   CDS_pept        complement(556423..557010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88316"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF04"
FT                   /protein_id="ABF88316.1"
FT   gene            556995..558356
FT                   /locus_tag="MXAN_0500"
FT   CDS_pept        556995..558356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0500"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88708"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF03"
FT                   /protein_id="ABF88708.1"
FT   gene            complement(558607..560517)
FT                   /gene="glmS"
FT                   /locus_tag="MXAN_0501"
FT   CDS_pept        complement(558607..560517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="MXAN_0501"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87004"
FT                   /db_xref="GOA:Q1DF02"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF02"
FT                   /protein_id="ABF87004.1"
FT                   E"
FT   gene            560676..561191
FT                   /locus_tag="MXAN_0502"
FT   CDS_pept        560676..561191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0502"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90418"
FT                   /db_xref="GOA:Q1DF01"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF01"
FT                   /protein_id="ABF90418.1"
FT                   FDTRVPLL"
FT   gene            561382..561992
FT                   /pseudo
FT                   /locus_tag="MXAN_0503"
FT                   /note="DnaJ domain protein, authentic frameshift; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(561968..562381)
FT                   /locus_tag="MXAN_0504"
FT   CDS_pept        complement(561968..562381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92801"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF00"
FT                   /protein_id="ABF92801.1"
FT   gene            complement(562571..562999)
FT                   /locus_tag="MXAN_0505"
FT   CDS_pept        complement(562571..562999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88649"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ9"
FT                   /protein_id="ABF88649.1"
FT   gene            563674..565035
FT                   /locus_tag="MXAN_0506"
FT   CDS_pept        563674..565035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0506"
FT                   /product="monooxygenase, flavin-contaning"
FT                   /note="identified by similarity to PIR:JC7986; match to
FT                   protein family HMM PF00743"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87866"
FT                   /db_xref="GOA:Q1DEZ8"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ8"
FT                   /protein_id="ABF87866.1"
FT   gene            566553..568151
FT                   /locus_tag="MXAN_0507"
FT   CDS_pept        566553..568151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92791"
FT                   /db_xref="GOA:Q1DEZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ7"
FT                   /protein_id="ABF92791.1"
FT                   CSSACRRGPTAGARA"
FT   gene            complement(567243..568094)
FT                   /locus_tag="MXAN_0508"
FT   CDS_pept        complement(567243..568094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92994"
FT                   /db_xref="GOA:Q1DEZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ6"
FT                   /protein_id="ABF92994.1"
FT                   AP"
FT   gene            568078..571008
FT                   /locus_tag="MXAN_0509"
FT   CDS_pept        568078..571008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88572"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ5"
FT                   /protein_id="ABF88572.1"
FT   gene            complement(568129..571125)
FT                   /locus_tag="MXAN_0510"
FT   CDS_pept        complement(568129..571125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0510"
FT                   /product="putative cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90085"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ4"
FT                   /protein_id="ABF90085.1"
FT                   FKLKRVPLL"
FT   gene            571574..571948
FT                   /locus_tag="MXAN_0511"
FT   CDS_pept        571574..571948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ3"
FT                   /protein_id="ABF87033.1"
FT   gene            571945..572709
FT                   /locus_tag="MXAN_0512"
FT   CDS_pept        571945..572709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89649"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ2"
FT                   /protein_id="ABF89649.1"
FT   gene            572770..573342
FT                   /locus_tag="MXAN_0514"
FT   CDS_pept        572770..573342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88381"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ1"
FT                   /protein_id="ABF88381.1"
FT   gene            complement(572797..573294)
FT                   /locus_tag="MXAN_0513"
FT   CDS_pept        complement(572797..573294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87777"
FT                   /db_xref="GOA:Q1DEZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ0"
FT                   /protein_id="ABF87777.1"
FT                   VA"
FT   gene            573724..576012
FT                   /gene="dpp4"
FT                   /locus_tag="MXAN_0515"
FT   CDS_pept        573724..576012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpp4"
FT                   /locus_tag="MXAN_0515"
FT                   /product="dipeptidyl peptidase IV"
FT                   /EC_number=""
FT                   /note="identified by similarity to GB:BAA11872.1; match to
FT                   protein family HMM PF00326; match to protein family HMM
FT                   PF00930"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88767"
FT                   /db_xref="GOA:Q1DEY9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY9"
FT                   /protein_id="ABF88767.1"
FT                   TARYFKRHL"
FT   gene            complement(576282..576887)
FT                   /locus_tag="MXAN_0516"
FT   CDS_pept        complement(576282..576887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0516"
FT                   /product="transposase, IS630 family"
FT                   /note="identified by similarity to GB:BAC68455.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89498"
FT                   /db_xref="GOA:Q1DEY8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY8"
FT                   /protein_id="ABF89498.1"
FT   gene            complement(576949..577395)
FT                   /locus_tag="MXAN_0517"
FT   CDS_pept        complement(576949..577395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0517"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85927"
FT                   /db_xref="GOA:Q1DEY7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY7"
FT                   /protein_id="ABF85927.1"
FT   gene            complement(577397..580273)
FT                   /locus_tag="MXAN_0518"
FT   CDS_pept        complement(577397..580273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0518"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91284"
FT                   /db_xref="GOA:Q1DEY6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY6"
FT                   /protein_id="ABF91284.1"
FT   gene            580425..581000
FT                   /locus_tag="MXAN_0519"
FT   CDS_pept        580425..581000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAU92366.1; match to
FT                   protein family HMM PF05685"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91923"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY5"
FT                   /protein_id="ABF91923.1"
FT   gene            complement(581014..585564)
FT                   /locus_tag="MXAN_0520"
FT   CDS_pept        complement(581014..585564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC53354.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91059"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY4"
FT                   /protein_id="ABF91059.1"
FT   gene            complement(585669..586121)
FT                   /locus_tag="MXAN_0521"
FT   CDS_pept        complement(585669..586121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE07649.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89995"
FT                   /db_xref="GOA:Q1DEY3"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY3"
FT                   /protein_id="ABF89995.1"
FT   gene            586377..588023
FT                   /locus_tag="MXAN_0522"
FT   CDS_pept        586377..588023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0522"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89401"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY2"
FT                   /protein_id="ABF89401.1"
FT   gene            588233..590113
FT                   /locus_tag="MXAN_0523"
FT   CDS_pept        588233..590113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92036"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY1"
FT                   /protein_id="ABF92036.1"
FT   gene            590225..590734
FT                   /locus_tag="MXAN_0524"
FT   CDS_pept        590225..590734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0524"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89672"
FT                   /db_xref="GOA:Q1DEY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY0"
FT                   /protein_id="ABF89672.1"
FT                   GKVRGG"
FT   gene            590854..594678
FT                   /locus_tag="MXAN_0525"
FT   CDS_pept        590854..594678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0525"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92323"
FT                   /db_xref="GOA:Q1DEX9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX9"
FT                   /protein_id="ABF92323.1"
FT   gene            594757..595827
FT                   /locus_tag="MXAN_0526"
FT   CDS_pept        594757..595827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92486"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX8"
FT                   /protein_id="ABF92486.1"
FT                   HFQAGTLIMSEVPPAQ"
FT   gene            595982..597247
FT                   /locus_tag="MXAN_0527"
FT   CDS_pept        595982..597247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0527"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87068"
FT                   /db_xref="GOA:Q1DEX7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX7"
FT                   /protein_id="ABF87068.1"
FT   gene            597272..600463
FT                   /locus_tag="MXAN_0528"
FT   CDS_pept        597272..600463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0528"
FT                   /product="efflux transporter, AcrB/AcrD/AcrF family, inner
FT                   membrane component"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86313"
FT                   /db_xref="GOA:Q1DEX6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX6"
FT                   /protein_id="ABF86313.1"
FT                   GGRGEPRPAPQARHD"
FT   gene            600548..602512
FT                   /locus_tag="MXAN_0529"
FT   CDS_pept        600548..602512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F83375"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90341"
FT                   /db_xref="GOA:Q1DEX5"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX5"
FT                   /protein_id="ABF90341.1"
FT   gene            complement(602524..603264)
FT                   /locus_tag="MXAN_0530"
FT   CDS_pept        complement(602524..603264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0530"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90732"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX4"
FT                   /protein_id="ABF90732.1"
FT   gene            603538..604842
FT                   /locus_tag="MXAN_0531"
FT   CDS_pept        603538..604842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0531"
FT                   /product="aminotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92738"
FT                   /db_xref="GOA:Q1DEX3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX3"
FT                   /protein_id="ABF92738.1"
FT   gene            604878..606236
FT                   /locus_tag="MXAN_0532"
FT   CDS_pept        604878..606236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0532"
FT                   /product="putative transporter"
FT                   /note="identified by similarity to SP:O84068"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86114"
FT                   /db_xref="GOA:Q1DEX2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX2"
FT                   /protein_id="ABF86114.1"
FT   gene            606283..607458
FT                   /locus_tag="MXAN_0533"
FT   CDS_pept        606283..607458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0533"
FT                   /product="NAD dependent epimerase/dehydratase family"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87649"
FT                   /db_xref="GOA:Q1DEX1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX1"
FT                   /protein_id="ABF87649.1"
FT   gene            607572..609095
FT                   /locus_tag="MXAN_0534"
FT   CDS_pept        607572..609095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0534"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87825"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX0"
FT                   /protein_id="ABF87825.1"
FT   gene            610214..614896
FT                   /gene="topB"
FT                   /locus_tag="MXAN_0535"
FT   CDS_pept        610214..614896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="MXAN_0535"
FT                   /product="DNA topoisomerase III/ATP-dependent DNA helicase,
FT                   RecQ family"
FT                   /EC_number=""
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR00614; match to protein family HMM
FT                   TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90073"
FT                   /db_xref="GOA:Q1DEW9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW9"
FT                   /protein_id="ABF90073.1"
FT   gene            615104..616555
FT                   /locus_tag="MXAN_0536"
FT   CDS_pept        615104..616555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92476"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW8"
FT                   /protein_id="ABF92476.1"
FT   gene            complement(616552..618012)
FT                   /locus_tag="MXAN_0537"
FT   CDS_pept        complement(616552..618012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0537"
FT                   /product="putative cardiolipin synthase"
FT                   /note="identified by similarity to GB:CAD29690.1; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91887"
FT                   /db_xref="GOA:Q1DEW7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW7"
FT                   /protein_id="ABF91887.1"
FT   gene            618427..619377
FT                   /locus_tag="MXAN_0538"
FT   CDS_pept        618427..619377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0538"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87456"
FT                   /db_xref="GOA:Q1DEW6"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW6"
FT                   /protein_id="ABF87456.1"
FT   gene            complement(619505..619969)
FT                   /locus_tag="MXAN_0539"
FT   CDS_pept        complement(619505..619969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88704"
FT                   /db_xref="InterPro:IPR035223"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW5"
FT                   /protein_id="ABF88704.1"
FT   gene            complement(619994..621154)
FT                   /locus_tag="MXAN_0540"
FT   CDS_pept        complement(619994..621154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0540"
FT                   /product="ATP-binding protein, ClpX family"
FT                   /note="identified by match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87913"
FT                   /db_xref="GOA:Q1DEW4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW4"
FT                   /protein_id="ABF87913.1"
FT   gene            621391..623256
FT                   /gene="treZ"
FT                   /locus_tag="MXAN_0541"
FT   CDS_pept        621391..623256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ"
FT                   /locus_tag="MXAN_0541"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02402"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90802"
FT                   /db_xref="GOA:Q1DEW3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW3"
FT                   /protein_id="ABF90802.1"
FT   gene            623563..624915
FT                   /locus_tag="MXAN_0542"
FT   CDS_pept        623563..624915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0542"
FT                   /product="F5/8 type C domain protein"
FT                   /note="identified by match to protein family HMM PF00754"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90924"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW2"
FT                   /protein_id="ABF90924.1"
FT   gene            624930..626510
FT                   /locus_tag="MXAN_0543"
FT   CDS_pept        624930..626510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0543"
FT                   /product="peptidase, M20 (glutamate carboxypeptidase)
FT                   family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91458"
FT                   /db_xref="GOA:Q1DEW1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW1"
FT                   /protein_id="ABF91458.1"
FT                   SVIADHFKR"
FT   gene            complement(626500..628521)
FT                   /locus_tag="MXAN_0544"
FT   CDS_pept        complement(626500..628521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0544"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87214"
FT                   /db_xref="InterPro:IPR025410"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW0"
FT                   /protein_id="ABF87214.1"
FT   gene            complement(628544..628726)
FT                   /locus_tag="MXAN_0545"
FT   CDS_pept        complement(628544..628726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV9"
FT                   /protein_id="ABF89480.1"
FT                   SANVFNTCSRFMYCV"
FT   gene            complement(628779..630086)
FT                   /locus_tag="MXAN_0546"
FT   CDS_pept        complement(628779..630086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE78868.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86484"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV8"
FT                   /protein_id="ABF86484.1"
FT   gene            complement(630090..631403)
FT                   /locus_tag="MXAN_0547"
FT   CDS_pept        complement(630090..631403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91098"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV7"
FT                   /protein_id="ABF91098.1"
FT   gene            631424..631996
FT                   /locus_tag="MXAN_0548"
FT   CDS_pept        631424..631996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0548"
FT                   /product="glutathione S-transferase domain protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87956"
FT                   /db_xref="GOA:Q1DEV6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV6"
FT                   /protein_id="ABF87956.1"
FT   gene            complement(632081..632611)
FT                   /locus_tag="MXAN_0549"
FT   CDS_pept        complement(632081..632611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91369"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV5"
FT                   /protein_id="ABF91369.1"
FT                   TAVTRAKTIGVLD"
FT   gene            complement(632639..633613)
FT                   /locus_tag="MXAN_0550"
FT   CDS_pept        complement(632639..633613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89356"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV4"
FT                   /protein_id="ABF89356.1"
FT   gene            complement(633628..634869)
FT                   /locus_tag="MXAN_0551"
FT   CDS_pept        complement(633628..634869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86000"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV3"
FT                   /protein_id="ABF86000.1"
FT                   LPDQDPFGCLVGHD"
FT   gene            complement(634938..636608)
FT                   /locus_tag="MXAN_0552"
FT   CDS_pept        complement(634938..636608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0552"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P54738; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87300"
FT                   /db_xref="GOA:Q1DEV2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV2"
FT                   /protein_id="ABF87300.1"
FT   gene            complement(636733..637479)
FT                   /locus_tag="MXAN_0553"
FT   CDS_pept        complement(636733..637479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0553"
FT                   /product="ABC transporter, permease protein, ABC-2 family"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86762"
FT                   /db_xref="GOA:Q1DEV1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV1"
FT                   /protein_id="ABF86762.1"
FT   gene            complement(637504..638436)
FT                   /locus_tag="MXAN_0554"
FT   CDS_pept        complement(637504..638436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0554"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92427"
FT                   /db_xref="GOA:Q1DEV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV0"
FT                   /protein_id="ABF92427.1"
FT   gene            complement(638560..639390)
FT                   /locus_tag="MXAN_0555"
FT   CDS_pept        complement(638560..639390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0555"
FT                   /product="metallophosphoesterase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90703"
FT                   /db_xref="GOA:Q1DEU9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU9"
FT                   /protein_id="ABF90703.1"
FT   gene            complement(639479..640906)
FT                   /locus_tag="MXAN_0556"
FT   CDS_pept        complement(639479..640906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0556"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86680"
FT                   /db_xref="GOA:Q1DEU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU8"
FT                   /protein_id="ABF86680.1"
FT                   RIDEGLWRLRTRLAGAL"
FT   gene            640991..641455
FT                   /locus_tag="MXAN_0557"
FT   CDS_pept        640991..641455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0557"
FT                   /product="cupin domain protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89392"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU7"
FT                   /protein_id="ABF89392.1"
FT   gene            641499..641831
FT                   /locus_tag="MXAN_0558"
FT   CDS_pept        641499..641831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC94561.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92355"
FT                   /db_xref="GOA:Q1DEU6"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU6"
FT                   /protein_id="ABF92355.1"
FT                   GAFKRD"
FT   gene            642090..643769
FT                   /gene="mac1"
FT                   /locus_tag="MXAN_0559"
FT   CDS_pept        642090..643769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mac1"
FT                   /locus_tag="MXAN_0559"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91443"
FT                   /db_xref="GOA:Q1DEU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU5"
FT                   /protein_id="ABF91443.1"
FT   gene            complement(643878..644786)
FT                   /gene="pdcA"
FT                   /locus_tag="MXAN_0560"
FT   CDS_pept        complement(643878..644786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdcA"
FT                   /locus_tag="MXAN_0560"
FT                   /product="penicillin-resistant DD-carboxypeptidase"
FT                   /note="identified by similarity to GB:BAA83081.1; match to
FT                   protein family HMM PF01471; match to protein family HMM
FT                   PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87670"
FT                   /db_xref="GOA:Q1DEU4"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU4"
FT                   /protein_id="ABF87670.1"
FT   gene            645313..646230
FT                   /gene="htpX"
FT                   /locus_tag="MXAN_0561"
FT   CDS_pept        645313..646230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="MXAN_0561"
FT                   /product="peptidase HtpX"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to SP:P23894; match to
FT                   protein family HMM PF01435; match to protein family HMM
FT                   PF06509"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89755"
FT                   /db_xref="GOA:Q1DEU3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU3"
FT                   /protein_id="ABF89755.1"
FT   gene            646394..647767
FT                   /locus_tag="MXAN_0562"
FT   CDS_pept        646394..647767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0562"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="identified by match to protein family HMM PF07396"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90247"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU2"
FT                   /protein_id="ABF90247.1"
FT   gene            647951..649570
FT                   /locus_tag="MXAN_0563"
FT   CDS_pept        647951..649570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0563"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89521"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU1"
FT                   /protein_id="ABF89521.1"
FT   gene            649706..650884
FT                   /locus_tag="MXAN_0564"
FT   CDS_pept        649706..650884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB49832.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88436"
FT                   /db_xref="GOA:Q1DEU0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU0"
FT                   /protein_id="ABF88436.1"
FT   gene            complement(650890..651471)
FT                   /locus_tag="MXAN_0565"
FT   CDS_pept        complement(650890..651471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0565"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87141"
FT                   /db_xref="InterPro:IPR011751"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET9"
FT                   /protein_id="ABF87141.1"
FT   gene            complement(651473..652330)
FT                   /locus_tag="MXAN_0566"
FT   CDS_pept        complement(651473..652330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0566"
FT                   /product="hydrolase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92583"
FT                   /db_xref="GOA:Q1DET8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET8"
FT                   /protein_id="ABF92583.1"
FT                   WLLG"
FT   gene            652380..652571
FT                   /locus_tag="MXAN_0567"
FT   CDS_pept        652380..652571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET7"
FT                   /protein_id="ABF92236.1"
FT                   AYFLAWDLLEVDPRMGRA"
FT   gene            652654..654777
FT                   /locus_tag="MXAN_0568"
FT   CDS_pept        652654..654777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET6"
FT                   /protein_id="ABF89207.1"
FT                   PRHLFHLELETRF"
FT   gene            654573..656615
FT                   /locus_tag="MXAN_0569"
FT   CDS_pept        654573..656615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89809"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET5"
FT                   /protein_id="ABF89809.1"
FT   gene            656627..657088
FT                   /locus_tag="MXAN_0570"
FT   CDS_pept        656627..657088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0570"
FT                   /product="thermonuclease family protein"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86838"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET4"
FT                   /protein_id="ABF86838.1"
FT   gene            657295..659562
FT                   /locus_tag="MXAN_0571"
FT   CDS_pept        657295..659562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0571"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87919"
FT                   /db_xref="GOA:Q1DET3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET3"
FT                   /protein_id="ABF87919.1"
FT                   AP"
FT   gene            659640..660470
FT                   /locus_tag="MXAN_0572"
FT   CDS_pept        659640..660470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0572"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92333"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET2"
FT                   /protein_id="ABF92333.1"
FT   gene            660591..660932
FT                   /locus_tag="MXAN_0574"
FT   CDS_pept        660591..660932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90772"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET1"
FT                   /protein_id="ABF90772.1"
FT                   ASLFAASPP"
FT   gene            661017..661424
FT                   /locus_tag="MXAN_0575"
FT   CDS_pept        661017..661424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0575"
FT                   /product="putative arsenate reductase"
FT                   /note="identified by similarity to SP:P45947; match to
FT                   protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88276"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET0"
FT                   /protein_id="ABF88276.1"
FT   gene            661541..661960
FT                   /locus_tag="MXAN_0576"
FT   CDS_pept        661541..661960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0576"
FT                   /product="transposase orfA, IS5 family"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89081"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CVN7"
FT                   /protein_id="ABF89081.1"
FT   gene            661987..662286
FT                   /locus_tag="MXAN_0577"
FT   CDS_pept        661987..662286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0577"
FT                   /product="transposase orfB, IS5 family"
FT                   /note="identified by similarity to GB:AAN56270.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88443"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CVN8"
FT                   /protein_id="ABF88443.1"
FT   gene            complement(662323..663144)
FT                   /locus_tag="MXAN_0578"
FT   CDS_pept        complement(662323..663144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0578"
FT                   /product="tonB family protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90059"
FT                   /db_xref="GOA:Q1DES7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES7"
FT                   /protein_id="ABF90059.1"
FT   gene            complement(663275..663889)
FT                   /locus_tag="MXAN_0579"
FT   CDS_pept        complement(663275..663889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06080"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87671"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES6"
FT                   /protein_id="ABF87671.1"
FT   gene            663974..664468
FT                   /locus_tag="MXAN_0580"
FT   CDS_pept        663974..664468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89289"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES5"
FT                   /protein_id="ABF89289.1"
FT                   P"
FT   gene            664395..665138
FT                   /gene="infC"
FT                   /locus_tag="MXAN_0581"
FT   CDS_pept        664395..665138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="MXAN_0581"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by similarity to SP:P48516; match to
FT                   protein family HMM PF00707; match to protein family HMM
FT                   PF05198; match to protein family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88845"
FT                   /db_xref="GOA:Q1DES4"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DES4"
FT                   /protein_id="ABF88845.1"
FT   gene            665379..666278
FT                   /locus_tag="MXAN_0582"
FT   CDS_pept        665379..666278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90651"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES3"
FT                   /protein_id="ABF90651.1"
FT                   EALKALQSNEDGGGEGEY"
FT   gene            666308..666976
FT                   /locus_tag="MXAN_0583"
FT   CDS_pept        666308..666976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q9X081"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89591"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES2"
FT                   /protein_id="ABF89591.1"
FT                   "
FT   gene            666910..668541
FT                   /locus_tag="MXAN_0584"
FT   CDS_pept        666910..668541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90678"
FT                   /db_xref="GOA:Q1DES1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES1"
FT                   /protein_id="ABF90678.1"
FT   gene            668538..673256
FT                   /locus_tag="MXAN_0585"
FT   CDS_pept        668538..673256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P76464; match to
FT                   protein family HMM PF01835"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86815"
FT                   /db_xref="GOA:Q1DES0"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES0"
FT                   /protein_id="ABF86815.1"
FT   gene            673260..675470
FT                   /locus_tag="MXAN_0586"
FT   CDS_pept        673260..675470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0586"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89506"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER9"
FT                   /protein_id="ABF89506.1"
FT   gene            675610..676929
FT                   /locus_tag="MXAN_0587"
FT   CDS_pept        675610..676929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0587"
FT                   /product="trypsin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86192"
FT                   /db_xref="GOA:Q1DER8"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER8"
FT                   /protein_id="ABF86192.1"
FT   gene            676942..679323
FT                   /locus_tag="MXAN_0588"
FT   CDS_pept        676942..679323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87373"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER7"
FT                   /protein_id="ABF87373.1"
FT   gene            679437..681359
FT                   /locus_tag="MXAN_0589"
FT   CDS_pept        679437..681359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0589"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86609"
FT                   /db_xref="InterPro:IPR011030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER6"
FT                   /protein_id="ABF86609.1"
FT                   ASRGG"
FT   gene            681400..683172
FT                   /locus_tag="MXAN_0590"
FT   CDS_pept        681400..683172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER5"
FT                   /protein_id="ABF89046.1"
FT                   LDGQGQRVHLVLSP"
FT   gene            683169..683957
FT                   /locus_tag="MXAN_0592"
FT   CDS_pept        683169..683957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER4"
FT                   /protein_id="ABF86421.1"
FT   gene            complement(683207..683671)
FT                   /locus_tag="MXAN_0591"
FT   CDS_pept        complement(683207..683671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86563"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER3"
FT                   /protein_id="ABF86563.1"
FT   gene            complement(684014..685306)
FT                   /locus_tag="MXAN_0593"
FT   CDS_pept        complement(684014..685306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0593"
FT                   /product="glycosyltransferase, MGT family"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86560"
FT                   /db_xref="GOA:Q1DER2"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER2"
FT                   /protein_id="ABF86560.1"
FT   gene            685436..686209
FT                   /locus_tag="MXAN_0594"
FT   CDS_pept        685436..686209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0594"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89005"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER1"
FT                   /protein_id="ABF89005.1"
FT   gene            686277..687230
FT                   /locus_tag="MXAN_0595"
FT   CDS_pept        686277..687230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0595"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER0"
FT                   /protein_id="ABF91678.1"
FT   gene            687252..688010
FT                   /locus_tag="MXAN_0596"
FT   CDS_pept        687252..688010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0596"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92487"
FT                   /db_xref="GOA:Q1DEQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ9"
FT                   /protein_id="ABF92487.1"
FT   gene            688025..689521
FT                   /locus_tag="MXAN_0597"
FT   CDS_pept        688025..689521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0597"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   permease and substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89594"
FT                   /db_xref="GOA:Q1DEQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR041894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ8"
FT                   /protein_id="ABF89594.1"
FT   gene            complement(689518..690024)
FT                   /locus_tag="MXAN_0598"
FT   CDS_pept        complement(689518..690024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88233"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ7"
FT                   /protein_id="ABF88233.1"
FT                   LDEQD"
FT   gene            690915..692597
FT                   /locus_tag="MXAN_0599"
FT   CDS_pept        690915..692597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD01926.1; match to
FT                   protein family HMM PF03235; match to protein family HMM
FT                   PF07510"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90819"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ6"
FT                   /protein_id="ABF90819.1"
FT   gene            692955..693176
FT                   /locus_tag="MXAN_0600"
FT   CDS_pept        692955..693176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87102"
FT                   /db_xref="InterPro:IPR011753"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ5"
FT                   /protein_id="ABF87102.1"
FT   gene            complement(693442..693819)
FT                   /locus_tag="MXAN_0601"
FT   CDS_pept        complement(693442..693819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87507"
FT                   /db_xref="InterPro:IPR011753"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ4"
FT                   /protein_id="ABF87507.1"
FT   gene            complement(694361..695332)
FT                   /locus_tag="MXAN_0602"
FT   CDS_pept        complement(694361..695332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0602"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89276"
FT                   /db_xref="GOA:Q1DEQ3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ3"
FT                   /protein_id="ABF89276.1"
FT   gene            complement(695798..698554)
FT                   /locus_tag="MXAN_0603"
FT   CDS_pept        complement(695798..698554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0603"
FT                   /product="putative sigma-54 dependent transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90820"
FT                   /db_xref="GOA:Q1DEQ2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ2"
FT                   /protein_id="ABF90820.1"
FT   gene            698828..699913
FT                   /locus_tag="MXAN_0604"
FT   CDS_pept        698828..699913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92617"
FT                   /db_xref="GOA:Q1DEQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ1"
FT                   /protein_id="ABF92617.1"
FT   gene            complement(700129..700467)
FT                   /locus_tag="MXAN_0605"
FT   CDS_pept        complement(700129..700467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0605"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90373"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ0"
FT                   /protein_id="ABF90373.1"
FT                   VWVCPEVR"
FT   gene            complement(700496..702193)
FT                   /locus_tag="MXAN_0606"
FT   CDS_pept        complement(700496..702193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0606"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel (MscS) family"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92446"
FT                   /db_xref="GOA:Q1DEP9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP9"
FT                   /protein_id="ABF92446.1"
FT   gene            complement(702295..703710)
FT                   /locus_tag="MXAN_0607"
FT   CDS_pept        complement(702295..703710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0607"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86444"
FT                   /db_xref="GOA:Q1DEP8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP8"
FT                   /protein_id="ABF86444.1"
FT                   TKQQPPPRGTISE"
FT   gene            703703..704092
FT                   /locus_tag="MXAN_0608"
FT   CDS_pept        703703..704092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92708"
FT                   /db_xref="GOA:Q1DEP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP7"
FT                   /protein_id="ABF92708.1"
FT   gene            704174..704878
FT                   /locus_tag="MXAN_0609"
FT   CDS_pept        704174..704878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0609"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91494"
FT                   /db_xref="GOA:Q1DEP6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP6"
FT                   /protein_id="ABF91494.1"
FT                   PALRAEARRPVE"
FT   gene            705009..706769
FT                   /locus_tag="MXAN_0610"
FT   CDS_pept        705009..706769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0610"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87640"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP5"
FT                   /protein_id="ABF87640.1"
FT                   WEPARLATGA"
FT   gene            706782..707441
FT                   /locus_tag="MXAN_0611"
FT   CDS_pept        706782..707441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0611"
FT                   /product="putative acetyltransferase"
FT                   /note="identified by similarity to GB:CAA11147.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86603"
FT                   /db_xref="GOA:Q1DEP4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP4"
FT                   /protein_id="ABF86603.1"
FT   gene            707603..709774
FT                   /locus_tag="MXAN_0612"
FT   CDS_pept        707603..709774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0612"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01590; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87597"
FT                   /db_xref="GOA:Q1DEP3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP3"
FT                   /protein_id="ABF87597.1"
FT   gene            709919..711979
FT                   /locus_tag="MXAN_0613"
FT   CDS_pept        709919..711979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0613"
FT                   /product="alkaline ceramidase"
FT                   /note="identified by similarity to GB:BAA88409.1; match to
FT                   protein family HMM PF04734"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89280"
FT                   /db_xref="GOA:Q1DEP2"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="InterPro:IPR031329"
FT                   /db_xref="InterPro:IPR031331"
FT                   /db_xref="InterPro:IPR038445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP2"
FT                   /protein_id="ABF89280.1"
FT   gene            complement(711993..713477)
FT                   /locus_tag="MXAN_0614"
FT   CDS_pept        complement(711993..713477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0614"
FT                   /product="serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88229"
FT                   /db_xref="GOA:Q1DEP1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP1"
FT                   /protein_id="ABF88229.1"
FT   gene            complement(713535..714608)
FT                   /locus_tag="MXAN_0615"
FT   CDS_pept        complement(713535..714608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0615"
FT                   /product="DNA ligase, ATP-dependent"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P44121; match to
FT                   protein family HMM PF01068"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91525"
FT                   /db_xref="GOA:Q1DEP0"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP0"
FT                   /protein_id="ABF91525.1"
FT                   FPSYVGVRVDAAPFAAS"
FT   gene            714757..715245
FT                   /gene="idnK"
FT                   /locus_tag="MXAN_0616"
FT   CDS_pept        714757..715245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnK"
FT                   /locus_tag="MXAN_0616"
FT                   /product="thermosensitive gluconokinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P39208; match to
FT                   protein family HMM PF01202; match to protein family HMM
FT                   TIGR01313"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87478"
FT                   /db_xref="GOA:Q1DEN9"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN9"
FT                   /protein_id="ABF87478.1"
FT   gene            715363..716004
FT                   /locus_tag="MXAN_0617"
FT   CDS_pept        715363..716004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0617"
FT                   /product="putative carbonic anhydrase"
FT                   /note="identified by similarity to GB:AAR82947.1; match to
FT                   protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87641"
FT                   /db_xref="GOA:Q1DEN8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN8"
FT                   /protein_id="ABF87641.1"
FT   gene            716019..717719
FT                   /locus_tag="MXAN_0618"
FT   CDS_pept        716019..717719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0618"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /note="identified by match to protein family HMM PF02733;
FT                   match to protein family HMM PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89849"
FT                   /db_xref="GOA:Q1DEN7"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN7"
FT                   /protein_id="ABF89849.1"
FT   gene            complement(717747..718100)
FT                   /locus_tag="MXAN_0619"
FT   CDS_pept        complement(717747..718100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0619"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:T36952"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92302"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN6"
FT                   /protein_id="ABF92302.1"
FT                   LVDVYQTSKRWVQ"
FT   gene            complement(718232..719008)
FT                   /locus_tag="MXAN_0620"
FT   CDS_pept        complement(718232..719008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0620"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88782"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN5"
FT                   /protein_id="ABF88782.1"
FT   gene            complement(719059..719685)
FT                   /locus_tag="MXAN_0621"
FT   CDS_pept        complement(719059..719685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90967"
FT                   /db_xref="GOA:Q1DEN4"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN4"
FT                   /protein_id="ABF90967.1"
FT   gene            719871..721493
FT                   /locus_tag="MXAN_0622"
FT   CDS_pept        719871..721493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0622"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86337"
FT                   /db_xref="GOA:Q1DEN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN3"
FT                   /protein_id="ABF86337.1"
FT   gene            complement(721545..722312)
FT                   /locus_tag="MXAN_0623"
FT   CDS_pept        complement(721545..722312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0623"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM38636.1; match to
FT                   protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87252"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN2"
FT                   /protein_id="ABF87252.1"
FT   gene            complement(722305..722895)
FT                   /locus_tag="MXAN_0624"
FT   CDS_pept        complement(722305..722895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0624"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAT03682.1; match to
FT                   protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91245"
FT                   /db_xref="GOA:Q1DEN1"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN1"
FT                   /protein_id="ABF91245.1"
FT   gene            complement(722971..724410)
FT                   /locus_tag="MXAN_0625"
FT   CDS_pept        complement(722971..724410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0625"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="identified by similarity to SP:P12693; match to
FT                   protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90482"
FT                   /db_xref="GOA:Q1DEN0"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN0"
FT                   /protein_id="ABF90482.1"
FT   gene            complement(724449..725900)
FT                   /locus_tag="MXAN_0626"
FT   CDS_pept        complement(724449..725900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0626"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90874"
FT                   /db_xref="GOA:Q1DEM9"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM9"
FT                   /protein_id="ABF90874.1"
FT   gene            complement(725930..726613)
FT                   /locus_tag="MXAN_0627"
FT   CDS_pept        complement(725930..726613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0627"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93097"
FT                   /db_xref="GOA:Q1DEM8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM8"
FT                   /protein_id="ABF93097.1"
FT                   GLESR"
FT   gene            726712..727344
FT                   /locus_tag="MXAN_0628"
FT   CDS_pept        726712..727344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0628"
FT                   /product="phospholipase domain protein"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91835"
FT                   /db_xref="GOA:Q1DEM7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM7"
FT                   /protein_id="ABF91835.1"
FT   gene            complement(727476..728174)
FT                   /locus_tag="MXAN_0629"
FT   CDS_pept        complement(727476..728174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0629"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93075"
FT                   /db_xref="GOA:Q1DEM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM6"
FT                   /protein_id="ABF93075.1"
FT                   DEPELRRHTC"
FT   gene            complement(728171..729181)
FT                   /locus_tag="MXAN_0630"
FT   CDS_pept        complement(728171..729181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM5"
FT                   /protein_id="ABF86110.1"
FT   gene            complement(729488..730261)
FT                   /locus_tag="MXAN_0631"
FT   CDS_pept        complement(729488..730261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0631"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91976"
FT                   /db_xref="GOA:Q1DEM4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM4"
FT                   /protein_id="ABF91976.1"
FT   gene            complement(730342..731292)
FT                   /locus_tag="MXAN_0632"
FT   CDS_pept        complement(730342..731292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0632"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91529"
FT                   /db_xref="GOA:Q1DEM3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM3"
FT                   /protein_id="ABF91529.1"
FT   gene            complement(731387..731791)
FT                   /locus_tag="MXAN_0633"
FT   CDS_pept        complement(731387..731791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0633"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91220"
FT                   /db_xref="GOA:Q1DEM2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM2"
FT                   /protein_id="ABF91220.1"
FT   gene            732114..734216
FT                   /locus_tag="MXAN_0634"
FT   CDS_pept        732114..734216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87394"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM1"
FT                   /protein_id="ABF87394.1"
FT                   HKYFAA"
FT   gene            734257..735216
FT                   /locus_tag="MXAN_0635"
FT   CDS_pept        734257..735216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0635"
FT                   /product="ParA family protein"
FT                   /note="identified by similarity to SP:P37522; match to
FT                   protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86116"
FT                   /db_xref="GOA:Q1DEM0"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DEM0"
FT                   /protein_id="ABF86116.1"
FT   gene            735222..736436
FT                   /locus_tag="MXAN_0636"
FT   CDS_pept        735222..736436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89666"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL9"
FT                   /protein_id="ABF89666.1"
FT                   QATVR"
FT   gene            complement(736447..737433)
FT                   /locus_tag="MXAN_0637"
FT   CDS_pept        complement(736447..737433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0637"
FT                   /product="peptidase, M48 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90625"
FT                   /db_xref="GOA:Q1DEL8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL8"
FT                   /protein_id="ABF90625.1"
FT   gene            complement(737430..738038)
FT                   /locus_tag="MXAN_0638"
FT   CDS_pept        complement(737430..738038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89490"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL7"
FT                   /protein_id="ABF89490.1"
FT   gene            complement(738035..740389)
FT                   /locus_tag="MXAN_0639"
FT   CDS_pept        complement(738035..740389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0639"
FT                   /product="adenylate/guanylate cyclase domain protein"
FT                   /note="identified by match to protein family HMM PF00211;
FT                   match to protein family HMM PF05226"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91215"
FT                   /db_xref="GOA:Q1DEL6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL6"
FT                   /protein_id="ABF91215.1"
FT   gene            complement(740698..741252)
FT                   /locus_tag="MXAN_0640"
FT   CDS_pept        complement(740698..741252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06041"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90521"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL5"
FT                   /protein_id="ABF90521.1"
FT   gene            741355..741924
FT                   /locus_tag="MXAN_0641"
FT   CDS_pept        741355..741924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0641"
FT                   /product="TspO/MBR family protein"
FT                   /note="identified by match to protein family HMM PF03073"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87387"
FT                   /db_xref="GOA:Q1DEL4"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL4"
FT                   /protein_id="ABF87387.1"
FT   gene            complement(741931..742218)
FT                   /locus_tag="MXAN_0642"
FT   CDS_pept        complement(741931..742218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0642"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87145"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL3"
FT                   /protein_id="ABF87145.1"
FT   gene            complement(742253..743962)
FT                   /locus_tag="MXAN_0643"
FT   CDS_pept        complement(742253..743962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0643"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85915"
FT                   /db_xref="GOA:Q1DEL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL2"
FT                   /protein_id="ABF85915.1"
FT   gene            complement(743996..746644)
FT                   /locus_tag="MXAN_0644"
FT   CDS_pept        complement(743996..746644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0644"
FT                   /product="peptidase, M1 (aminopeptidase N) family"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF01433;
FT                   match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90010"
FT                   /db_xref="GOA:Q1DEL1"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL1"
FT                   /protein_id="ABF90010.1"
FT                   AGGRKRKATRR"
FT   gene            746826..747617
FT                   /locus_tag="MXAN_0645"
FT   CDS_pept        746826..747617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0645"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91865"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL0"
FT                   /protein_id="ABF91865.1"
FT   gene            complement(747628..748710)
FT                   /locus_tag="MXAN_0646"
FT   CDS_pept        complement(747628..748710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0646"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88821"
FT                   /db_xref="GOA:Q1DEK9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK9"
FT                   /protein_id="ABF88821.1"
FT   gene            748912..749466
FT                   /locus_tag="MXAN_0647"
FT   CDS_pept        748912..749466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0647"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86658"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK8"
FT                   /protein_id="ABF86658.1"
FT   gene            complement(749301..749993)
FT                   /locus_tag="MXAN_0649"
FT   CDS_pept        complement(749301..749993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK7"
FT                   /protein_id="ABF91044.1"
FT                   VMTMLNAW"
FT   gene            complement(749441..749572)
FT                   /locus_tag="MXAN_0648"
FT   CDS_pept        complement(749441..749572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0648"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK6"
FT                   /protein_id="ABF88202.1"
FT   gene            749547..750080
FT                   /locus_tag="MXAN_0650"
FT   CDS_pept        749547..750080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0650"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK5"
FT                   /protein_id="ABF90871.1"
FT                   CASAVRFTGRRVTE"
FT   gene            complement(750055..750471)
FT                   /locus_tag="MXAN_0651"
FT   CDS_pept        complement(750055..750471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88470"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK4"
FT                   /protein_id="ABF88470.1"
FT   gene            complement(750449..751234)
FT                   /locus_tag="MXAN_0652"
FT   CDS_pept        complement(750449..751234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86329"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK3"
FT                   /protein_id="ABF86329.1"
FT   gene            751212..753047
FT                   /locus_tag="MXAN_0653"
FT   CDS_pept        751212..753047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0653"
FT                   /product="peptidase, S8A (subtilisin) subfamily"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF01483"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91759"
FT                   /db_xref="GOA:Q1DEK2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"