(data stored in ACNUC17686 zone)

EMBL: CP000114

ID   CP000114; SV 1; circular; genomic DNA; STD; PRO; 2127839 BP.
XX
AC   CP000114;
XX
PR   Project:PRJNA326;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Streptococcus agalactiae A909, complete genome.
XX
KW   .
XX
OS   Streptococcus agalactiae A909
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RC   Erratum:[Proc Natl Acad Sci U S A. 2005 Nov 8;102(45):16530]
RP   1-2127839
RX   DOI; 10.1073/pnas.0506758102.
RX   PUBMED; 16172379.
RA   Tettelin H., Masignani V., Cieslewicz M.J., Donati C., Medini D.,
RA   Ward N.L., Angiuoli S.V., Crabtree J., Jones A.L., Durkin A.S., Deboy R.T.,
RA   Davidsen T.M., Mora M., Scarselli M., Margarit y Ros I., Peterson J.D.,
RA   Hauser C.R., Sundaram J.P., Nelson W.C., Madupu R., Brinkac L.M.,
RA   Dodson R.J., Rosovitz M.J., Sullivan S.A., Daugherty S.C., Haft D.H.,
RA   Selengut J., Gwinn M.L., Zhou L., Zafar N., Khouri H., Radune D.,
RA   Dimitrov G., Watkins K., O'Connor K.J., Smith S., Utterback T.R., White O.,
RA   Rubens C.E., Grandi G., Madoff L.C., Kasper D.L., Telford J.L.,
RA   Wessels M.R., Rappuoli R., Fraser C.M.;
RT   "Genome analysis of multiple pathogenic isolates of Streptococcus
RT   agalactiae: implications for the microbial "pan-genome"";
RL   Proc. Natl. Acad. Sci. U.S.A. 102(39):13950-13955(2005).
XX
RN   [2]
RP   1-2127839
RA   Tettelin H., Masignani V., Cieslewicz M.J., Donati C., Medini D.,
RA   Ward N.L., Angiuoli S.V., Crabtree J., Jones A.L., Durkin A.S., Deboy R.T.,
RA   Davidsen T.M., Mora M., Scarselli M., Margarit Y Ros I., Peterson J.D.,
RA   Hauser C.R., Sundaram J.P., Nelson W.C., Madupu R., Brinkac L.M.,
RA   Dodson R.J., Rosovitz M.J., Sullivan S.A., Daugherty S.C., Haft D.H.,
RA   Selengut J., Gwinn M.L., Zhou L., Zafar N., Khouri H., Radune D.,
RA   Dimitrov G., Watkins K., O'connor K.J., Smith S., Utterback T.R., White O.,
RA   Rubens C.E., Grandi G., Madoff L.C., Kasper D.L., Telford J.L.,
RA   Wessels M.R., Rappuoli R., Fraser C.M.;
RT   ;
RL   Submitted (30-AUG-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 679765a616fe30afbe72d300653f1355.
DR   BioSample; SAMN02604011.
DR   EnsemblGenomes-Gn; EBG00001195038.
DR   EnsemblGenomes-Gn; EBG00001195039.
DR   EnsemblGenomes-Gn; EBG00001195040.
DR   EnsemblGenomes-Gn; EBG00001195041.
DR   EnsemblGenomes-Gn; EBG00001195042.
DR   EnsemblGenomes-Gn; EBG00001195043.
DR   EnsemblGenomes-Gn; EBG00001195044.
DR   EnsemblGenomes-Gn; EBG00001195045.
DR   EnsemblGenomes-Gn; EBG00001195046.
DR   EnsemblGenomes-Gn; EBG00001195047.
DR   EnsemblGenomes-Gn; EBG00001195048.
DR   EnsemblGenomes-Gn; EBG00001195049.
DR   EnsemblGenomes-Gn; EBG00001195050.
DR   EnsemblGenomes-Gn; EBG00001195051.
DR   EnsemblGenomes-Gn; EBG00001195052.
DR   EnsemblGenomes-Gn; EBG00001195053.
DR   EnsemblGenomes-Gn; EBG00001195054.
DR   EnsemblGenomes-Gn; EBG00001195055.
DR   EnsemblGenomes-Gn; EBG00001195056.
DR   EnsemblGenomes-Gn; EBG00001195057.
DR   EnsemblGenomes-Gn; EBG00001195058.
DR   EnsemblGenomes-Gn; EBG00001195059.
DR   EnsemblGenomes-Gn; EBG00001195060.
DR   EnsemblGenomes-Gn; EBG00001195061.
DR   EnsemblGenomes-Gn; EBG00001195062.
DR   EnsemblGenomes-Gn; EBG00001195063.
DR   EnsemblGenomes-Gn; EBG00001195064.
DR   EnsemblGenomes-Gn; EBG00001195065.
DR   EnsemblGenomes-Gn; EBG00001195066.
DR   EnsemblGenomes-Gn; EBG00001195067.
DR   EnsemblGenomes-Gn; EBG00001195068.
DR   EnsemblGenomes-Gn; EBG00001195069.
DR   EnsemblGenomes-Gn; EBG00001195070.
DR   EnsemblGenomes-Gn; EBG00001195071.
DR   EnsemblGenomes-Gn; EBG00001195072.
DR   EnsemblGenomes-Gn; EBG00001195073.
DR   EnsemblGenomes-Gn; EBG00001195074.
DR   EnsemblGenomes-Gn; EBG00001195075.
DR   EnsemblGenomes-Gn; EBG00001195076.
DR   EnsemblGenomes-Gn; EBG00001195077.
DR   EnsemblGenomes-Gn; EBG00001195078.
DR   EnsemblGenomes-Gn; EBG00001195079.
DR   EnsemblGenomes-Gn; EBG00001195080.
DR   EnsemblGenomes-Gn; EBG00001195081.
DR   EnsemblGenomes-Gn; EBG00001195082.
DR   EnsemblGenomes-Gn; EBG00001195083.
DR   EnsemblGenomes-Gn; EBG00001195084.
DR   EnsemblGenomes-Gn; EBG00001195085.
DR   EnsemblGenomes-Gn; EBG00001195086.
DR   EnsemblGenomes-Gn; EBG00001195087.
DR   EnsemblGenomes-Gn; EBG00001195088.
DR   EnsemblGenomes-Gn; EBG00001195089.
DR   EnsemblGenomes-Gn; EBG00001195090.
DR   EnsemblGenomes-Gn; EBG00001195091.
DR   EnsemblGenomes-Gn; EBG00001195092.
DR   EnsemblGenomes-Gn; EBG00001195093.
DR   EnsemblGenomes-Gn; EBG00001195094.
DR   EnsemblGenomes-Gn; EBG00001195095.
DR   EnsemblGenomes-Gn; EBG00001195096.
DR   EnsemblGenomes-Gn; EBG00001195097.
DR   EnsemblGenomes-Gn; EBG00001195098.
DR   EnsemblGenomes-Gn; EBG00001195099.
DR   EnsemblGenomes-Gn; EBG00001195100.
DR   EnsemblGenomes-Gn; EBG00001195101.
DR   EnsemblGenomes-Gn; EBG00001195102.
DR   EnsemblGenomes-Gn; EBG00001195103.
DR   EnsemblGenomes-Gn; EBG00001195104.
DR   EnsemblGenomes-Gn; EBG00001195105.
DR   EnsemblGenomes-Gn; EBG00001195106.
DR   EnsemblGenomes-Gn; EBG00001195107.
DR   EnsemblGenomes-Gn; EBG00001195108.
DR   EnsemblGenomes-Gn; EBG00001195109.
DR   EnsemblGenomes-Gn; EBG00001195110.
DR   EnsemblGenomes-Gn; EBG00001195111.
DR   EnsemblGenomes-Gn; EBG00001195112.
DR   EnsemblGenomes-Gn; EBG00001195113.
DR   EnsemblGenomes-Gn; EBG00001195114.
DR   EnsemblGenomes-Gn; EBG00001195115.
DR   EnsemblGenomes-Gn; EBG00001195116.
DR   EnsemblGenomes-Gn; EBG00001195117.
DR   EnsemblGenomes-Gn; EBG00001195118.
DR   EnsemblGenomes-Gn; EBG00001195119.
DR   EnsemblGenomes-Gn; EBG00001195120.
DR   EnsemblGenomes-Gn; EBG00001195121.
DR   EnsemblGenomes-Gn; EBG00001195122.
DR   EnsemblGenomes-Gn; EBG00001195123.
DR   EnsemblGenomes-Gn; EBG00001195124.
DR   EnsemblGenomes-Gn; EBG00001195125.
DR   EnsemblGenomes-Gn; EBG00001195126.
DR   EnsemblGenomes-Gn; EBG00001195127.
DR   EnsemblGenomes-Gn; EBG00001195128.
DR   EnsemblGenomes-Gn; EBG00001195129.
DR   EnsemblGenomes-Gn; EBG00001195130.
DR   EnsemblGenomes-Gn; EBG00001195131.
DR   EnsemblGenomes-Gn; EBG00001195132.
DR   EnsemblGenomes-Gn; EBG00001195133.
DR   EnsemblGenomes-Gn; EBG00001195134.
DR   EnsemblGenomes-Gn; EBG00001195135.
DR   EnsemblGenomes-Gn; EBG00001195136.
DR   EnsemblGenomes-Gn; EBG00001195137.
DR   EnsemblGenomes-Gn; EBG00001195138.
DR   EnsemblGenomes-Gn; EBG00001195139.
DR   EnsemblGenomes-Gn; EBG00001195140.
DR   EnsemblGenomes-Gn; EBG00001195141.
DR   EnsemblGenomes-Gn; EBG00001195142.
DR   EnsemblGenomes-Gn; EBG00001195143.
DR   EnsemblGenomes-Gn; EBG00001195144.
DR   EnsemblGenomes-Gn; EBG00001195145.
DR   EnsemblGenomes-Gn; EBG00001195146.
DR   EnsemblGenomes-Gn; EBG00001195147.
DR   EnsemblGenomes-Gn; EBG00001195148.
DR   EnsemblGenomes-Gn; EBG00001195149.
DR   EnsemblGenomes-Gn; EBG00001195150.
DR   EnsemblGenomes-Gn; EBG00001195151.
DR   EnsemblGenomes-Gn; EBG00001195152.
DR   EnsemblGenomes-Gn; EBG00001195153.
DR   EnsemblGenomes-Gn; EBG00001195154.
DR   EnsemblGenomes-Gn; EBG00001195155.
DR   EnsemblGenomes-Gn; EBG00001195156.
DR   EnsemblGenomes-Gn; EBG00001195157.
DR   EnsemblGenomes-Gn; EBG00001195158.
DR   EnsemblGenomes-Gn; EBG00001195159.
DR   EnsemblGenomes-Gn; EBG00001195160.
DR   EnsemblGenomes-Gn; EBG00001195161.
DR   EnsemblGenomes-Gn; EBG00001195162.
DR   EnsemblGenomes-Gn; EBG00001195163.
DR   EnsemblGenomes-Gn; EBG00001195164.
DR   EnsemblGenomes-Gn; EBG00001195165.
DR   EnsemblGenomes-Gn; EBG00001195166.
DR   EnsemblGenomes-Gn; EBG00001195167.
DR   EnsemblGenomes-Gn; EBG00001195168.
DR   EnsemblGenomes-Gn; EBG00001195169.
DR   EnsemblGenomes-Gn; EBG00001195170.
DR   EnsemblGenomes-Gn; EBG00001195171.
DR   EnsemblGenomes-Gn; EBG00001195172.
DR   EnsemblGenomes-Gn; EBG00001195173.
DR   EnsemblGenomes-Gn; EBG00001195174.
DR   EnsemblGenomes-Gn; EBG00001195175.
DR   EnsemblGenomes-Gn; SAK_0016.
DR   EnsemblGenomes-Gn; SAK_0017.
DR   EnsemblGenomes-Gn; SAK_0018.
DR   EnsemblGenomes-Gn; SAK_0019.
DR   EnsemblGenomes-Gn; SAK_0020.
DR   EnsemblGenomes-Gn; SAK_0021.
DR   EnsemblGenomes-Gn; SAK_0022.
DR   EnsemblGenomes-Gn; SAK_0023.
DR   EnsemblGenomes-Gn; SAK_0024.
DR   EnsemblGenomes-Gn; SAK_0025.
DR   EnsemblGenomes-Gn; SAK_0026.
DR   EnsemblGenomes-Gn; SAK_0027.
DR   EnsemblGenomes-Gn; SAK_0028.
DR   EnsemblGenomes-Gn; SAK_0029.
DR   EnsemblGenomes-Gn; SAK_0030.
DR   EnsemblGenomes-Gn; SAK_0031.
DR   EnsemblGenomes-Gn; SAK_0032.
DR   EnsemblGenomes-Gn; SAK_0033.
DR   EnsemblGenomes-Gn; SAK_0034.
DR   EnsemblGenomes-Gn; SAK_0035.
DR   EnsemblGenomes-Gn; SAK_0036.
DR   EnsemblGenomes-Gn; SAK_0037.
DR   EnsemblGenomes-Gn; SAK_0038.
DR   EnsemblGenomes-Gn; SAK_0039.
DR   EnsemblGenomes-Gn; SAK_0040.
DR   EnsemblGenomes-Gn; SAK_0041.
DR   EnsemblGenomes-Gn; SAK_0042.
DR   EnsemblGenomes-Gn; SAK_0043.
DR   EnsemblGenomes-Gn; SAK_0044.
DR   EnsemblGenomes-Gn; SAK_0045.
DR   EnsemblGenomes-Gn; SAK_0046.
DR   EnsemblGenomes-Gn; SAK_0047.
DR   EnsemblGenomes-Gn; SAK_0048.
DR   EnsemblGenomes-Gn; SAK_0049.
DR   EnsemblGenomes-Gn; SAK_0118.
DR   EnsemblGenomes-Gn; SAK_0119.
DR   EnsemblGenomes-Gn; SAK_0120.
DR   EnsemblGenomes-Gn; SAK_0121.
DR   EnsemblGenomes-Gn; SAK_0122.
DR   EnsemblGenomes-Gn; SAK_0123.
DR   EnsemblGenomes-Gn; SAK_0124.
DR   EnsemblGenomes-Gn; SAK_0125.
DR   EnsemblGenomes-Gn; SAK_0126.
DR   EnsemblGenomes-Gn; SAK_0127.
DR   EnsemblGenomes-Gn; SAK_0128.
DR   EnsemblGenomes-Gn; SAK_0129.
DR   EnsemblGenomes-Gn; SAK_0130.
DR   EnsemblGenomes-Gn; SAK_0131.
DR   EnsemblGenomes-Gn; SAK_0132.
DR   EnsemblGenomes-Gn; SAK_0133.
DR   EnsemblGenomes-Gn; SAK_0134.
DR   EnsemblGenomes-Gn; SAK_0135.
DR   EnsemblGenomes-Gn; SAK_0136.
DR   EnsemblGenomes-Gn; SAK_0159.
DR   EnsemblGenomes-Gn; SAK_0211.
DR   EnsemblGenomes-Gn; SAK_0212.
DR   EnsemblGenomes-Gn; SAK_0213.
DR   EnsemblGenomes-Gn; SAK_0214.
DR   EnsemblGenomes-Gn; SAK_0215.
DR   EnsemblGenomes-Gn; SAK_0304.
DR   EnsemblGenomes-Gn; SAK_0305.
DR   EnsemblGenomes-Gn; SAK_0306.
DR   EnsemblGenomes-Gn; SAK_0307.
DR   EnsemblGenomes-Gn; SAK_0308.
DR   EnsemblGenomes-Gn; SAK_0309.
DR   EnsemblGenomes-Gn; SAK_0310.
DR   EnsemblGenomes-Gn; SAK_0311.
DR   EnsemblGenomes-Gn; SAK_0312.
DR   EnsemblGenomes-Gn; SAK_0313.
DR   EnsemblGenomes-Gn; SAK_0314.
DR   EnsemblGenomes-Gn; SAK_0315.
DR   EnsemblGenomes-Gn; SAK_0316.
DR   EnsemblGenomes-Gn; SAK_0317.
DR   EnsemblGenomes-Gn; SAK_0318.
DR   EnsemblGenomes-Gn; SAK_0319.
DR   EnsemblGenomes-Gn; SAK_0409.
DR   EnsemblGenomes-Gn; SAK_0410.
DR   EnsemblGenomes-Gn; SAK_0411.
DR   EnsemblGenomes-Gn; SAK_0412.
DR   EnsemblGenomes-Gn; SAK_0413.
DR   EnsemblGenomes-Gn; SAK_0450.
DR   EnsemblGenomes-Gn; SAK_0484.
DR   EnsemblGenomes-Gn; SAK_0485.
DR   EnsemblGenomes-Gn; SAK_0486.
DR   EnsemblGenomes-Gn; SAK_0487.
DR   EnsemblGenomes-Gn; SAK_0488.
DR   EnsemblGenomes-Gn; SAK_0489.
DR   EnsemblGenomes-Gn; SAK_0490.
DR   EnsemblGenomes-Gn; SAK_0491.
DR   EnsemblGenomes-Gn; SAK_0519.
DR   EnsemblGenomes-Gn; SAK_0693.
DR   EnsemblGenomes-Gn; SAK_1236.
DR   EnsemblGenomes-Gn; SAK_1238.
DR   EnsemblGenomes-Gn; SAK_1239.
DR   EnsemblGenomes-Gn; SAK_1387.
DR   EnsemblGenomes-Gn; SAK_1388.
DR   EnsemblGenomes-Gn; SAK_1855.
DR   EnsemblGenomes-Gn; SAK_1939.
DR   EnsemblGenomes-Gn; SAK_2131.
DR   EnsemblGenomes-Gn; SAK_2132.
DR   EnsemblGenomes-Gn; SAK_2133.
DR   EnsemblGenomes-Tr; EBT00001773252.
DR   EnsemblGenomes-Tr; EBT00001773253.
DR   EnsemblGenomes-Tr; EBT00001773254.
DR   EnsemblGenomes-Tr; EBT00001773255.
DR   EnsemblGenomes-Tr; EBT00001773256.
DR   EnsemblGenomes-Tr; EBT00001773257.
DR   EnsemblGenomes-Tr; EBT00001773258.
DR   EnsemblGenomes-Tr; EBT00001773259.
DR   EnsemblGenomes-Tr; EBT00001773260.
DR   EnsemblGenomes-Tr; EBT00001773261.
DR   EnsemblGenomes-Tr; EBT00001773262.
DR   EnsemblGenomes-Tr; EBT00001773263.
DR   EnsemblGenomes-Tr; EBT00001773264.
DR   EnsemblGenomes-Tr; EBT00001773265.
DR   EnsemblGenomes-Tr; EBT00001773266.
DR   EnsemblGenomes-Tr; EBT00001773267.
DR   EnsemblGenomes-Tr; EBT00001773268.
DR   EnsemblGenomes-Tr; EBT00001773269.
DR   EnsemblGenomes-Tr; EBT00001773270.
DR   EnsemblGenomes-Tr; EBT00001773271.
DR   EnsemblGenomes-Tr; EBT00001773272.
DR   EnsemblGenomes-Tr; EBT00001773273.
DR   EnsemblGenomes-Tr; EBT00001773274.
DR   EnsemblGenomes-Tr; EBT00001773275.
DR   EnsemblGenomes-Tr; EBT00001773276.
DR   EnsemblGenomes-Tr; EBT00001773277.
DR   EnsemblGenomes-Tr; EBT00001773278.
DR   EnsemblGenomes-Tr; EBT00001773279.
DR   EnsemblGenomes-Tr; EBT00001773280.
DR   EnsemblGenomes-Tr; EBT00001773281.
DR   EnsemblGenomes-Tr; EBT00001773282.
DR   EnsemblGenomes-Tr; EBT00001773283.
DR   EnsemblGenomes-Tr; EBT00001773284.
DR   EnsemblGenomes-Tr; EBT00001773285.
DR   EnsemblGenomes-Tr; EBT00001773286.
DR   EnsemblGenomes-Tr; EBT00001773287.
DR   EnsemblGenomes-Tr; EBT00001773288.
DR   EnsemblGenomes-Tr; EBT00001773289.
DR   EnsemblGenomes-Tr; EBT00001773290.
DR   EnsemblGenomes-Tr; EBT00001773291.
DR   EnsemblGenomes-Tr; EBT00001773292.
DR   EnsemblGenomes-Tr; EBT00001773293.
DR   EnsemblGenomes-Tr; EBT00001773294.
DR   EnsemblGenomes-Tr; EBT00001773295.
DR   EnsemblGenomes-Tr; EBT00001773296.
DR   EnsemblGenomes-Tr; EBT00001773297.
DR   EnsemblGenomes-Tr; EBT00001773298.
DR   EnsemblGenomes-Tr; EBT00001773299.
DR   EnsemblGenomes-Tr; EBT00001773300.
DR   EnsemblGenomes-Tr; EBT00001773301.
DR   EnsemblGenomes-Tr; EBT00001773302.
DR   EnsemblGenomes-Tr; EBT00001773303.
DR   EnsemblGenomes-Tr; EBT00001773304.
DR   EnsemblGenomes-Tr; EBT00001773305.
DR   EnsemblGenomes-Tr; EBT00001773306.
DR   EnsemblGenomes-Tr; EBT00001773307.
DR   EnsemblGenomes-Tr; EBT00001773308.
DR   EnsemblGenomes-Tr; EBT00001773309.
DR   EnsemblGenomes-Tr; EBT00001773310.
DR   EnsemblGenomes-Tr; EBT00001773311.
DR   EnsemblGenomes-Tr; EBT00001773312.
DR   EnsemblGenomes-Tr; EBT00001773313.
DR   EnsemblGenomes-Tr; EBT00001773314.
DR   EnsemblGenomes-Tr; EBT00001773315.
DR   EnsemblGenomes-Tr; EBT00001773316.
DR   EnsemblGenomes-Tr; EBT00001773317.
DR   EnsemblGenomes-Tr; EBT00001773318.
DR   EnsemblGenomes-Tr; EBT00001773319.
DR   EnsemblGenomes-Tr; EBT00001773320.
DR   EnsemblGenomes-Tr; EBT00001773321.
DR   EnsemblGenomes-Tr; EBT00001773322.
DR   EnsemblGenomes-Tr; EBT00001773323.
DR   EnsemblGenomes-Tr; EBT00001773324.
DR   EnsemblGenomes-Tr; EBT00001773325.
DR   EnsemblGenomes-Tr; EBT00001773326.
DR   EnsemblGenomes-Tr; EBT00001773327.
DR   EnsemblGenomes-Tr; EBT00001773328.
DR   EnsemblGenomes-Tr; EBT00001773329.
DR   EnsemblGenomes-Tr; EBT00001773330.
DR   EnsemblGenomes-Tr; EBT00001773331.
DR   EnsemblGenomes-Tr; EBT00001773332.
DR   EnsemblGenomes-Tr; EBT00001773333.
DR   EnsemblGenomes-Tr; EBT00001773334.
DR   EnsemblGenomes-Tr; EBT00001773335.
DR   EnsemblGenomes-Tr; EBT00001773336.
DR   EnsemblGenomes-Tr; EBT00001773337.
DR   EnsemblGenomes-Tr; EBT00001773338.
DR   EnsemblGenomes-Tr; EBT00001773339.
DR   EnsemblGenomes-Tr; EBT00001773340.
DR   EnsemblGenomes-Tr; EBT00001773341.
DR   EnsemblGenomes-Tr; EBT00001773342.
DR   EnsemblGenomes-Tr; EBT00001773343.
DR   EnsemblGenomes-Tr; EBT00001773344.
DR   EnsemblGenomes-Tr; EBT00001773345.
DR   EnsemblGenomes-Tr; EBT00001773346.
DR   EnsemblGenomes-Tr; EBT00001773347.
DR   EnsemblGenomes-Tr; EBT00001773348.
DR   EnsemblGenomes-Tr; EBT00001773349.
DR   EnsemblGenomes-Tr; EBT00001773350.
DR   EnsemblGenomes-Tr; EBT00001773351.
DR   EnsemblGenomes-Tr; EBT00001773352.
DR   EnsemblGenomes-Tr; EBT00001773353.
DR   EnsemblGenomes-Tr; EBT00001773354.
DR   EnsemblGenomes-Tr; EBT00001773355.
DR   EnsemblGenomes-Tr; EBT00001773356.
DR   EnsemblGenomes-Tr; EBT00001773357.
DR   EnsemblGenomes-Tr; EBT00001773358.
DR   EnsemblGenomes-Tr; EBT00001773359.
DR   EnsemblGenomes-Tr; EBT00001773360.
DR   EnsemblGenomes-Tr; EBT00001773361.
DR   EnsemblGenomes-Tr; EBT00001773362.
DR   EnsemblGenomes-Tr; EBT00001773363.
DR   EnsemblGenomes-Tr; EBT00001773364.
DR   EnsemblGenomes-Tr; EBT00001773365.
DR   EnsemblGenomes-Tr; EBT00001773366.
DR   EnsemblGenomes-Tr; EBT00001773367.
DR   EnsemblGenomes-Tr; EBT00001773368.
DR   EnsemblGenomes-Tr; EBT00001773369.
DR   EnsemblGenomes-Tr; EBT00001773370.
DR   EnsemblGenomes-Tr; EBT00001773371.
DR   EnsemblGenomes-Tr; EBT00001773372.
DR   EnsemblGenomes-Tr; EBT00001773373.
DR   EnsemblGenomes-Tr; EBT00001773374.
DR   EnsemblGenomes-Tr; EBT00001773375.
DR   EnsemblGenomes-Tr; EBT00001773376.
DR   EnsemblGenomes-Tr; EBT00001773377.
DR   EnsemblGenomes-Tr; EBT00001773378.
DR   EnsemblGenomes-Tr; EBT00001773379.
DR   EnsemblGenomes-Tr; EBT00001773380.
DR   EnsemblGenomes-Tr; EBT00001773381.
DR   EnsemblGenomes-Tr; EBT00001773382.
DR   EnsemblGenomes-Tr; EBT00001773383.
DR   EnsemblGenomes-Tr; EBT00001773384.
DR   EnsemblGenomes-Tr; EBT00001773385.
DR   EnsemblGenomes-Tr; EBT00001773386.
DR   EnsemblGenomes-Tr; EBT00001773387.
DR   EnsemblGenomes-Tr; EBT00001773388.
DR   EnsemblGenomes-Tr; EBT00001773389.
DR   EnsemblGenomes-Tr; SAK_0016-1.
DR   EnsemblGenomes-Tr; SAK_0017-1.
DR   EnsemblGenomes-Tr; SAK_0018-1.
DR   EnsemblGenomes-Tr; SAK_0019-1.
DR   EnsemblGenomes-Tr; SAK_0020-1.
DR   EnsemblGenomes-Tr; SAK_0021-1.
DR   EnsemblGenomes-Tr; SAK_0022-1.
DR   EnsemblGenomes-Tr; SAK_0023-1.
DR   EnsemblGenomes-Tr; SAK_0024-1.
DR   EnsemblGenomes-Tr; SAK_0025-1.
DR   EnsemblGenomes-Tr; SAK_0026-1.
DR   EnsemblGenomes-Tr; SAK_0027-1.
DR   EnsemblGenomes-Tr; SAK_0028-1.
DR   EnsemblGenomes-Tr; SAK_0029-1.
DR   EnsemblGenomes-Tr; SAK_0030-1.
DR   EnsemblGenomes-Tr; SAK_0031-1.
DR   EnsemblGenomes-Tr; SAK_0032-1.
DR   EnsemblGenomes-Tr; SAK_0033-1.
DR   EnsemblGenomes-Tr; SAK_0034-1.
DR   EnsemblGenomes-Tr; SAK_0035-1.
DR   EnsemblGenomes-Tr; SAK_0036-1.
DR   EnsemblGenomes-Tr; SAK_0037-1.
DR   EnsemblGenomes-Tr; SAK_0038-1.
DR   EnsemblGenomes-Tr; SAK_0039-1.
DR   EnsemblGenomes-Tr; SAK_0040-1.
DR   EnsemblGenomes-Tr; SAK_0041-1.
DR   EnsemblGenomes-Tr; SAK_0042-1.
DR   EnsemblGenomes-Tr; SAK_0043-1.
DR   EnsemblGenomes-Tr; SAK_0044-1.
DR   EnsemblGenomes-Tr; SAK_0045-1.
DR   EnsemblGenomes-Tr; SAK_0046-1.
DR   EnsemblGenomes-Tr; SAK_0047-1.
DR   EnsemblGenomes-Tr; SAK_0048-1.
DR   EnsemblGenomes-Tr; SAK_0049-1.
DR   EnsemblGenomes-Tr; SAK_0118-1.
DR   EnsemblGenomes-Tr; SAK_0119-1.
DR   EnsemblGenomes-Tr; SAK_0120-1.
DR   EnsemblGenomes-Tr; SAK_0121-1.
DR   EnsemblGenomes-Tr; SAK_0122-1.
DR   EnsemblGenomes-Tr; SAK_0123-1.
DR   EnsemblGenomes-Tr; SAK_0124-1.
DR   EnsemblGenomes-Tr; SAK_0125-1.
DR   EnsemblGenomes-Tr; SAK_0126-1.
DR   EnsemblGenomes-Tr; SAK_0127-1.
DR   EnsemblGenomes-Tr; SAK_0128-1.
DR   EnsemblGenomes-Tr; SAK_0129-1.
DR   EnsemblGenomes-Tr; SAK_0130-1.
DR   EnsemblGenomes-Tr; SAK_0131-1.
DR   EnsemblGenomes-Tr; SAK_0132-1.
DR   EnsemblGenomes-Tr; SAK_0133-1.
DR   EnsemblGenomes-Tr; SAK_0134-1.
DR   EnsemblGenomes-Tr; SAK_0135-1.
DR   EnsemblGenomes-Tr; SAK_0136-1.
DR   EnsemblGenomes-Tr; SAK_0159-1.
DR   EnsemblGenomes-Tr; SAK_0211-1.
DR   EnsemblGenomes-Tr; SAK_0212-1.
DR   EnsemblGenomes-Tr; SAK_0213-1.
DR   EnsemblGenomes-Tr; SAK_0214-1.
DR   EnsemblGenomes-Tr; SAK_0215-1.
DR   EnsemblGenomes-Tr; SAK_0304-1.
DR   EnsemblGenomes-Tr; SAK_0305-1.
DR   EnsemblGenomes-Tr; SAK_0306-1.
DR   EnsemblGenomes-Tr; SAK_0307-1.
DR   EnsemblGenomes-Tr; SAK_0308-1.
DR   EnsemblGenomes-Tr; SAK_0309-1.
DR   EnsemblGenomes-Tr; SAK_0310-1.
DR   EnsemblGenomes-Tr; SAK_0311-1.
DR   EnsemblGenomes-Tr; SAK_0312-1.
DR   EnsemblGenomes-Tr; SAK_0313-1.
DR   EnsemblGenomes-Tr; SAK_0314-1.
DR   EnsemblGenomes-Tr; SAK_0315-1.
DR   EnsemblGenomes-Tr; SAK_0316-1.
DR   EnsemblGenomes-Tr; SAK_0317-1.
DR   EnsemblGenomes-Tr; SAK_0318-1.
DR   EnsemblGenomes-Tr; SAK_0319-1.
DR   EnsemblGenomes-Tr; SAK_0409-1.
DR   EnsemblGenomes-Tr; SAK_0410-1.
DR   EnsemblGenomes-Tr; SAK_0411-1.
DR   EnsemblGenomes-Tr; SAK_0412-1.
DR   EnsemblGenomes-Tr; SAK_0413-1.
DR   EnsemblGenomes-Tr; SAK_0450-1.
DR   EnsemblGenomes-Tr; SAK_0484-1.
DR   EnsemblGenomes-Tr; SAK_0485-1.
DR   EnsemblGenomes-Tr; SAK_0486-1.
DR   EnsemblGenomes-Tr; SAK_0487-1.
DR   EnsemblGenomes-Tr; SAK_0488-1.
DR   EnsemblGenomes-Tr; SAK_0489-1.
DR   EnsemblGenomes-Tr; SAK_0490-1.
DR   EnsemblGenomes-Tr; SAK_0491-1.
DR   EnsemblGenomes-Tr; SAK_0519-1.
DR   EnsemblGenomes-Tr; SAK_0693-1.
DR   EnsemblGenomes-Tr; SAK_1236-1.
DR   EnsemblGenomes-Tr; SAK_1238-1.
DR   EnsemblGenomes-Tr; SAK_1239-1.
DR   EnsemblGenomes-Tr; SAK_1387-1.
DR   EnsemblGenomes-Tr; SAK_1388-1.
DR   EnsemblGenomes-Tr; SAK_1855-1.
DR   EnsemblGenomes-Tr; SAK_1939-1.
DR   EnsemblGenomes-Tr; SAK_2131-1.
DR   EnsemblGenomes-Tr; SAK_2132-1.
DR   EnsemblGenomes-Tr; SAK_2133-1.
DR   EuropePMC; PMC1216834; 16172379.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2247369; 17870297.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2493126; 18541727.
DR   EuropePMC; PMC2747082; 19328843.
DR   EuropePMC; PMC2797019; 19968877.
DR   EuropePMC; PMC2798480; 19858262.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3028816; 21115784.
DR   EuropePMC; PMC3070697; 21483735.
DR   EuropePMC; PMC3140582; 21330441.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3497532; 23144401.
DR   EuropePMC; PMC4260502; 25538698.
DR   EuropePMC; PMC4263844; 25502682.
DR   EuropePMC; PMC4313228; 25165085.
DR   EuropePMC; PMC4573720; 26283765.
DR   EuropePMC; PMC4813141; 26927064.
DR   EuropePMC; PMC5277510; 27852675.
DR   EuropePMC; PMC5648701; 28615470.
DR   EuropePMC; PMC5648781; 29051505.
DR   EuropePMC; PMC5733627; 28333320.
DR   EuropePMC; PMC6064168; 30055586.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000114.
DR   SILVA-SSU; CP000114.
DR   StrainInfo; 125890; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2127839
FT                   /organism="Streptococcus agalactiae A909"
FT                   /strain="A909"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:205921"
FT   gene            101..1462
FT                   /gene="dnaA"
FT                   /locus_tag="SAK_0001"
FT   CDS_pept        101..1462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SAK_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45205"
FT                   /db_xref="GOA:Q3K425"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K425"
FT                   /protein_id="ABA45205.1"
FT                   /translation="MTENEQLFWNRVLELSRSQIAPAAYEFFVLEARLLKIEHQTAVIT
FT                   LDNIEMKKLFWEQNLGPVILTAGFEIFNAEITANYVSNDLHLQETSFSNYQQSSNEVNT
FT                   LPIRKIDSNLKEKYTFANFVQGDENRWAVSASIAVADSPGTTYNPLFIWGGPGLGKTHL
FT                   LNAIGNQVLRDNPNARVLYITAENFINEFVSHIRLDSMEELKEKFRNLDLLLIDDIQSL
FT                   AKKTLGGTQEEFFNTFNALHTNDKQIVLTSDRNPNQLNDLEERLVTRFSWGLPVNITPP
FT                   DFETRVAILTNKIQEYPYDFPQDTIEYLAGEFDSNVRELEGALKNISLVADFKHAKTIT
FT                   VDIAAEAIRARKNDGPIVTVIPIEEIQIQVGKFYGVTVKEIKATKRTQDIVLARQVAMY
FT                   LAREMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMVAQDDNLRIEIETIKNKIR"
FT   gene            1617..2753
FT                   /gene="dnaN"
FT                   /locus_tag="SAK_0002"
FT   CDS_pept        1617..2753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SAK_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44654"
FT                   /protein_id="ABA44654.1"
FT                   /translation="MIHFSINKNFFLHALTVTKRAISHKNAIPILSTVKIEVTRDAIIL
FT                   TGSNGQISIENTIPASNENAGLLVTNPGSILLEAGFFINIISSLPDVTLEFTEIEQHQI
FT                   VLTSGKSEITLKGKDVDQYPRLQEMTTDTPLTLETKLLKSIINETAFAASQQESRPILT
FT                   GVHLVISQNKYFKAVATDSHRMSQRTFQLEKSANNFDLVVPSKSLREFSAVFTDDIETV
FT                   EVFFSDSQMLFRSENISFYTRLLEGNYPDTDRLLTNQFETEIIFNTNALRHAMERAYLI
FT                   SNATQNGTVRLEIQNETVSAHVNSPEVGKVNEELDTVSLKGDSLNISFNPTYLIESLKA
FT                   VKSETVTIRFISPVRPFTLTPGEDTEDFIQLITPVRTN"
FT   gene            2823..3704
FT                   /locus_tag="SAK_0003"
FT   CDS_pept        2823..3704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0003"
FT                   /product="diacylglycerol kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45564"
FT                   /protein_id="ABA45564.1"
FT                   /translation="MTLYIIANPHAGNKNASTIVGQIQELYHTEDISVFYTEQKDDEKK
FT                   QVINILRSFKESDHLMIIGGDGTLSKVMTYLPQHIPCAYYPVGSGNDFARALKIPNLKE
FT                   TLTAIQTERLKEINCFIYDKGLILNSLDLGFAAYVVWKASNSKIKNILNRYRLGKITYI
FT                   VIAIKSLLHSSKVQVLVEGETGQQIKLNDLYFFALANNTYFGGGITIWPKASALTAELD
FT                   MVYAKGYTFLKRLSILLSLVFKRHTTSKSIKHQTFKAMTVYFPKNSLIEIDGEIVELDQ
FT                   ISLKCQKRYLYM"
FT   gene            3714..3911
FT                   /locus_tag="SAK_0004"
FT   CDS_pept        3714..3911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN57796.1; match to
FT                   protein family HMM PF06107"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45780"
FT                   /protein_id="ABA45780.1"
FT                   /translation="MYQVGSLVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFERKLKKVLQP"
FT   gene            4113..4229
FT                   /locus_tag="SAK_0005"
FT   CDS_pept        4113..4229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44647"
FT                   /protein_id="ABA44647.1"
FT                   /translation="MDNLIRLAEIFDVSLDEHVLANTNEVKVERIYEKNLDL"
FT   gene            4473..5588
FT                   /gene="ychF"
FT                   /locus_tag="SAK_0006"
FT   CDS_pept        4473..5588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="SAK_0006"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF06071;
FT                   match to protein family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45684"
FT                   /protein_id="ABA45684.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEEEAKVVKGLFLLTTKPVLYVANVDEDKVADPD
FT                   DIDYVNQIRAFAETESAEVVVISARAEEEISELDDEDKLEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLIQYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            5672..6247
FT                   /gene="pth"
FT                   /locus_tag="SAK_0007"
FT   CDS_pept        5672..6247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SAK_0007"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44805"
FT                   /db_xref="GOA:Q3K419"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K419"
FT                   /protein_id="ABA44805.1"
FT                   /translation="MVKMIVGLGNPGSKYNDTKHNIGFMAIDRIVKNLDVNFTEDKNFK
FT                   AEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRF
FT                   RQKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMISNT
FT                   LDKVDNAVKYYLQTNDFQKTMQKYNGLK"
FT   gene            6244..9741
FT                   /gene="mfd"
FT                   /locus_tag="SAK_0008"
FT   CDS_pept        6244..9741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SAK_0008"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45805"
FT                   /protein_id="ABA45805.1"
FT                   /translation="MNIIELFSQNKVVRTWHSGLVTNSRQLVMGFSGASKAIAIASAYE
FT                   KLSKKIMVVTATQNDSDKLSSDISSLIGEDNVYQFFADDVPAAEFIFSSLDKSISRLSA
FT                   LRFLKDPEKNGVLITSISGLRLLLPNPEVFSKSQYKFEIGQECYLDKLSKNLVNLGYQK
FT                   VSQVFSPGEFSQRGDILDIFEMTQEYPYRLEFFGDEIDGIRQFDIDTQKSLKQLESVQI
FT                   SPADDIILQDADFERAKKKLEGYLVTASEVQRAYLSEVLSATENHFKHSDIRRFLSIFY
FT                   EKEWGILDYIPEGTPLFVDDFQKIVDRNAKLDLEIASLLTEDLQQGKSHSSLNYFSDPY
FT                   KQLRQYQPATFFSNFHKGLGNLKFDKLHHFTQYGMQEFFNQFPLLVDEINRYKKAGATV
FT                   LLQVDSQKGLNLLQENLKEYGLDLIISDKNDIAPKESQLIVGHLSNGFYFADEKIVLIT
FT                   EREIYHRRVKRKIRRSNISNAERLKDYNELSVGDYVVHNVHGVGKFLGIETIEIQGIHR
FT                   DYLTIQYQNADRISIPVEQIELLTKYVSADGKEPKINTLNDGRFKKAKQRVAKQVEDIA
FT                   DDLLKLYAERSQLQGFAFSPDDNMQNDFDNDFAYVETEDQLRSIKEIKQDMEGNRPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHFENFKERFSNYPVTVDVL
FT                   SRFRSKKEQTDTLKRLSKGQVDIIIGTHRLLSQDVVFSDLGLIVIDEEQRFGVKHKEKL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLETNPGLVREA
FT                   IIREIDRGGQVFYVYNKVDTIEQKVSELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFVENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KVLTEISEKRLDAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIATKQGKSLIRQKGNAELALQIDAYLPAEYISDERQKIEIYKRIRELETRADYEA
FT                   LQDELIDRFGEYPDQVAYLLEIGLLKAYLDLAFTELVERKGNEISILFEKASLKYFLTQ
FT                   DYFEALSKTQLKARISETNGKMEVVFNIKHKKNYEIIEELLKFAECFIKIKSRKPVEE"
FT   gene            10032..10304
FT                   /locus_tag="SAK_0009"
FT   CDS_pept        10032..10304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0009"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44612"
FT                   /protein_id="ABA44612.1"
FT                   /translation="MRLDKYLKVSRIIKRRPVAKEVADKGRVKVNGVLAKSSTDLKLND
FT                   QVEIRFGNKLLTVKVLEMKDSTKKEDAIKMYEIINETRIETDEQA"
FT   gene            10291..10662
FT                   /locus_tag="SAK_0010"
FT   CDS_pept        10291..10662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN57801.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46195"
FT                   /protein_id="ABA46195.1"
FT                   /translation="MSKPNVVQLNNQYINDENLKKRYEAEELRRKNRLMGWVLIFVMLL
FT                   FILPTYNLVKSYRTLQERRQEVVKLTKDYQTLTNRTENQKLLAKQLKNPDYVQKYARAK
FT                   YYFSKTGEMIYPLPDLLPK"
FT   gene            10665..10799
FT                   /locus_tag="SAK_0011"
FT   CDS_pept        10665..10799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63104.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44557"
FT                   /protein_id="ABA44557.1"
FT                   /translation="MNNLIETIEHFLAYSDDKLEELADKNYQLRQTIVEKEKIESREK"
FT   gene            10799..12085
FT                   /locus_tag="SAK_0012"
FT   CDS_pept        10799..12085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK33154.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44548"
FT                   /protein_id="ABA44548.1"
FT                   /translation="MKKVLTFLLCSLYFVSIPAISTEEPLTLSQNRRYALTQTVVDKEM
FT                   YFDAIPERPTTKIEISSFQDEALTITGETLVPNTLLSIVSLTINSNGIPVFTLSNGQFI
FT                   KASREAIFNDLVSKQQSVSLDYWLKPSFVTYEAPYTNGVSEVKNNLKPYSRVHLVEQAE
FT                   TEHGIYYKTDSGFWISVEDLSVADNRIAKVQEVLLEKYNKDKYGIYIKQLNTQTVAGIN
FT                   IDRSMYSASIAKLATLYASQEQVKLGKLSLDSKFEYKDNVNQFPNSYDPSGSGKLEKKA
FT                   DHKLYTVKELLEATAKESDNVATNMLGYYVNNQYDSMFQTQVDTISGMHWDMKKRQISP
FT                   QAAGKMMEAIYYQNGDIVNYLSKTDFDNTRIPKNIPVKVAHKIGDAYDYKHDAAIVYAE
FT                   QPFIMIIFTDKSSYDDITKIADDVYQVLK"
FT   gene            12087..13361
FT                   /gene="tilS"
FT                   /locus_tag="SAK_0013"
FT   CDS_pept        12087..13361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="SAK_0013"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432; match to protein
FT                   family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45691"
FT                   /protein_id="ABA45691.1"
FT                   /translation="MYNTILKDTLSKGLFTAHQKVLIAVSGGIDSINLLQFLYQYQKEL
FT                   SISIGIAHINHGQRKESEKEEEYIRQWGQIHDVPVFISYFQGIFSEDRARNHRYNFFSK
FT                   VMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPYKK
FT                   ELLPNIFHFEDASNASSDYLRNRIRNVYFPALERENNQLKDSLITLSEETECLFTALTD
FT                   LTRSIEVTNCYDFLRQTHSVQEFLLQDYISKFPDLQVSKEQFRVILKLIRTKANIDYTI
FT                   KSGYFLHKDYESFHITKIHPKTDSFKVEKRLELHNIQIFSQYLFSYGKFISQADITIPI
FT                   YDTSPIILRRRKEGDRIFLGNHTKKIRRLFIDEKITLKDREEAVIGEQNKELIFVIVAG
FT                   RTYLRKPSEHDIMKGKLYIENLEKR"
FT   gene            13366..13908
FT                   /gene="hpt"
FT                   /locus_tag="SAK_0014"
FT   CDS_pept        13366..13908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SAK_0014"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by similarity to SP:Q02522; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46119"
FT                   /protein_id="ABA46119.1"
FT                   /translation="MLENDIKKVLYSEEDIILKTKELGAKLTADYAGKNPLLVGVLKGS
FT                   VPFMAELLKHIDTHVEIDFMVVSSYHGGTTSSGEVKILKDVDTNIEGRDVIFIEDIIDT
FT                   GRTLKYLRDMFKYRQANSVKVATLFDKPEGRLVDIDADYVCYDIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEIYSK"
FT   gene            13931..15907
FT                   /gene="ftsH"
FT                   /locus_tag="SAK_0015"
FT   CDS_pept        13931..15907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SAK_0015"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to SP:P37476; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF01434; match to protein family HMM PF06480; match to
FT                   protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45460"
FT                   /protein_id="ABA45460.1"
FT                   /translation="MKNNKNNGFLKNSFIYILLIIAVITTFQYYLKGTSSQNQQISYTK
FT                   LVKQLKAGEIKSISYQPSGGVVEVSGTYKKAKTIKSANSFTFLGGSVATKVTGFNSVIL
FT                   PNDSSIKSLVSAAEENNTNIQVKHESSSGTWISYIASFLPLVIMIGFFMMMMNQGGGGG
FT                   ARGAMSFGKNKARSSSKDEVKVRFSDVAGAEEEKQELIEVVDFLKDPKRYKSLGARIPA
FT                   GVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAER
FT                   AIIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNESIIVIAATNRSDVLD
FT                   PALLRPGRFDRKVLVGQPDVKGREAILRVHAKNKPLADNVDLKVVAQQTPGFVGADLEN
FT                   VLNEAALVAARRNKKVIDASDIDEAEDRVIAGPSKKDRTISERERAMVAYHEAGHTIVG
FT                   LILSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKDDMKEQLAGLMGGRVAEEIIFN
FT                   AQTTGASNDFEQATAMARAMVTEYGMSEKLGPVQYEGNHAMIAGQMSPEKSYSAQTAQL
FT                   IDDEVRHLLNEARNKAADIINENRDTHKLIAEALLKYETLDAAQIKSIFETGKMPETEN
FT                   DEDKARALSYDEIKEKMQEEDKK"
FT   gene            16406..17912
FT                   /gene="rrsA"
FT                   /locus_tag="SAK_0016"
FT   rRNA            16406..17912
FT                   /gene="rrsA"
FT                   /locus_tag="SAK_0016"
FT                   /product="16S ribosomal RNA"
FT   gene            18002..18074
FT                   /locus_tag="SAK_0017"
FT   tRNA            18002..18074
FT                   /locus_tag="SAK_0017"
FT                   /product="tRNA-Ala"
FT   gene            18229..21131
FT                   /gene="rrlA"
FT                   /locus_tag="SAK_0018"
FT   rRNA            18229..21131
FT                   /gene="rrlA"
FT                   /locus_tag="SAK_0018"
FT                   /product="23S ribosomal RNA"
FT   gene            21206..21321
FT                   /gene="rrfA"
FT                   /locus_tag="SAK_0019"
FT   rRNA            21206..21321
FT                   /gene="rrfA"
FT                   /locus_tag="SAK_0019"
FT                   /product="5S ribosomal RNA"
FT   gene            21325..21397
FT                   /locus_tag="SAK_0020"
FT   tRNA            21325..21397
FT                   /locus_tag="SAK_0020"
FT                   /product="tRNA-Val"
FT   gene            21400..21472
FT                   /locus_tag="SAK_0021"
FT   tRNA            21400..21472
FT                   /locus_tag="SAK_0021"
FT                   /product="tRNA-Asp"
FT   gene            21475..21547
FT                   /locus_tag="SAK_0022"
FT   tRNA            21475..21547
FT                   /locus_tag="SAK_0022"
FT                   /product="tRNA-Lys"
FT   gene            21557..21638
FT                   /locus_tag="SAK_0023"
FT   tRNA            21557..21638
FT                   /locus_tag="SAK_0023"
FT                   /product="tRNA-Leu"
FT   gene            21649..21721
FT                   /locus_tag="SAK_0024"
FT   tRNA            21649..21721
FT                   /locus_tag="SAK_0024"
FT                   /product="tRNA-Thr"
FT   gene            21755..21826
FT                   /locus_tag="SAK_0025"
FT   tRNA            21755..21826
FT                   /locus_tag="SAK_0025"
FT                   /product="tRNA-Gly"
FT   gene            21835..21919
FT                   /locus_tag="SAK_0026"
FT   tRNA            21835..21919
FT                   /locus_tag="SAK_0026"
FT                   /product="tRNA-Leu"
FT   gene            21931..22004
FT                   /locus_tag="SAK_0027"
FT   tRNA            21931..22004
FT                   /locus_tag="SAK_0027"
FT                   /product="tRNA-Arg"
FT   gene            22012..22085
FT                   /locus_tag="SAK_0028"
FT   tRNA            22012..22085
FT                   /locus_tag="SAK_0028"
FT                   /product="tRNA-Pro"
FT   gene            22238..23744
FT                   /gene="rrsB"
FT                   /locus_tag="SAK_0029"
FT   rRNA            22238..23744
FT                   /gene="rrsB"
FT                   /locus_tag="SAK_0029"
FT                   /product="16S ribosomal RNA"
FT   gene            23834..23906
FT                   /locus_tag="SAK_0030"
FT   tRNA            23834..23906
FT                   /locus_tag="SAK_0030"
FT                   /product="tRNA-Ala"
FT   gene            24061..26963
FT                   /gene="rrlB"
FT                   /locus_tag="SAK_0031"
FT   rRNA            24061..26963
FT                   /gene="rrlB"
FT                   /locus_tag="SAK_0031"
FT                   /product="23S ribosomal RNA"
FT   gene            27038..27153
FT                   /gene="rrfB"
FT                   /locus_tag="SAK_0032"
FT   rRNA            27038..27153
FT                   /gene="rrfB"
FT                   /locus_tag="SAK_0032"
FT                   /product="5S ribosomal RNA"
FT   gene            27157..27229
FT                   /locus_tag="SAK_0033"
FT   tRNA            27157..27229
FT                   /locus_tag="SAK_0033"
FT                   /product="tRNA-Val"
FT   gene            27232..27304
FT                   /locus_tag="SAK_0034"
FT   tRNA            27232..27304
FT                   /locus_tag="SAK_0034"
FT                   /product="tRNA-Asp"
FT   gene            27307..27379
FT                   /locus_tag="SAK_0035"
FT   tRNA            27307..27379
FT                   /locus_tag="SAK_0035"
FT                   /product="tRNA-Lys"
FT   gene            27389..27470
FT                   /locus_tag="SAK_0036"
FT   tRNA            27389..27470
FT                   /locus_tag="SAK_0036"
FT                   /product="tRNA-Leu"
FT   gene            27481..27553
FT                   /locus_tag="SAK_0037"
FT   tRNA            27481..27553
FT                   /locus_tag="SAK_0037"
FT                   /product="tRNA-Thr"
FT   gene            27587..27658
FT                   /locus_tag="SAK_0038"
FT   tRNA            27587..27658
FT                   /locus_tag="SAK_0038"
FT                   /product="tRNA-Gly"
FT   gene            27667..27751
FT                   /locus_tag="SAK_0039"
FT   tRNA            27667..27751
FT                   /locus_tag="SAK_0039"
FT                   /product="tRNA-Leu"
FT   gene            27763..27836
FT                   /locus_tag="SAK_0040"
FT   tRNA            27763..27836
FT                   /locus_tag="SAK_0040"
FT                   /product="tRNA-Arg"
FT   gene            27844..27917
FT                   /locus_tag="SAK_0041"
FT   tRNA            27844..27917
FT                   /locus_tag="SAK_0041"
FT                   /product="tRNA-Pro"
FT   gene            27933..28006
FT                   /locus_tag="SAK_0042"
FT   tRNA            27933..28006
FT                   /locus_tag="SAK_0042"
FT                   /product="tRNA-Met"
FT   gene            28026..28099
FT                   /locus_tag="SAK_0043"
FT   tRNA            28026..28099
FT                   /locus_tag="SAK_0043"
FT                   /product="tRNA-Met"
FT   gene            28115..28204
FT                   /locus_tag="SAK_0044"
FT   tRNA            28115..28204
FT                   /locus_tag="SAK_0044"
FT                   /product="tRNA-Ser"
FT   gene            28215..28288
FT                   /locus_tag="SAK_0045"
FT   tRNA            28215..28288
FT                   /locus_tag="SAK_0045"
FT                   /product="tRNA-Met"
FT   gene            28291..28363
FT                   /locus_tag="SAK_0046"
FT   tRNA            28291..28363
FT                   /locus_tag="SAK_0046"
FT                   /product="tRNA-Phe"
FT   gene            28383..28453
FT                   /locus_tag="SAK_0047"
FT   tRNA            28383..28453
FT                   /locus_tag="SAK_0047"
FT                   /product="tRNA-Gly"
FT   gene            28488..28561
FT                   /locus_tag="SAK_0048"
FT   tRNA            28488..28561
FT                   /locus_tag="SAK_0048"
FT                   /product="tRNA-Ile"
FT   gene            28575..28662
FT                   /locus_tag="SAK_0049"
FT   tRNA            28575..28662
FT                   /locus_tag="SAK_0049"
FT                   /product="tRNA-Ser"
FT   gene            28898..30199
FT                   /gene="pcsB"
FT                   /locus_tag="SAK_0050"
FT   CDS_pept        28898..30199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcsB"
FT                   /locus_tag="SAK_0050"
FT                   /product="PcsB protein"
FT                   /note="identified by similarity to GB:CAC28144.1; match to
FT                   protein family HMM PF05257"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45926"
FT                   /protein_id="ABA45926.1"
FT                   /translation="MKKRILSAVLVSGVTLGTAAVTVNADDFDSKIAATDSVINTLSGQ
FT                   QAAAQKQVTAIKGQVGALESQQSELEAQNAQLEAVSQQLGQEIQTLSNKIVARNESLKK
FT                   QVRSAQKGNLTNYINTILNSKSVSDAVNRVVAIREVVSANEKMLAQQEADKAALEAKQI
FT                   ENQNAINTVAANKQAIENNKAALATQRAQLEAAQLELSAQLTTVQNEKASLIQAKAQAE
FT                   EAARKAAEAQAESVAKAQAAAQVESATAPTETVQTQPRTEIKPSNLTATSSATTVAKTT
FT                   ATATNEPKVTQPSVVTKAVEAPKAVVSSTPRAVSKPVVRSYDSSNTYPMGQCTWGAKSM
FT                   ASWVGNYWGNANQWGASARAAGYSVGTTPRVGAVAVWPYDGGGYGHVAVVTSVANNSSI
FT                   QVMESNYAGNMSIGNYRGSFNPSASGSVYYIYPN"
FT   gene            30323..31291
FT                   /gene="prs"
FT                   /locus_tag="SAK_0051"
FT   CDS_pept        30323..31291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="SAK_0051"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by similarity to SP:P14193; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44924"
FT                   /protein_id="ABA44924.1"
FT                   /translation="MSYSNLKLFALSSNKELAKKVSQTIGIPLGQSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAESVSVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRQGLV
FT                   GDDVVVVSPDHGGVTRARKLAQCLKTPIAIIDKRRSVTKMNTSEVMNIIGNIKGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQNSAIEKLIVLDTIYL
FT                   PEERLIDKIEQISIAELIGEAIIRIHEKRPLSPLFEMNKLK"
FT   gene            31399..32574
FT                   /locus_tag="SAK_0052"
FT   CDS_pept        31399..32574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0052"
FT                   /product="aromatic amino acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="identified by similarity to GB:AAF06954.1; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45923"
FT                   /protein_id="ABA45923.1"
FT                   /translation="MTLEKRFNKYLDRIEVSLIRQFDQSISDIPGMVKLTLGEPDFTTP
FT                   DHVKEAAKSAIDANQSYYTGMSGLLALRQAAADFAKDKYNLTYNPDSEILVTIGATEAL
FT                   SASLIAILEAGDVVLLPAPAYPGYEPIVNLVGADIVEIDTRENDFRLTPEMLETAIIQQ
FT                   GEKLKAVLLNYPTNPTGITYSRQEIAALAEVLKKYDIFVISDEVYSELTYTGQQHVSIA
FT                   EYLPNQTILINGLSKSHAMTGWRVGLVYAPEAFTAQIIKSHQYMVTAASTISQFAGVEA
FT                   LSVGKNDTLPMRQEYIKRRDYIIDKMSKLGFKIIKPSGAFYIFAKIPDSYPQDSFKFCQ
FT                   DFAYQQAVAIIPGVAFGKYGEGYIRLSYAASMEVIETAMARLKVFMESYEG"
FT   gene            32564..33325
FT                   /gene="recO"
FT                   /locus_tag="SAK_0053"
FT   CDS_pept        32564..33325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SAK_0053"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45037"
FT                   /db_xref="GOA:Q3K407"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K407"
FT                   /protein_id="ABA45037.1"
FT                   /translation="MRVSQTYGLVLYNRNYREDDKLVKIFTETEGKRMFFVKHASKSKF
FT                   NAVLQPLTIAHFILKINDNGLSYIDDYKEVLAFQEINSDLFKLSYASYITSLADVAISD
FT                   NVADAQLFIFLKKTLELIEDGLDYEILTNIFEVQLLERFGVALNFHDCVFCHRAGLPFD
FT                   FSHKYSGLLCPNHYYKDERRNHLDPNMLHLINRFQSIQFDDLQTISVKPEMKLKIRQFL
FT                   DMIYDEYVGIHLKSKKFIDDLSSWGSIMKSD"
FT   gene            33415..34266
FT                   /locus_tag="SAK_0054"
FT   CDS_pept        33415..34266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0054"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45633"
FT                   /protein_id="ABA45633.1"
FT                   /translation="MKKTLYITNKLFFANWFVPVIGAVLIQVIGIIVSRRLVVKLLPDD
FT                   YKFNLYIALLLFVPILASILLFLIYFQKRDFTSLGFTKDNNILTTISGFITGSLLMFFI
FT                   YICHWLSGFVEISSSNSFSFGPFFFLFLAYFIQSLTEEILFRGYVMTTVTKFKGSFAGV
FT                   LCNSMLFSFIHFRNYGITAIALFNLFLLGIIFSILFNMTKNILFVTGVHTTWNFTMGCV
FT                   LGNKVSGGYSPVSLFRITENSSFALWNGGDFGFEGGVLCSLILVGCLAYFSLERVRVSV
FT                   RY"
FT   gene            34344..35336
FT                   /gene="plsX"
FT                   /locus_tag="SAK_0055"
FT   CDS_pept        34344..35336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SAK_0055"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44425"
FT                   /db_xref="GOA:Q3K405"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K405"
FT                   /protein_id="ABA44425.1"
FT                   /translation="MKKIAVDAMGGDYAPKAIVEGVNQAISDFSDIEVQLYGDQKKIEK
FT                   YLTVTERVSIIHTEEKINSDDEPAKAVRRKKQSSMVLGAKAVKDGVAQAFISAGNTGAL
FT                   LAAGLFVVGRIKGVDRPGLMSTMPTLDGVGFDMLDLGANAENTASHLHQYAILGSFYAK
FT                   NVRGIEIPRVGLLNNGTEETKGDSLHKEAYELLAAEPSINFIGNIEARDLMSSVADVVV
FT                   TDGFTGNAVLKTMEGTAMSIMGSLKSSIKSGGVKAKLGALLLKDSLYQLKDNMDYSSAG
FT                   GAVLFGLKAPIVKCHGSSDSKAVYSTLKQVRTMLETQVVDQLVDAFTDE"
FT   gene            35347..35586
FT                   /locus_tag="SAK_0056"
FT   CDS_pept        35347..35586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0056"
FT                   /product="acyl carrier protein, putative"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44496"
FT                   /protein_id="ABA44496.1"
FT                   /translation="MSRDEVFEKMLELLRQQLGDPQLDITPETSLHDDLAIDSIALTEF
FT                   IINLEDVFHLEIPDEAVEHMSSVQQLLDYIIEHK"
FT   gene            35710..36417
FT                   /gene="purC"
FT                   /locus_tag="SAK_0057"
FT   CDS_pept        35710..36417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SAK_0057"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by similarity to SP:Q07296; match to
FT                   protein family HMM PF01259; match to protein family HMM
FT                   TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45726"
FT                   /db_xref="GOA:Q3K403"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K403"
FT                   /protein_id="ABA45726.1"
FT                   /translation="MTNQLIYTGKAKDIYSTKDENMIRTVYKDQATMLNGARKETIDGK
FT                   GALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRF
FT                   GVEEGRVLETPIVEFYYKNDDLNDPFINDEHVKFLGIVNDEEIAYLKGETRRINELLKD
FT                   WFAQIGINLIDFKLEFGFDNDGKIILADEFSPDNCRLWDAEGNHMDKDIFRRDLGSLTD
FT                   AYQVVLDKLKTLD"
FT   gene            36685..40296
FT                   /locus_tag="SAK_0058"
FT   CDS_pept        36685..40296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0058"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01857"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44806"
FT                   /protein_id="ABA44806.1"
FT                   /translation="MQVYDVFHLAEDLLARAEKHIFSEQVTDRLLTEAEITAELDKVAF
FT                   FAIEALPGQFDQRAASSQEALLLLGGDSQVKVNTAQLYLVNKDIAEAELEAVKNYLLNP
FT                   VDSRFKDITLPLEEQAFSVSDKTIPNLDFFETYTADDFVAYKAEQGLAMEVDDLLFIQD
FT                   YFKSIGRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQATYDKYIAMR
FT                   DELDRSEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLM
FT                   FKNETHNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRAGK
FT                   LPQQVISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREK
FT                   PETGDVVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRDG
FT                   NVTRLIKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVV
FT                   VRPSDVDAFIAACNKENIDAVVVATVTEKPNLVMTWNGEIIVDLERRFLDTNGVRVVVD
FT                   AKVVDKDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGG
FT                   RYQITPTESSVQKLPVQHGVTTTASVIAQGYNPYIAEWSPYHGAAYAVIEATARLVATG
FT                   ADWSRARFSYQEYFKRMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEDL
FT                   TVPPTLVAFGVTTADSRRVLSPEFKAAGENIYYIPGQAISEDIDFDLIKANFSQFETIQ
FT                   AQHKITAASAVKYGGVLESLALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIAG
FT                   AVKIGQTQADFTVTVNGNDLAGASLLAAFEGKLEEVYPTEFEQADALEEVPAVVSDTVI
FT                   KAKETIEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVAFVTLNEAAIAESVDTMVAN
FT                   IAKANIIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGGFIIGICNGFQAL
FT                   VKSGLLPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANTNSPWLAGVEVGDIHAIPV
FT                   SHGEGKFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQI
FT                   IGKMGHSERWEDGLFQNIPGNKDQALFASAVKYFTGK"
FT   gene            40530..41984
FT                   /gene="purF"
FT                   /locus_tag="SAK_0059"
FT   CDS_pept        40530..41984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SAK_0059"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by similarity to SP:P00497; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   PF00310; match to protein family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45992"
FT                   /protein_id="ABA45992.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIV
FT                   SNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFH
FT                   DGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNPSFMGKVKEALS
FT                   TVKGGFAYLLMTEDKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVE
FT                   PGEVILIDDSGIQCDRYTDETQLAICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQE
FT                   FKQDADIIIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGID
FT                   IQTRRELISANHAVDEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYP
FT                   TPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            42012..43034
FT                   /gene="purM"
FT                   /locus_tag="SAK_0060"
FT   CDS_pept        42012..43034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SAK_0060"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45061"
FT                   /db_xref="GOA:Q3K400"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K400"
FT                   /protein_id="ABA45061.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVREPVLVSGTDGVGTKLMLAIKYQQHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGNEVLPELEGKQLKDVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDEDKVPVLPIFNA
FT                   IEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEPVYEIGRIIKKADDSVVIK
FT                   "
FT   gene            43202..43753
FT                   /gene="purN"
FT                   /locus_tag="SAK_0061"
FT   CDS_pept        43202..43753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SAK_0061"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by similarity to SP:P12040; match to
FT                   protein family HMM PF00551; match to protein family HMM
FT                   TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46209"
FT                   /protein_id="ABA46209.1"
FT                   /translation="MKIAVFASGNGSNFQIIAEQFPVSFVFSDHRDAYVLERAQNLTIP
FT                   SFAFELKEFENKAAYEQAIVNLLDKHEIDLVCLAGYMKIVGEALLSAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGIKRKQ"
FT   gene            43773..44525
FT                   /locus_tag="SAK_0062"
FT   CDS_pept        43773..44525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0062"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45340"
FT                   /protein_id="ABA45340.1"
FT                   /translation="MKLVKNLEIVESIFGDWDETIIWSCVQGIMGEVFVDSLDQPKSSL
FT                   AKLGRKSSFGFLAGQPTLFLLEVCSGEDIILVPQHKGWSDLIESTYGQNAHSFKRYATK
FT                   KDTLFERSRLEKFVTQLPNGFELRAIDEKVYNSCLEKEWSQDLVANYATYQYYKKQGIG
FT                   YVVYYQGNIIAGASSYSTYKNGIEIEVDTHPDFRRRGLATIVAAQLILTCLDKEIYPSW
FT                   DAHTRTSLNLAEKLGYEFSHEYIAYEID"
FT   gene            44545..46092
FT                   /gene="purH"
FT                   /locus_tag="SAK_0063"
FT   CDS_pept        44545..46092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SAK_0063"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /note="identified by similarity to SP:P12048; match to
FT                   protein family HMM PF01808; match to protein family HMM
FT                   PF02142; match to protein family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45457"
FT                   /db_xref="GOA:Q3K3Z7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3Z7"
FT                   /protein_id="ABA45457.1"
FT                   /translation="MTKRALISVSDKSGIVDFAKELKNLGWDIISTGGTKVSLDDAGVE
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDADSHLQAAKDNNIELIDLVVVNLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYATVLGELADASQT
FT                   TFKTRQRLAAKAFRHTAAYDALIAEYFTAQVGEAKPEKLTITYDLKQAMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKASPTVVALKHMNPCGI
FT                   GQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAGKMHPIFLEIIIAPSYSEEALA
FT                   ILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPT
FT                   EQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAV
FT                   LASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQESIDAANKHGLTMIFTGVRHFRH"
FT   gene            46285..47184
FT                   /gene="zooA"
FT                   /locus_tag="SAK_0064"
FT   CDS_pept        46285..47184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zooA"
FT                   /locus_tag="SAK_0064"
FT                   /product="zoocin A"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to GB:AAC46072.1; match to
FT                   protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44545"
FT                   /protein_id="ABA44545.1"
FT                   /translation="MNKWLVKASSLVVLGGMVLSAGSRVLADTYVRPIDNGRITTGFNG
FT                   YPGHCGVDYAVPTGTIIRAVADGTVKFAGAGANFSWMTDLAGNCVMIQHADGMHSGYAH
FT                   MSRVVARTGEKVKQGDIIGYVGATGMATGPHLHFEFLPANPNFQNGFHGRINPTSLIAN
FT                   VATFSGKTQASAPSIKPLQSAPVQNQSSKLKVYRVDELQKVNGVWLVKNNTLTPTGFDW
FT                   NDNGIPASEIDEVDANGNLTADQVLQKGGYFIFNPKTLKTVEKPIQGTAGLTWAKTRFA
FT                   NGSSVWLRVDNSQELLYK"
FT   gene            47331..48635
FT                   /gene="sip"
FT                   /locus_tag="SAK_0065"
FT   CDS_pept        47331..48635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sip"
FT                   /locus_tag="SAK_0065"
FT                   /product="group B streptococcal surface immunogenic
FT                   protein"
FT                   /note="identified by similarity to GB:AAG18477.1; match to
FT                   protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45688"
FT                   /protein_id="ABA45688.1"
FT                   /translation="MKMNKKVLLTSTMAASLLSVASVQAQETDTTWTARTVSEVKADLV
FT                   KQDNKSSYTVKYGDTLSVISEAMSIDMNVLAKINNIADINLIYPETTLTVTYDQKSHTA
FT                   TSMKIETPATNAAGQTTATVDLKTNQVSVADQKVSLNTISEGMTPEAATTIVSPMKTYS
FT                   SAPALKSKEVLAQGQAVSQAAANEQVSPAPVKSITSEVPAAKEEVKPTQTSVSQSTTVS
FT                   PASVAAETPAPVAKVAPVRTVAAPRVASVKVVTPKVETGASPEHVSAPAVPVTTTSTAT
FT                   DSKLQATEVKSVPVAQKAPTATPVAQPASTTNAVAAHPENARLQPHVAAYKEKVASTYG
FT                   VNEFSTYRAGDPGDHGKGLAVDFIVGKNQALGNEVAQYSTQNMAANNISYVIWQQKFYS
FT                   NTNSIYGPANTWNAMPDRGGVTANHYDHVHVSFNK"
FT   gene            48882..49580
FT                   /locus_tag="SAK_0066"
FT   CDS_pept        48882..49580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0066"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF04131"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46255"
FT                   /db_xref="GOA:Q3K3Z4"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3Z4"
FT                   /protein_id="ABA46255.1"
FT                   /translation="MPHLSKEAFKKQIKNGIIVSCQALPGEPLYTESGGVMPLLALAAQ
FT                   EAGAVGIRANSVRDIKEIQEVTNLPIIGIIKREYPPQEPFITATMTEVDQLASLDIAVI
FT                   ALDCTLRERHDGLSVAEFIQKIKRKYPEQLLMADISTFEEGKNAFEAGVDFVGTTLSGY
FT                   TDYSRQEEGPDIELLNKLCQAGIDVIAEGKIHTPKQANEINHIGVAGIVVGGAITRPKE
FT                   IAERFISGLS"
FT   gene            49627..50943
FT                   /locus_tag="SAK_0067"
FT   CDS_pept        49627..50943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0067"
FT                   /product="carbohydrate uptake 1 (CUT1) family ABC
FT                   transporter, carbohydrate-binding protein"
FT                   /note="identified by similarity to GB:AAO21863.1; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45153"
FT                   /protein_id="ABA45153.1"
FT                   /translation="MSIKKSVIGFCLGAATLSMFACVDSSQSVMASEKDKVEITWWAFP
FT                   TFTQEKAKDGVGTYEKKVIKAFEKKNPNIKVKLETIDFTSGPEKITTAIEAGTAPDVLF
FT                   DAPGRIIQYGKNGKLADLNDLFTDQFIKDVNNKNIIQASKSGDKAYMYPISSAPFYMAF
FT                   NKKMLKDAGVLKLVKEGWTTSDFEKVLKALKNKGYTPGSFFANGQGGDQGPRAFFANLY
FT                   SAPITDKEVTKYTTDTKNSVKSMKKIVEWIKKGYLMNGSQYDGSADIQNFANGQTAFTI
FT                   LWAPAQPKTQAKLLESSKVDYLEVPFPSEDGKPDLEYLVNGFAVFNNKDENKVKASKKF
FT                   ITFIADDKKWGPKDVIRTGAFPVRTSFGDLYKGDKRMMKISKWTQYYSPYYNTIDGFSE
FT                   MRTLWFPMVQSVSNGDEKPADALKDFTQKANDTIKKAAK"
FT   gene            51031..51918
FT                   /locus_tag="SAK_0068"
FT   CDS_pept        51031..51918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0068"
FT                   /product="carbohydrate uptake 1 (CUT1) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44504"
FT                   /protein_id="ABA44504.1"
FT                   /translation="MRTNKLKMRETMIAYAFLAPILLFFLIFVFAPMVMGFVTSFFNYS
FT                   MTQFTFIGLANYNRMFHDSIFMKSLINTVIIVIGSVPVVVFFSLFVAANTYEKNVFSRS
FT                   FYRCVFFLPVVTGSVAVTVVWKWIYDPMSGILNYILKSGHVIEQNISWLGDKHWALLAI
FT                   IIILLTTSVGQPIILYIAAMGNIDNSLCEAARVDGANEMQVFWQIKWPSLLPTTLYIAV
FT                   ITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAVMIALI
FT                   SFAQFKILGNDVEY"
FT   gene            51928..52758
FT                   /locus_tag="SAK_0069"
FT   CDS_pept        51928..52758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0069"
FT                   /product="carbohydrate uptake 1 (CUT1) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:P94530; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45418"
FT                   /protein_id="ABA45418.1"
FT                   /translation="MKKKTFSAYNFLTALILCLLTVLFIFPFYWIMTGAFKSQPDTIII
FT                   PPQWWPKAPTLENFKALTVQNPALRWLWNSVFISIMTMFLVCCTSSMAGYVLAKKRFYG
FT                   QKILFSLFIAAMALPKQVVLVPLVRIINFMGIHDTLWAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFINVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSRNN
FT                   LTISLGVATMQAEMATNYGLIMAGAALAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            52771..53214
FT                   /locus_tag="SAK_0070"
FT   CDS_pept        52771..53214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04074;
FT                   match to protein family HMM TIGR00022"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44687"
FT                   /protein_id="ABA44687.1"
FT                   /translation="MIYDHLLNLTHYKDINPNLDLAIDYLLSHDLRNLDIGTYHISPEV
FT                   ILMVQSNQLSESFDHIFEYHKKYLDIHYVIEGHEVIKLGKGDKVEVEEYLGDIGFIKCS
FT                   EETSFDLRDNYIAFFFPEEAHQPNGMGSLDNYVKKGVLKVLMA"
FT   gene            53234..53896
FT                   /locus_tag="SAK_0071"
FT   CDS_pept        53234..53896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0071"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04854"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45476"
FT                   /protein_id="ABA45476.1"
FT                   /translation="MKKANQLIAAIFDVNNPFMQGCNVVFDLALLNLLFMITCLPLVTI
FT                   GAAKISLYRTLWQKLEGDQTNLLILYIKHLKKEWFQGMLLGLVELSILVVIIFDLTILH
FT                   YQIGFIVSFLKITCYAFLLLTVMTSIYLFPMAARYEMSLLDTVKKSFIMACLNLKWTGV
FT                   LMFLLIMTWFIMVQSSLLFMLTVSAIFIFAYTAFAYFKIIILQKQFAYFSKQQGDYQ"
FT   gene            53893..54810
FT                   /locus_tag="SAK_0072"
FT   CDS_pept        53893..54810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0072"
FT                   /product="N-acetylneuraminate lyase, putative"
FT                   /note="identified by similarity to SP:P06995; match to
FT                   protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44487"
FT                   /protein_id="ABA44487.1"
FT                   /translation="MKDLQKYQGIIPAFYACYDDKGDICPERVKALTNYFIDKGVQGLY
FT                   VNGSSGECIYQSVADRKLVLENVMSVAKGKLTVIAHVACNNTKDSVELAMHAEAIGVDA
FT                   IAAIPPIYFRLPEYAIADYWNTISQAAPQTDFIIYNIPQLAGVALTSDLYRKMLQNPQV
FT                   IGVKNSSMPVQDIQNFVAIGGENHIVFNGPDEQFLGGRLMGAAAGIGGTYGVMPELYLT
FT                   LNQLIVDKDLEKARELQFTINDIITKLCSGHGNMYAVIKAVLEINEQLTIGSVRLPLAS
FT                   VTEEDKPIIKEAAEMIRHAKKQFC"
FT   gene            54827..55708
FT                   /locus_tag="SAK_0073"
FT   CDS_pept        54827..55708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0073"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45848"
FT                   /protein_id="ABA45848.1"
FT                   /translation="MTRTVAIDIGGTMIKHGIVDNLGCIVEASELATEAYKGGPGILQK
FT                   VCQIIDNYLTEGSIDGIAISSAGMVDPDEGCIFYSGPQIPNYAGTQFKKVLEDTYQVRT
FT                   EIENDVNCAGLAEAVSGSAKDSSIALCLTIGTGIGGCLIIDKTVFHGFSNSACEVGYMH
FT                   LSDGDFQDLASTTALIADVAKAHGDEISRWDGRRIFQEAKKGNEKCIASIDRMINYLGQ
FT                   GIANMVYVVNPEKVVLGGGIMAQKDYLQDKLSESLKRNLVTSLAEKTTIVFAQHENQAG
FT                   MLGAYYHFKNRG"
FT   gene            55716..56693
FT                   /locus_tag="SAK_0074"
FT   CDS_pept        55716..56693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0074"
FT                   /product="acetyl xylan esterase, putative"
FT                   /note="identified by similarity to GB:AAB68821.1; match to
FT                   protein family HMM PF05448"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44936"
FT                   /protein_id="ABA44936.1"
FT                   /translation="MIETMSLDDMREYLGQDQIPEDFDDFWKKQTMKYQGNIEYRLDKK
FT                   DFNITFAQAYDLHFKGSNDSIVYAKCLFPKTNKPYPVVFYFHGYQNQSPDWSDQLNYVA
FT                   AGYGVVSMDVRGQAGQSQDKGHFDGITVKGQIVRGMISGPNHLFYKDIYLDVFQLIDIV
FT                   ATLESVDSNQLYSYGWSQGGALALIAAALNPKIVKTVAVYPFLSDFRRVLDLGNVSEPY
FT                   DELFRYFKYSDPFHKTENNVLKTLAYIDVKNFAHRISCPVVLLTALKDDICPPSTQFAI
FT                   FNRLTSTKKHLLLPDYGHDPMTVQVKDYIFDQLTGSQFTKQKIE"
FT   gene            complement(56716..57519)
FT                   /locus_tag="SAK_0075"
FT   CDS_pept        complement(56716..57519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0075"
FT                   /product="phosphosugar-binding transcriptional regulator,
FT                   RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46034"
FT                   /protein_id="ABA46034.1"
FT                   /translation="MTIYDQIESALDLMTDLEREIACYFMGQPISKDALASSIVTKQLH
FT                   ISQAALTRFAKKCGFKGYREFVFEYLKSHETISQQLYGLQNDNTKKVFMNYQEMVSKSA
FT                   DIIDEEQLLEVSHMIEQADRVYFYGKGSSSLVAKEFKIRLMRLGVICEALDDTDSFSWT
FT                   NSIVNDRCLVIAFSLSGNTNSVIGALKIASCHGAKTVLFTKQPHTIDYAFDKIIQVASA
FT                   RHLDYGNRISPQIPMLIMVDIIYAQFLDINKIEKERIFRETIIQR"
FT   gene            57802..59064
FT                   /gene="purD"
FT                   /locus_tag="SAK_0076"
FT   CDS_pept        57802..59064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SAK_0076"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by similarity to GB:CAA04374.1; match to
FT                   protein family HMM PF01071; match to protein family HMM
FT                   PF02842; match to protein family HMM PF02843; match to
FT                   protein family HMM PF02844; match to protein family HMM
FT                   TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46028"
FT                   /protein_id="ABA46028.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGLGLV
FT                   NIGISEHSRLIDFAKENEIAWTFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSK
FT                   DFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFANGDKFYIMPTAQDHKRAFDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVETIVKPVLEGMIAEGRPYLGVLYAGLILTADGPK
FT                   VIEFNSRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQKDGVTLGVVVASEGYPL
FT                   DYEKGVPLPEKTDGDIITYYAGAKLAENSKALLSNGGRVYMLVTTEDSVKAGQDKIYTQ
FT                   LAQQDTTGLFYRNDIGSKAIK"
FT   gene            59350..59838
FT                   /gene="purE"
FT                   /locus_tag="SAK_0077"
FT   CDS_pept        59350..59838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SAK_0077"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to SP:P12044; match to
FT                   protein family HMM PF00731; match to protein family HMM
FT                   TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44380"
FT                   /protein_id="ABA44380.1"
FT                   /translation="MQPIISIIMGSKSDWTTMQKTAEVLDNFGIAYEKKVVSAHRTPDL
FT                   MFKHAEEARDRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDQNLADALAHFHEEQGKIAEESSNELI"
FT   gene            59825..60916
FT                   /gene="purK"
FT                   /locus_tag="SAK_0078"
FT   CDS_pept        59825..60916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SAK_0078"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to SP:P12045; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45521"
FT                   /protein_id="ABA45521.1"
FT                   /translation="MNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITLDPASDCPASRVS
FT                   EVVVAPYDDVEALGQLAARCDILTYEFENVDADGLDAVVSAGHLPQGTDLLRISQNRIF
FT                   EKDFLANKAGVTVAPYKVVTSSLDLEGIDLTKTYVLKTATGGYDGHGQKVIRSAEDLSE
FT                   AQQLANSAQCVLEEFVNFDLEISVIVSGNGQDVTVFPVQENIHRNNILSKTIVPARISD
FT                   QLADKAKEMAVQIAKKLQLSGTLCVEMFATADDIIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGQPLPPIKLHAPAVMLNVLGQHVQQAIDYVAENPSAHLHMYGKLEAKHNRK
FT                   MGHVTVFSNTPDEVEEFEERMDF"
FT   gene            60969..62360
FT                   /locus_tag="SAK_0079"
FT   CDS_pept        60969..62360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0079"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44632"
FT                   /protein_id="ABA44632.1"
FT                   /translation="MNRIINRDILPRISKISKNNKEKDLLSIAYITWLIFIIFALGVVT
FT                   VNDLKPMFNQLIVNLLNIYYYMEAFILGMDSYLQYNLPYSFDFWSIFVEAINLFVKVFL
FT                   IAFIPFVIRKVLKKESFFNEVVILLGAIVTIILSFHLYLEILIVVGLVLLLIAFVSIGK
FT                   NRVYNFVQNLNYFEEVIWNYFEENPVEIKEKSLIIKILLTISFVFVIDFAMVRLLNFNI
FT                   KFSTILACSAILLAWLYQNKSVTEPFLLKKLAIYFIFFIATLIGNFKNESSILETPLLF
FT                   ISIFFTMDRIIALSKEMRDLIISKSILFYYDHEKIKPAILLSEMKEIKYLENVDIGELE
FT                   LVRQMVIRLRLELEEEFLILSDIYMNNGYEKYIQFVQGNVYFINLELDKTPNYANLKLI
FT                   LESIFDHNNQKIFIPKLYEEYIYILISLGEVEKAKEILREVSDYLTEESLNYFEKEYDK
FT                   AKGSN"
FT   gene            62382..63680
FT                   /gene="purB"
FT                   /locus_tag="SAK_0080"
FT   CDS_pept        62382..63680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SAK_0080"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by similarity to SP:P12047; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45767"
FT                   /protein_id="ABA45767.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQDTRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFERLGLEK"
FT   gene            63833..64741
FT                   /locus_tag="SAK_0081"
FT   CDS_pept        63833..64741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0081"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45988"
FT                   /protein_id="ABA45988.1"
FT                   /translation="MLKHFGSKVRKFRESQQVTREEFCGDESELSVRQLARIEAGESVP
FT                   NLSKAHYIARNLGVSLDSLTAGASLELSKKYKELKYLILRTPTYNDTDRLDLIEKYLDE
FT                   IYLNFYDDLPEDEKIAIESIQSSLDIYISKSHHFGDDLIREYMNQIKRKKIYSINDLLI
FT                   IKLWQYKITASRYDPNIFKIDTFIGTIDKLLNQVKVLSIENLFLLRDVLIYSLGILFIL
FT                   AEYQQIENIINTLNDILIKTQDFQKRPIIDMFEWKYQLFYKENREVAKRKYQESTLFAQ
FT                   LIGDQVLVTQLKEEWKADYIE"
FT   gene            64942..65940
FT                   /gene="ruvB"
FT                   /locus_tag="SAK_0082"
FT   CDS_pept        64942..65940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SAK_0082"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44987"
FT                   /db_xref="GOA:Q3K3X8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3X8"
FT                   /protein_id="ABA44987.1"
FT                   /translation="MTRFLDSDAMGDEELVERTLRPQYLREYIGQDKVKDQLKIFIEAA
FT                   KLRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAIEKSGDLVAILNDLEPG
FT                   DVLFIDEIHRMPMAVEEVLYSAMEDFYIDIMIGAGETSRSVHLDLPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYEENDLTEIIERTADIFEMKITYEAASELARRSRGTPRIANR
FT                   LLKRVRDYAQIMGDGLIDDNITDKALTMLDVDHEGLDYVDQKILRTMIEMYNGGPVGLG
FT                   TLSVNIAEERDTVEDMYEPYLIQKGFIMRTRTGRVATDKAYEHLGYQRFDK"
FT   gene            66092..66529
FT                   /locus_tag="SAK_0083"
FT   CDS_pept        66092..66529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0083"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="identified by similarity to SP:P24666; match to
FT                   protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45268"
FT                   /protein_id="ABA45268.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMANLDKEDSLSVESRATSTWEHGN
FT                   PIHRGTQAILQRYQIPYTNDKGSQPISKDDLAYFDYIIGMDEQNVKDLKALSQGTYDDK
FT                   ISLFCDGGVPDPWYTGDFEETYRLVNDGCKQWLTLINNSRD"
FT   gene            66536..66916
FT                   /locus_tag="SAK_0084"
FT   CDS_pept        66536..66916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0084"
FT                   /product="MORN repeat family protein"
FT                   /note="identified by match to protein family HMM PF02493"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46127"
FT                   /protein_id="ABA46127.1"
FT                   /translation="MKNFKITRTHLEILSLIIIVVFGLSVFTLTTSSQGVLSYDGGKIK
FT                   YVGSIVNHHMTGKGKLTYENGDYYKGDFVNGVFEGKGTFVSVHGWSYTGDFKKGQPDGQ
FT                   GRLNAKNKKVYKGTFKQGIYQK"
FT   gene            66913..68691
FT                   /locus_tag="SAK_0085"
FT   CDS_pept        66913..68691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0085"
FT                   /product="acyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45525"
FT                   /protein_id="ABA45525.1"
FT                   /translation="MRIKWFSLVRITGLLLVLLYHFFKNSFPGGFVGVDIFFTFSGFLI
FT                   TALLIDEFSKTKKIDFVSFCRRRFYRIFPPLVLMVLLTIPFVFLVKSDFRASIGSQIMT
FT                   ALGFTSNFYEILTGGNYESQFIPHLFVHTWSLSIEVHFYVLWGLTVWLLSKRSKDQKQL
FT                   RGTLFLISMGVFGVSFLTMFVRAFFVDNFSTIYFSTLSHIFPFFLGAMVATISGIREIT
FT                   GRFKKNIKNLTLKHNLIMMGSAFAGLMILTFALDFDNRLTYLFGFVLSSIFASVMIYNA
FT                   RILHEHTPDISEPFVITYLADISYGMYLFHWPFYIIFSRLSPNWIAVILTVVLSAVFST
FT                   LSFYVIEPFILGRKPKFLDYEFDLLPYKKWLFSIGGVLTLITVVTMLTAPSIGSFETEL
FT                   LQNSLQQARTNTNRTHTLAAGDAGALSDVTVIGDSVALRSSAAFNKLLPEVQLDAAVSR
FT                   NFSKSFDIFENRIQNKALSKIVVLAVGVNSLDNYKTDLSQFIKSLPKGHRLIIVTPYNA
FT                   KNMSQVTTVRDYELSLMKKYNYITVADWYKVATEHPEIWGNTDGVHYSDSDTTGADLYV
FT                   SNVKKAIQKSAQRAAK"
FT   gene            68961..71603
FT                   /locus_tag="SAK_0086"
FT   CDS_pept        68961..71603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0086"
FT                   /product="aldehyde-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by similarity to SP:Q24803; match to
FT                   protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45147"
FT                   /protein_id="ABA45147.1"
FT                   /translation="MTEKTKAVETTDVALAIDTLVQNGLKALDEMRQLNQEQVDYIVAK
FT                   ASVAALDAHGELALHAVEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTG
FT                   LTLIAEPVGVVCGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWIEQPSIDATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYKEFVEEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKSAVWIAEQAGFTVPEGTNILAAEC
FT                   TEVSEKEPLTREKLSPVIAVLKAESTEDGVEKARQMVEFNGLGHSAAIHTKDADLAREF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVMTVPGFIAADTGMDVLTHATEAYVSQMANDYTDGLALQAIKIV
FT                   FDYLERSVKDADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLPAATPEEAVESYAKAVYDL
FT                   GTRLGIKMNFRDQGIDEKEWKEKSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YEERPGRRK"
FT   gene            71782..72798
FT                   /locus_tag="SAK_0087"
FT   CDS_pept        71782..72798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0087"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by similarity to SP:P20368; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44500"
FT                   /protein_id="ABA44500.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPKVGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLRVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIAVYGAGGLGNLAVQYAKKVFNAHVVAVDINADKLQLAKEVGADLTVNGKEIKDVAA
FT                   YIQEKTGGCHGVVVTAVSKIAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIRV
FT                   VGSLVGTRKDLEEAFAFGAEGLVVPVVEKVPVDTAPQVFDEMERGLIQGRKVLDFTK"
FT   gene            72918..74408
FT                   /gene="thrC"
FT                   /locus_tag="SAK_0088"
FT   CDS_pept        72918..74408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="SAK_0088"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45378"
FT                   /protein_id="ABA45378.1"
FT                   /translation="MAIVYQSTRDASNKVTASQAILKGLADDGGLFTPITFPKVDLDFT
FT                   KLKDASYQEVAKLVLSAFFDDFTEQELDYCISQAYDTKFDTTEIAPLVKVGDRYHLELF
FT                   HGPTIAFKDMALSILPYLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEII
FT                   VFYPKNGVSYIQELQMITQAGQNTHVVAIEGNFDDAQTSVKEMFNNSILRSKLSQQHMQ
FT                   LSSANSMNIGRLVPQIVYYIYAYAQLVKSKEISIGQPINFSVPTGNFGNILAAYYASQI
FT                   GLPVTKLICASNDNNVLTDFFKTQTYDKNREFKVTSSPSMDILVSSNLERLIFHLLGDD
FT                   AETTKKLMEDLVTTGEYALEARQANILESFVAGFATEQFVELDIKRLFDQYQYIEDPHT
FT                   AVASAVYQAYQTETKDQTPTVIVSTASPYKFPCVVTKAITNKEEIQDFAAISILNDLSG
FT                   VSLPRAVTDLQKAEVIHRTVVPTSNMRETLEECLGLKQ"
FT   gene            74513..75793
FT                   /locus_tag="SAK_0089"
FT   CDS_pept        74513..75793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0089"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44777"
FT                   /protein_id="ABA44777.1"
FT                   /translation="MRYSKEIIQLAIPAMIENILQMLMGVVDNYLVAQLGVVAVSGVSV
FT                   ANNIITVYQAIFIALGASIASLLAKSLAGSEKDDAISVCSQAIFLTLLIGAILGIISIV
FT                   FGQTFFKLLGTTKSVAQVGGLYLAIVGGGVVTLGMLTTLGSFLRVQGQPRLPMYVSIFV
FT                   NFLNAVLSGFAIFEWRYGLVGVAVSTLIARLIGICILAKYLPIKKIIKRMTWKISAQIW
FT                   NLALPSAGERLMMRAGDVVIVAIVVQLGTNVVAGNAIGETLTQFNYMPGLGIATATIIL
FT                   TAKYVGQKNRESIEETIQSSYYIGLVLMILISSFMLLAGKPLTQLFTNNPSAIKGSLIV
FT                   ILLSFVGVPATIGTLVYTAAWQGLGNAKLPFYTTTIGMWLIRVVLGYLLGILFELGLLG
FT                   VWMATIADNIFRWLFLKVHYHRYIQKM"
FT   gene            75998..76306
FT                   /gene="rpsJ"
FT                   /locus_tag="SAK_0090"
FT   CDS_pept        75998..76306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SAK_0090"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45721"
FT                   /db_xref="GOA:Q3K3X0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3X0"
FT                   /protein_id="ABA45721.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            76411..77037
FT                   /gene="rplC"
FT                   /locus_tag="SAK_0091"
FT   CDS_pept        76411..77037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SAK_0091"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by similarity to SP:P42920; match to
FT                   protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44405"
FT                   /db_xref="GOA:Q3K3W9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W9"
FT                   /protein_id="ABA44405.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVVLIKGNVPGAKKSLITIKSAVKAAK"
FT   gene            77061..77684
FT                   /gene="rplD"
FT                   /locus_tag="SAK_0092"
FT   CDS_pept        77061..77684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SAK_0092"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by similarity to SP:P42921; match to
FT                   protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45553"
FT                   /db_xref="GOA:Q3K3W8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W8"
FT                   /protein_id="ABA45553.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNEAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVENLSFAAPKTAEFASVLSALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVTVATATTASVLDIVNADKLLVTKEAISTIEGVLA"
FT   gene            77684..77980
FT                   /gene="rplW"
FT                   /locus_tag="SAK_0093"
FT   CDS_pept        77684..77980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SAK_0093"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by similarity to SP:P42924; match to
FT                   protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45042"
FT                   /protein_id="ABA45042.1"
FT                   /translation="MNLYDVIKKPVITEKSMVALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVTVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            77998..78831
FT                   /gene="rplB"
FT                   /locus_tag="SAK_0094"
FT   CDS_pept        77998..78831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SAK_0094"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:P42919; match to
FT                   protein family HMM PF00181; match to protein family HMM
FT                   PF03947; match to protein family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45821"
FT                   /db_xref="GOA:Q3K3W6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W6"
FT                   /protein_id="ABA45821.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTNTPEKSLLVSLKNKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   LAPKGLEVGQRIISGPEADIKVGNALPLANIPVGTVIHNIELQPGKGAELIRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRNRWKGVRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK"
FT   gene            78930..79208
FT                   /gene="rpsS"
FT                   /locus_tag="SAK_0095"
FT   CDS_pept        78930..79208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SAK_0095"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by similarity to SP:P21476; match to
FT                   protein family HMM PF00203; match to protein family HMM
FT                   TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45293"
FT                   /db_xref="GOA:Q3K3W5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W5"
FT                   /protein_id="ABA45293.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   gene            79224..79568
FT                   /gene="rplV"
FT                   /locus_tag="SAK_0096"
FT   CDS_pept        79224..79568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SAK_0096"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by similarity to SP:P42060; match to
FT                   protein family HMM PF00237; match to protein family HMM
FT                   TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45318"
FT                   /db_xref="GOA:Q3K3W4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W4"
FT                   /protein_id="ABA45318.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            79581..80234
FT                   /gene="rpsC"
FT                   /locus_tag="SAK_0097"
FT   CDS_pept        79581..80234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SAK_0097"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by similarity to SP:P21465; match to
FT                   protein family HMM PF00189; match to protein family HMM
FT                   PF00417; match to protein family HMM PF07650; match to
FT                   protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45388"
FT                   /db_xref="GOA:Q3K3W3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W3"
FT                   /protein_id="ABA45388.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            80238..80651
FT                   /gene="rplP"
FT                   /locus_tag="SAK_0098"
FT   CDS_pept        80238..80651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SAK_0098"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by similarity to SP:Q9Z9K7; match to
FT                   protein family HMM PF00252; match to protein family HMM
FT                   TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44751"
FT                   /db_xref="GOA:Q3K3W2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W2"
FT                   /protein_id="ABA44751.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEVAREALRLASHKLPVKCKFVKREAE"
FT   gene            80661..80867
FT                   /gene="rpmC"
FT                   /locus_tag="SAK_0099"
FT   CDS_pept        80661..80867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SAK_0099"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by similarity to SP:P12873; match to
FT                   protein family HMM PF00831; match to protein family HMM
FT                   TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45580"
FT                   /db_xref="GOA:Q3K3W1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W1"
FT                   /protein_id="ABA45580.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   gene            80893..81153
FT                   /gene="rpsQ"
FT                   /locus_tag="SAK_0100"
FT   CDS_pept        80893..81153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SAK_0100"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by similarity to SP:P23828; match to
FT                   protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46031"
FT                   /db_xref="GOA:Q3K3W0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3W0"
FT                   /protein_id="ABA46031.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEKAVII"
FT   gene            81178..81546
FT                   /gene="rplN"
FT                   /locus_tag="SAK_0101"
FT   CDS_pept        81178..81546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SAK_0101"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by similarity to SP:P12875; match to
FT                   protein family HMM PF00238; match to protein family HMM
FT                   TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45861"
FT                   /db_xref="GOA:Q3K3V9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V9"
FT                   /protein_id="ABA45861.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            81626..81931
FT                   /gene="rplX"
FT                   /locus_tag="SAK_0102"
FT   CDS_pept        81626..81931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SAK_0102"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to SP:P04455; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46287"
FT                   /db_xref="GOA:Q3K3V8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V8"
FT                   /protein_id="ABA46287.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVVVEGVALIKKHQ
FT                   KPNNENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYNKKSGEVLD"
FT   gene            81955..82497
FT                   /gene="rplE"
FT                   /locus_tag="SAK_0103"
FT   CDS_pept        81955..82497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SAK_0103"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to SP:P12877; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45132"
FT                   /db_xref="GOA:Q3K3V7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V7"
FT                   /protein_id="ABA45132.1"
FT                   /translation="MANRLKEKYTNEVVPALTEKFNYSSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            82515..82700
FT                   /gene="rpsNA"
FT                   /locus_tag="SAK_0104"
FT   CDS_pept        82515..82700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsNA"
FT                   /locus_tag="SAK_0104"
FT                   /product="ribosomal protein S14-1"
FT                   /note="identified by similarity to SP:P12878; match to
FT                   protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45561"
FT                   /db_xref="GOA:Q3K3V6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V6"
FT                   /protein_id="ABA45561.1"
FT                   /translation="MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFQLCRVCFR
FT                   DLAYKGQVPGVTKASW"
FT   gene            82855..83253
FT                   /gene="rpsH"
FT                   /locus_tag="SAK_0105"
FT   CDS_pept        82855..83253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SAK_0105"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by similarity to SP:P12879; match to
FT                   protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44484"
FT                   /db_xref="GOA:Q3K3V5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V5"
FT                   /protein_id="ABA44484.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIADILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGQNGERVITNLKRISKPGLRVYTKHEDMPKVLNGLGIA
FT                   IVSTSEGLLTDKEARQKNVGGEVLAYIW"
FT   gene            83363..83899
FT                   /gene="rplF"
FT                   /locus_tag="SAK_0106"
FT   CDS_pept        83363..83899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SAK_0106"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by similarity to SP:P02391; match to
FT                   protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45922"
FT                   /db_xref="GOA:Q3K3V4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V4"
FT                   /protein_id="ABA45922.1"
FT                   /translation="MSRIGNKVITLPAGVEIINKDNVVTVKGPKGELTREFNKNIGITV
FT                   EGTEVTVTRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKALEMRGVGYRAQLQGSKLV
FT                   LSVGKSHQDEVEAPEGVTFEVPTPTTINVIGINKESVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            84000..84356
FT                   /gene="rplR"
FT                   /locus_tag="SAK_0107"
FT   CDS_pept        84000..84356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SAK_0107"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by similarity to SP:P46899; match to
FT                   protein family HMM PF00861; match to protein family HMM
FT                   TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45012"
FT                   /db_xref="GOA:Q3K3V3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V3"
FT                   /protein_id="ABA45012.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKLSGTADRPRLNIFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSNGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALADSARENGLKF"
FT   gene            84375..84869
FT                   /gene="rpsE"
FT                   /locus_tag="SAK_0108"
FT   CDS_pept        84375..84869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SAK_0108"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to SP:P02357; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44621"
FT                   /db_xref="GOA:Q3K3V2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V2"
FT                   /protein_id="ABA44621.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDRNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMVEVPMVGTTIPHEVRSEFGGAKVLLKPAVEGAGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            84884..85063
FT                   /gene="rpmD"
FT                   /locus_tag="SAK_0109"
FT   CDS_pept        84884..85063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SAK_0109"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by similarity to SP:Q9Z9J6; match to
FT                   protein family HMM PF00327; match to protein family HMM
FT                   TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45739"
FT                   /db_xref="GOA:Q3K3V1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V1"
FT                   /protein_id="ABA45739.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVNAISHLVTVEEA"
FT   gene            85188..85628
FT                   /gene="rplO"
FT                   /locus_tag="SAK_0110"
FT   CDS_pept        85188..85628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SAK_0110"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by similarity to SP:P19946; match to
FT                   protein family HMM PF00256; match to protein family HMM
FT                   PF01305; match to protein family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45320"
FT                   /db_xref="GOA:Q3K3V0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3V0"
FT                   /protein_id="ABA45320.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRMPKRGFSNINAKEYALVNLDQLNVFEDGTEVTPVVLKEAGIVRA
FT                   EKSGVKILGNGELTKKLSVKAAKFSKSAEAAITAKGGSIEVI"
FT   gene            85649..86953
FT                   /gene="secY"
FT                   /locus_tag="SAK_0111"
FT   CDS_pept        85649..86953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SAK_0111"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:P16336; match to
FT                   protein family HMM PF00344; match to protein family HMM
FT                   TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45450"
FT                   /protein_id="ABA45450.1"
FT                   /translation="MFLKLLRDALKVKMVRNKILFTIFILLVFRIGTHITVPGINVKSL
FT                   EQMGELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLFLAFVQSIGITAGFNTLSSVALVKTPNVQTYLLIGAILTTGSMV
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPSAITTIYEDFFVNVRSSAITNSYIFVGIL
FT                   IVAVLAIVFFTTFIQQAEYKIPIQYTKLVQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTIIPFFQNGKEIPWLTKLQELLNYQTPVGMIIYAILIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSIRPGRETEEYMSSLLKKLATIGSVFLAFISLLPIIAQQALHLSSSIALG
FT                   GTSLLILIATGIEGMKQLEGYLLKRRYVGFMNTTE"
FT   gene            87048..87686
FT                   /gene="adk"
FT                   /locus_tag="SAK_0112"
FT   CDS_pept        87048..87686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SAK_0112"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by similarity to SP:P16304; match to
FT                   protein family HMM PF00406; match to protein family HMM
FT                   TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45138"
FT                   /db_xref="GOA:Q3K3U8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3U8"
FT                   /protein_id="ABA45138.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLIERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGESILEHYRKLGLVTDIEGNQEITEVFADVEKALLELK"
FT   gene            87802..88020
FT                   /gene="infA"
FT                   /locus_tag="SAK_0113"
FT   CDS_pept        87802..88020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SAK_0113"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46261"
FT                   /db_xref="GOA:Q3K3U7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3U7"
FT                   /protein_id="ABA46261.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            88180..88545
FT                   /gene="rpsM"
FT                   /locus_tag="SAK_0114"
FT   CDS_pept        88180..88545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SAK_0114"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to SP:P20282; match to
FT                   protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45756"
FT                   /db_xref="GOA:Q3K3U6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3U6"
FT                   /protein_id="ABA45756.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLSTSKKILAAAGISEDIRV
FT                   KDLTPDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            88590..88946
FT                   /gene="rpsK"
FT                   /locus_tag="SAK_0115"
FT   CDS_pept        88590..88946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SAK_0115"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to SP:P04969; match to
FT                   protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45882"
FT                   /db_xref="GOA:Q3K3U5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3U5"
FT                   /protein_id="ABA45882.1"
FT                   /translation="MKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSR
FT                   KSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTP
FT                   VPHNGARPPKRRRV"
FT   gene            88996..89934
FT                   /gene="rpoA"
FT                   /locus_tag="SAK_0116"
FT   CDS_pept        88996..89934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SAK_0116"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P20429; match to
FT                   protein family HMM PF01000; match to protein family HMM
FT                   PF01193; match to protein family HMM PF03118; match to
FT                   protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45207"
FT                   /db_xref="GOA:Q3K3U4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3U4"
FT                   /protein_id="ABA45207.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELDVEGPAE
FT                   ITAGDILTDSDIEIVNPDHYLFTIAEGHSLKATMTVAKNRGYVPAEGNKKDDVPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKTEP
FT                   EMMKVRNLGRKSLEEVKIKLADLGLGLKNDK"
FT   gene            89949..90335
FT                   /gene="rplQ"
FT                   /locus_tag="SAK_0117"
FT   CDS_pept        89949..90335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SAK_0117"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to SP:P20277; match to
FT                   protein family HMM PF01196; match to protein family HMM
FT                   TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46311"
FT                   /db_xref="GOA:Q3K3U3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3U3"
FT                   /protein_id="ABA46311.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEASDKYTSTTALQKLFDDIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            90927..92433
FT                   /gene="rrsC"
FT                   /locus_tag="SAK_0118"
FT   rRNA            90927..92433
FT                   /gene="rrsC"
FT                   /locus_tag="SAK_0118"
FT                   /product="16S ribosomal RNA"
FT   gene            92523..92595
FT                   /locus_tag="SAK_0119"
FT   tRNA            92523..92595
FT                   /locus_tag="SAK_0119"
FT                   /product="tRNA-Ala"
FT   gene            92752..95654
FT                   /gene="rrlC"
FT                   /locus_tag="SAK_0120"
FT   rRNA            92752..95654
FT                   /gene="rrlC"
FT                   /locus_tag="SAK_0120"
FT                   /product="23S ribosomal RNA"
FT   gene            95729..95844
FT                   /gene="rrfC"
FT                   /locus_tag="SAK_0121"
FT   rRNA            95729..95844
FT                   /gene="rrfC"
FT                   /locus_tag="SAK_0121"
FT                   /product="5S ribosomal RNA"
FT   gene            95848..95920
FT                   /locus_tag="SAK_0122"
FT   tRNA            95848..95920
FT                   /locus_tag="SAK_0122"
FT                   /product="tRNA-Val"
FT   gene            95923..95995
FT                   /locus_tag="SAK_0123"
FT   tRNA            95923..95995
FT                   /locus_tag="SAK_0123"
FT                   /product="tRNA-Asp"
FT   gene            95998..96070
FT                   /locus_tag="SAK_0124"
FT   tRNA            95998..96070
FT                   /locus_tag="SAK_0124"
FT                   /product="tRNA-Lys"
FT   gene            96080..96161
FT                   /locus_tag="SAK_0125"
FT   tRNA            96080..96161
FT                   /locus_tag="SAK_0125"
FT                   /product="tRNA-Leu"
FT   gene            96172..96244
FT                   /locus_tag="SAK_0126"
FT   tRNA            96172..96244
FT                   /locus_tag="SAK_0126"
FT                   /product="tRNA-Thr"
FT   gene            96273..96349
FT                   /locus_tag="SAK_0127"
FT   tRNA            96273..96349
FT                   /locus_tag="SAK_0127"
FT                   /product="tRNA-Ile"
FT   gene            96357..96428
FT                   /locus_tag="SAK_0128"
FT   tRNA            96357..96428
FT                   /locus_tag="SAK_0128"
FT                   /product="tRNA-Glu"
FT   gene            96442..96531
FT                   /locus_tag="SAK_0129"
FT   tRNA            96442..96531
FT                   /locus_tag="SAK_0129"
FT                   /product="tRNA-Ser"
FT   gene            96542..96615
FT                   /locus_tag="SAK_0130"
FT   tRNA            96542..96615
FT                   /locus_tag="SAK_0130"
FT                   /product="tRNA-Met"
FT   gene            96618..96690
FT                   /locus_tag="SAK_0131"
FT   tRNA            96618..96690
FT                   /locus_tag="SAK_0131"
FT                   /product="tRNA-Phe"
FT   gene            96702..96782
FT                   /locus_tag="SAK_0132"
FT   tRNA            96702..96782
FT                   /locus_tag="SAK_0132"
FT                   /product="tRNA-Tyr"
FT   gene            96789..96859
FT                   /locus_tag="SAK_0133"
FT   tRNA            96789..96859
FT                   /locus_tag="SAK_0133"
FT                   /product="tRNA-Trp"
FT   gene            96874..96946
FT                   /locus_tag="SAK_0134"
FT   tRNA            96874..96946
FT                   /locus_tag="SAK_0134"
FT                   /product="tRNA-His"
FT   gene            96953..97024
FT                   /locus_tag="SAK_0135"
FT   tRNA            96953..97024
FT                   /locus_tag="SAK_0135"
FT                   /product="tRNA-Gln"
FT   gene            97035..97118
FT                   /locus_tag="SAK_0136"
FT   tRNA            97035..97118
FT                   /locus_tag="SAK_0136"
FT                   /product="tRNA-Leu"
FT   gene            97532..97963
FT                   /locus_tag="SAK_0137"
FT   CDS_pept        97532..97963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0137"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45030"
FT                   /protein_id="ABA45030.1"
FT                   /translation="MKKYVKWLIPISIIGMLLAGCQMNSESKSQSNEVKNSKQSAVKKG
FT                   KKVMKKEQVAYLKKHEKELTEYVKIQNPDISEIKYDWNSVRIVEASNGTPQGGEQLLLI
FT                   LGYANGSELTNFTLNFTLGDNQMPNIDSVGSDNLSTIED"
FT   gene            98033..98203
FT                   /locus_tag="SAK_0138"
FT   CDS_pept        98033..98203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46094"
FT                   /protein_id="ABA46094.1"
FT                   /translation="MAESANTGRSNSFVLEELTEFQREKLKNGESVKFNFSKDVKKENK
FT                   VIEGGHPQVIG"
FT   gene            99119..99670
FT                   /locus_tag="SAK_0139"
FT   CDS_pept        99119..99670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58065.1; match to
FT                   protein family HMM PF06042"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45225"
FT                   /protein_id="ABA45225.1"
FT                   /translation="MTKIYHMILCNSDIMKILAIIKSLPLNDCWLCAGTLRNFIWNKLS
FT                   GINETLTSDIDVVFFDKNISYEETVALEQQLKDNYPQYDWELKNKFYMNTHSPNTPKYT
FT                   SSKDAISKFPEKCTAVGARLDDRNQLELYLPYGEEEILNFIVSPTPYFEEDLLRYNVYL
FT                   KRVDKKKWNNIWPRLTIIKK"
FT   gene            99890..100309
FT                   /locus_tag="SAK_0140"
FT   CDS_pept        99890..100309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35217.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46340"
FT                   /protein_id="ABA46340.1"
FT                   /translation="MKMTVYFDGNFWLGLIEYDDDGDYKVFRYFFGKEPKDDDVFNFIN
FT                   HKLNDLIKKYEFVKTDISLKRTNEHKKSPKRMQREINREKRKPVVSTKAQLAMKTIHMS
FT                   IKNERQLSQKCKKNELRKHRYQLKQEKRYQKKKGH"
FT   gene            100509..100988
FT                   /gene="comX"
FT                   /locus_tag="SAK_0141"
FT   CDS_pept        100509..100988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="SAK_0141"
FT                   /product="competence-specific sigma factor ComX"
FT                   /note="identified by similarity to GB:AAD50429.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44586"
FT                   /protein_id="ABA44586.1"
FT                   /translation="MRDFEELFDKVKPIVMKLRRNYFVQLWEYDDWIQEGRIVLFRLLE
FT                   EHPYLLDNESKLFIYFKTKFSNYLNDVLRHQDCQKRQFNKMPYEEISEVSHYVKSKGLV
FT                   LDDYIAYRDTLTKVEETLSDIDKEKFEKLISGERFAGKKQFIRDIQPFFNAFKAD"
FT   gene            101110..101802
FT                   /locus_tag="SAK_0142"
FT   CDS_pept        101110..101802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0142"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45547"
FT                   /protein_id="ABA45547.1"
FT                   /translation="MSKVRLYIARHGKTMFNTIGRAQGWSDTPLTTFGELGIKELGLGL
FT                   KASNISFKEAFSSDSGRTLQTMEIILREVQQENIPYTRDKRIREWCFGSLDGGYDGDLF
FT                   NGVLPRVSNGDMSHLTHEEIANLICQVDTAGWAEPWAILSNRILSGFTAIAKKIEDIGG
FT                   GNAIVVSHGMTIATFLWLIDHSTPRSLGLDNGSVSVVDFEDGTFSIQSIGDMSYREKGR
FT                   EILEKTLQ"
FT   gene            101799..102551
FT                   /locus_tag="SAK_0143"
FT   CDS_pept        101799..102551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0143"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44613"
FT                   /protein_id="ABA44613.1"
FT                   /translation="MKKNKVIRFSLVGVLLAILCFSLFALLKPNSQQSSSQKLRNEDIK
FT                   KTSSQKRNKKLRLPAVSSKDWNLILVNRDHKHEELSPDVVPVENIYLDKRITKQATQFL
FT                   EAARAIDSREHLISGYRSVAYQEKLFNSYVTQEMTSNPNLTKEQAEKLVKTYSQPAGAS
FT                   EHQTGLAMDMSTVDSLNESDPRVVSQLKKIAPQYGFVLRFPDGKTAETGVGYEDWHYRY
FT                   VGVESAKYMAKHHLTLEEYITLLKENNQ"
FT   gene            102548..103123
FT                   /locus_tag="SAK_0144"
FT   CDS_pept        102548..103123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0144"
FT                   /product="mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase family protein"
FT                   /note="identified by match to protein family HMM PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45784"
FT                   /protein_id="ABA45784.1"
FT                   /translation="MRKRFSLLNFIVVTFIFFFFILFPLLNHKGKVDANSRQSVTYTKE
FT                   EFIQKIVPDAQDLGKSYGIRPSFIIAQAALDSDFGEKILANKYHNLFGLLAEPGTPSIT
FT                   LNDSSTGKKQEKQFTHYKSWKYSMYDYLAHIKSGATGKKDSYTIMVSVKNPKTLVQKLQ
FT                   DSGFDNDKKYAKKMTEIIDLYDLTRYDK"
FT   gene            103266..104300
FT                   /gene="hrcA"
FT                   /locus_tag="SAK_0145"
FT   CDS_pept        103266..104300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SAK_0145"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by similarity to SP:Q45550; match to
FT                   protein family HMM PF01628; match to protein family HMM
FT                   TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44888"
FT                   /db_xref="GOA:Q3K3T4"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3T4"
FT                   /protein_id="ABA44888.1"
FT                   /translation="MITQRQNDILNLIVELFTQTHEPVGSKALQRTIDSSSATIRNDMA
FT                   KLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYYVIKAFDFEAFKLEDM
FT                   LQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAI
FT                   PRNFLTRDLIAFKAIVEERLLDGSVMDIHYKLRTEIPQIVQKYFVTTDNVLQLFDYVFS
FT                   ELFLETVFVAGKVNSLTYSDLSTYQFLDNEQQVAISLRQSLKEGEMASVQVADSQEAAL
FT                   ADVSVLTHKFLIPYRGFGLLSLIGPIDMDYRRSVSLVNIIGKVLATKLGDYYRYLNSNH
FT                   YEVH"
FT   gene            104342..104875
FT                   /gene="grpE"
FT                   /locus_tag="SAK_0146"
FT   CDS_pept        104342..104875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SAK_0146"
FT                   /product="co-chaperone protein GrpE"
FT                   /note="identified by similarity to SP:P15874; match to
FT                   protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46015"
FT                   /db_xref="GOA:Q3K3T3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3T3"
FT                   /protein_id="ABA46015.1"
FT                   /translation="MSEEIKKDDLQEEVEATETEETVEEVIEEIPEKSELELANERADE
FT                   FENKYLRAHAEMQNIQRRSSEERQQLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVK
FT                   KGLEMTRDSLIQALKEEGVEEVEVDSFDHNFHMAVQTLPADDEHPADSIAEVFQKGYKL
FT                   HERLLRPAMVVVYN"
FT   gene            105056..106885
FT                   /gene="dnaK"
FT                   /locus_tag="SAK_0147"
FT   CDS_pept        105056..106885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SAK_0147"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by similarity to SP:P17820; match to
FT                   protein family HMM PF00012; match to protein family HMM
FT                   TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45634"
FT                   /db_xref="GOA:Q3K3T2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3T2"
FT                   /protein_id="ABA45634.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKTDKDEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDFLVEEFKKENGIDL
FT                   SQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAGPLHLEMSLSRAKFDDLTRD
FT                   LVERTKTPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQHIVIQSNSGLTDEEIDKMMKDAEANAEADAKRKEEVDLKNEVDQAIFATE
FT                   KTIKETEGKGFDTERDAAQSALDELKKAQESGNLDDMKAKLEALNEKAQALAVKLYEQA
FT                   AAAQQAAQGAEGAQSADSSSKGDDVVDGEFTEK"
FT   gene            107174..108289
FT                   /gene="dnaJ"
FT                   /locus_tag="SAK_0148"
FT   CDS_pept        107174..108289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SAK_0148"
FT                   /product="co-chaperone protein DnaJ"
FT                   /note="identified by similarity to SP:P17631; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF00684; match to protein family HMM PF01556; match to
FT                   protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44796"
FT                   /db_xref="GOA:Q3K3T1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3T1"
FT                   /protein_id="ABA44796.1"
FT                   /translation="MNNTEFYDRLGVSKDASQDEIKKAYRRMSKKYHPDINKEAGAEEK
FT                   YKEVQEAYETLSDTQKRAAYDQYGAAGANGGFGGFDGGGFGGFEDIFSSFFGGGGMRNP
FT                   NAPRQGDDLQYRVNLSFEEAIFGAEKEVSYNRESSCHTCSGSGAKPGTSPVTCQKCHGS
FT                   GVINVDTQTPLGTMRRQVTCDVCQGSGQEIKEKCPTCHGTGHEKKTHKVSVKIPAGVET
FT                   GQQIRLTGQGEAGFNGGPYGDLFVIINVLPSQQFERNGSTIYYTLNISFVQAALGDTID
FT                   IPTVHGAVEMSIPAGTQTGKTFRLRGKGAPKLRGGGQGDQHVTVNIVTPTKLNDAQKEA
FT                   LHAFAEASGDKMVHPKKKGFFDKVKDALDVD"
FT   gene            108403..109650
FT                   /locus_tag="SAK_0149"
FT   CDS_pept        108403..109650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0149"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45526"
FT                   /protein_id="ABA45526.1"
FT                   /translation="MVTKVEEIRSYLIASIQNGKLAPGDRLPSIRQLANQFSCNKDTVQ
FT                   RVLMELRFDNYIYAKPRSGYYVFDSHQEEVEEGVSLPNSEIANIAYDDFRLCLNETLIG
FT                   REDYLFNYYHRQEGLLDLSKAVAKLMEETGVYVPLDDIVITAGTQQALFILTQVTFPNR
FT                   KSRVLIEEPTYPRMIELIKTQNLPYETISRGTHGIDFQRLEEIFQTQSIKFFYVIPRMH
FT                   NPLGTSYNPVEMKRLIEMAEKYDVYIVEDDYMSDFASQSPLHYYDTHGRVIYLKSFSKA
FT                   IFPALRLAAICLPQALKSTFMAYKKLMDYDTNLILQKALALYIENGLYAKNSQYLKYRY
FT                   QKDLANSKSILADQPNLPPYSLHHDSVLFDCSKLDNFKILRQYGDTLENYFCQKSHQSL
FT                   LQVKNDSCLKQFLGSL"
FT   gene            109721..110497
FT                   /gene="truA"
FT                   /locus_tag="SAK_0150"
FT   CDS_pept        109721..110497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SAK_0150"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45178"
FT                   /db_xref="GOA:Q3K3S9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3S9"
FT                   /protein_id="ABA45178.1"
FT                   /translation="MTRYKAQISYDGSAFSGFQRQPNCRTVQEEIERTLKRLNSGNDVI
FT                   IHGAGRTDAGVHAYGQVIHFDLPQARDVEKLRFGLDTQCPDDIDIVKVEQVSDDFHCRY
FT                   DKHIKTYEFLVDIGRPKNPMMRNYATHYPYPVIIELMKEAIKDLVGTHDFTGFTASGTS
FT                   VENKVRTIFDAKIQFEASKNLLIFTFTGNGFLYKQVRNMVGTLLKIGNGRMPISQIKTI
FT                   LQAKNRDLAGPTAAGNGLYLKEIIYEDEECFSNFRK"
FT   gene            110460..111218
FT                   /locus_tag="SAK_0151"
FT   CDS_pept        110460..111218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0151"
FT                   /product="phosphomethylpyrimidine kinase, putative"
FT                   /note="identified by similarity to SP:P39610"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46331"
FT                   /protein_id="ABA46331.1"
FT                   /translation="MKTRNVLAISGNDIFSGGGLHADLATYVVNKLHGFVAVTCLTVMS
FT                   DKGFEVIPIEASILKQQLESLKDVEFGSIKLGLLPNVETAQVVLEFVKSKQECPVVLDP
FT                   VLVCKENHDLEVSQLREQLIAFFPYTDVITPNLVEAQLLTGLSIENLDQMKIAAEKLYD
FT                   MGAKHVVIKGGNRLNAEEATDLYYDGERFETYVFPVVDANNTGAGCTFASSIASQLAMG
FT                   KNVEDAVKMSKGFVYQAIKASDKYGVVQHF"
FT   gene            111228..111692
FT                   /locus_tag="SAK_0152"
FT   CDS_pept        111228..111692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0152"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45252"
FT                   /protein_id="ABA45252.1"
FT                   /translation="MRKEKTNQLVQLAIVTAISIVLGMFISIPTPTGFLTLLDAGIFFA
FT                   AFYFGKKEGAVVGALAGFLIDLLKGYPNWMFFSLLIHGAQGYLAGLPGRRRLLGLISAT
FT                   LVMVLGYAIASGLMYGWGAVLPDIPGNIMQNMVGMVVGFALNKSLERVKK"
FT   gene            111689..112258
FT                   /locus_tag="SAK_0153"
FT   CDS_pept        111689..112258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0153"
FT                   /product="conserved hypothetical protein TIGR01440"
FT                   /note="identified by similarity to GB:BAC63325.1; match to
FT                   protein family HMM PF04260; match to protein family HMM
FT                   TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46111"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3S6"
FT                   /protein_id="ABA46111.1"
FT                   /translation="MILDYNKLKQETKAIVVDIIERSALKKGQIFVLGLSSSEVSGGLI
FT                   GKNSSSEIGEIIVEVILKELHSRGIYLAVQGCEHVNRALVVEAELAERQQLEVVNVVPN
FT                   LHAGGSGQVAAFKLMTSPVEVEEIVAHAGIDIGDTSIGMHIKRVQVPLIPISRELGGAH
FT                   VTALASRPKLIGGARAGYTSDPIRKF"
FT   gene            complement(112295..113137)
FT                   /locus_tag="SAK_0154"
FT   CDS_pept        complement(112295..113137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0154"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45696"
FT                   /protein_id="ABA45696.1"
FT                   /translation="MITLEKFIDHLNVEEVLFTFFTKLISILLLIIAFVIVRQVINYLF
FT                   EKTVNRSLAFSRQKVARQKTLAKLSHNVLNYTLYFFLFYWILSILGVPISSLLAGAGIA
FT                   GVAIGLGAQGFLSDVVNGFFILLENQFDVGDIINVGTVSGTVTNVGIRTTQIHDFDGTL
FT                   HFIPNRNITIVSNKSRSNMRAQIDIPLFVHTNLDQISDIVTKINEEYVSKHPAIVGEPT
FT                   VFGPTTNANGQFVYRINIFTQNGAQFDIYAEFYKLYQKAILEKGIDLPTYNFSNNHSR"
FT   gene            113294..114577
FT                   /gene="tig"
FT                   /locus_tag="SAK_0155"
FT   CDS_pept        113294..114577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SAK_0155"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P80698; match to
FT                   protein family HMM PF00254; match to protein family HMM
FT                   PF05697; match to protein family HMM PF05698; match to
FT                   protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46080"
FT                   /db_xref="GOA:Q3K3S4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3S4"
FT                   /protein_id="ABA46080.1"
FT                   /translation="MSTSFENKATNRGIITFTISQDEIKPALDQAFNKVKKDLNVPGFR
FT                   KGHMPRTVFNQKFGEEALYENALNLVLPKAYEAAVAELGLDVVAQPKIDVVSMEKGQDW
FT                   KLTAEVVTKPEVKLGDYKDLSVEVDASKEVSDEEVDAKVERERNNLAELTVKDGEAAQG
FT                   DTVVIDFVGSVDGVEFDGGKGDNFSLELGSGQFIPGFEEQLVGSKAGQTVDVNVTFPED
FT                   YQAEDLAGKDAKFVTTIHEVKTKEVPALDDELAKDIDEEVETLDELKAKYRKELESAKE
FT                   IAFDDAVEGAAIELAVANAEIVELPEEMVHDEVHRAMNEFMGNMQRQGISPEMYFQLTG
FT                   TTEEDLHKQYQADADKRVKTNLVIEAIAAAEGFEATDEEIEKEITDLASEYNMEADQVR
FT                   GLLSADMLKHDIAMKKAVDVITSSATVK"
FT   gene            114766..115341
FT                   /gene="rpoE"
FT                   /locus_tag="SAK_0156"
FT   CDS_pept        114766..115341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SAK_0156"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P12464; match to
FT                   protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44973"
FT                   /db_xref="GOA:Q3K3S3"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3S3"
FT                   /protein_id="ABA44973.1"
FT                   /translation="MELEVFAGQEKSELSMIEVARAILEQRGRDNEMYFSDLVNDIQTY
FT                   LGKSDSAIRESLPFFYSDLNTDGSFIPLGENKWGLRSWYAIDEIDEEIITLEEDEDGAP
FT                   KRKKKRVNAFMDGDEDAIDYNDDDPEDEDFTEETPSLEYDEENPDDEKSEVESYDSEIN
FT                   EIIPDEDLDEDVEINEEDDEEEEEEEEV"
FT   gene            115614..117218
FT                   /gene="pyrG"
FT                   /locus_tag="SAK_0157"
FT   CDS_pept        115614..117218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SAK_0157"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46157"
FT                   /db_xref="GOA:Q3K3S2"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3S2"
FT                   /protein_id="ABA46157.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERR
FT                   GEYLGATVQVIPHVTDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQSIK
FT                   NKLAQFCDVAPEAVIESLDVDHIYQIPLNMQAQNMDQIVCDHLKLETPAADMTEWSAMV
FT                   DKVMNLEKKVKIALVGKYVELPDAYLSVVEALKHSGYVNDVAIDLKWVNAAEVTEDNIK
FT                   ELVGDADGIIVPGGFGQRGSEGKIEAIRYARENDVPMLGVCLGMQLTCVEFARNVLKLH
FT                   GANSAELDPKTPFPIIDIMRDQIDIEDMGGTLRLGLYPCKLKAGSRAAAAYNNQEVVQR
FT                   RHRHRYEFNTKFREQFEAAGFVFSGVSPDNRLMEVVELPEKKFFVAAQYHPELQSRPNH
FT                   AEELYTAFVTAAVENMK"
FT   gene            117327..118253
FT                   /locus_tag="SAK_0158"
FT   CDS_pept        117327..118253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34601.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45248"
FT                   /protein_id="ABA45248.1"
FT                   /translation="MKKIRLSKFIKMIVVILFLISVAASFYFFHVAQVRDDKSFISNGQ
FT                   RKPGNSLYAYDKSFDKLLKQKIEMTNQNIKQVAWYVPAAKKTHKTAVVVHGFANSKENM
FT                   KAYGWLFHKLGYNVLMPDNIAHGESHGQLIGYGWNDRENIIKWTEMIVDKNSSSQITLF
FT                   GVSMGGATVMMASGEKLPSQVVNIIEDCGYSGVWDELKFQAKEMYGLPAFPLLYEVSTI
FT                   SKIRAGFSYGQASSVEQLKKNNLPALFIHGDKDNFVPTSMVYDNYKATAGKKELYIVKG
FT                   AKHAKSFETEPEKYEKRISSFLKKYEK"
FT   gene            118300..118385
FT                   /locus_tag="SAK_0159"
FT   tRNA            118300..118385
FT                   /locus_tag="SAK_0159"
FT                   /product="tRNA-Leu"
FT   gene            118448..118894
FT                   /gene="dut"
FT                   /locus_tag="SAK_0160"
FT   CDS_pept        118448..118894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SAK_0160"
FT                   /product="deoxyuridine 5`-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by similarity to SP:P06968; match to
FT                   protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46107"
FT                   /protein_id="ABA46107.1"
FT                   /translation="MSKVRGFELVSQFSNKELLPKRETAHAAGYDLKVAKKTVIEPGEI
FT                   TLVPTGIKAYMQPGEVLYLYDRSSNPRKKGIVLINSVGVIDGDYYNNQVNEGHIFAQMQ
FT                   NITDQAVILEEGERIVQAVFAPFLLADDDQATGMRTGGFGSTGK"
FT   gene            119056..120420
FT                   /gene="radA"
FT                   /locus_tag="SAK_0161"
FT   CDS_pept        119056..120420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SAK_0161"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44947"
FT                   /protein_id="ABA44947.1"
FT                   /translation="MAKKKSVFTCQECGYQSPKYLGRCPNCSAWSSFVEEVEVQEVKNA
FT                   RVSLNGEKSRPTKLKDVSSINYSRTKTDMDEFNRVLGGGVVPGSLVLIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYVSGEESAEQIKLRSERLGDIDNEFYLYAETNMQSIRSEIEKIK
FT                   PDFLIIDSIQTIMSPEVSSVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAIVVTMEGTRPILAEVQALVTPTVFGNAKRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTNPQESFIGEIGLTGEI
FT                   RRVTRIEQRINEASKLGFTKIYAPKNSLAGIEIPKGIDVIGVTTVSQVLKAVFST"
FT   gene            120556..121053
FT                   /locus_tag="SAK_0162"
FT   CDS_pept        120556..121053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0162"
FT                   /product="carbonic anhydrase, putative"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44851"
FT                   /protein_id="ABA44851.1"
FT                   /translation="MTTYFDNFLKTNQAYADLHGTAHLPIKPKTKVAIVTCMDSRLHVA
FT                   QALGLALGDAHILRNAGGRVTDDVLRSLVISQQQLGTREIVVLHHTDCGAQTFTNEAFA
FT                   AQLQRDLGVDMHGHDFLPFNDIEESVREDVAKLHASPLIPNDVVISGAIYDVDTGRMVE
FT                   VK"
FT   gene            121207..122526
FT                   /locus_tag="SAK_0163"
FT   CDS_pept        121207..122526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0163"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45496"
FT                   /protein_id="ABA45496.1"
FT                   /translation="MKKYDVIVLGFGKAGKTLAAKLATQGKSVAMVEEDNKMYGGTCIN
FT                   IGCIPTKTLLVSASKNHDFQEAMTTRNEVTSRLRAKNFAMLDNKDTVDVYNAKARFISN
FT                   KVVELTGGADKQELTADVIIINTGAKSVQLPIPGLADSQHVYDSTAIQELAHLPKRLGI
FT                   IGGGNIGLEFATLYSELGSKVTVIDSQSRIFAREEEELSEMAQDYLEEMGISFKLSADI
FT                   KSVQNEDENVVISFEDEKLSFDAVLYATGRKPNTEGLALENTDIKLTERGAIAVDEYCQ
FT                   TSVENIFAVGDVNGGPQFTYISLDDSRIVLNYLNGDKDYSLKNRGAVPTSTFTNPPLAT
FT                   VGLDEKTAKEKGYQVKSNSLLVSAMPRAHVNNDLRGIFKVVVDTETNLILGARLFGAES
FT                   HELINIITMAMDNKIPYTYFQKQIFTHPTMVENFNDLFNF"
FT   gene            complement(122833..123999)
FT                   /locus_tag="SAK_0164"
FT   CDS_pept        complement(122833..123999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0164"
FT                   /product="ISSag9, transposase"
FT                   /note="identified by similarity to GB:AAN00658.1; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44396"
FT                   /protein_id="ABA44396.1"
FT                   /translation="MTKHKHLTLSDRNDIQSGLDRGETFKAIGLNLLKHPTTIAKEVKR
FT                   NKQLRESTKDCLDCPLLRKAPYVCNGCPKRRINCGYKKTFYLAKQAQRNYEKLLVESRE
FT                   GIPLNKETFWKIDRVLSNGVKKGQRIYHILKTNDLEVSSSTVYRHIKKGYLSITPIDLP
FT                   RAVKFKKRRKSTLPPIPKAIKEGRRYEDFIEHMNQSELNSWLEMDTVIGRIGGKVLLTF
FT                   NVAFCNFIFAKLMDSKTAIETAKHIQVIKRTLYDNKRDFFELFPVILTDNGGEFARVDD
FT                   IEIDVCGQSQLFFCDPNRSDQKARIEKNHTLVRDILPKGTSFDNLTQEDINLALSHINS
FT                   VKRQALNGKTAYELFSFTYGKDIASILGIEEITAEDVCQSPKLLKDKI"
FT   gene            124303..125739
FT                   /gene="gltX"
FT                   /locus_tag="SAK_0165"
FT   CDS_pept        124303..125739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SAK_0165"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by similarity to SP:P22250; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45477"
FT                   /db_xref="GOA:Q3K3R5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3R5"
FT                   /protein_id="ABA45477.1"
FT                   /translation="MRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRH
FT                   VEDGERSQLENLRWLGMDWDESPETHENYRQSERLELYQRYIDQLLAEGKAYKSYVTEE
FT                   ELAAERERQELAGETPRYINEFIGMSETEKEAYIAEREAAGIIPTVRLAVSESGIYKWT
FT                   DMVKGDIEFEGSNIGGDWVIQKKDGYPTYNFAVVIDDHVMQISHVIRGDDHIANTPKQL
FT                   MVYEALGWEAPQFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMSEAVFNFIALL
FT                   GWNPGGEEEIFSREQLINLFDENRLSKSPAAFDQKKMDWMSNDYLKNADFESVFALCKP
FT                   FLEEAGRLTDKAEKLVELYKPQLKSADEIVPLTDLFFADFPELTEAEKEVMAAETVPTV
FT                   LSVFKEKLVSLSDEEFTRDTIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDT
FT                   IYLLGKEKSVQHIDNMLAKL"
FT   gene            complement(125779..126747)
FT                   /gene="rbsB"
FT                   /locus_tag="SAK_0166"
FT   CDS_pept        complement(125779..126747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="SAK_0166"
FT                   /product="ribose ABC transporter, ribose-binding protein"
FT                   /note="identified by similarity to SP:P02925; match to
FT                   protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44862"
FT                   /protein_id="ABA44862.1"
FT                   /translation="MKFGKKLGFLALLMSIVLILGACGKTGLGNSSENSTKNVTKKSAK
FT                   DLKLGVSISTTNNPYFVAMKDGIDKYASNKKISIKVADAQDDAARQADDVQNFISQNVD
FT                   AILINPVDSKAIVTAIKSANNANIPVILMDRGSEGGKVLTTVASDNVAAGKMAADYAVK
FT                   KLGKKAKAFELSGVPGASATVDRGKGFHSVAKSKLDMLSSQSANFDRAKALNTTQNMIQ
FT                   GHKDVQIIFAQNDEMALGAAQAVKSAGLQNVLIVGIDGQPDAHDAIKKGDISATIAQQP
FT                   AKMGEIAIQAAIDHYKGKKVEKETISPIYLVTKDNVEKYNW"
FT   gene            complement(126800..127732)
FT                   /gene="rbsC"
FT                   /locus_tag="SAK_0167"
FT   CDS_pept        complement(126800..127732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="SAK_0167"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P04984; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46023"
FT                   /protein_id="ABA46023.1"
FT                   /translation="MMKYISELTTLIALAGLMVIITLINPNFLTTNNLLNLLLQVTANG
FT                   FIAFGMTFVILTGGIDLSVGSILALSSALTAGLIGHGVPVGIAIVLSVALGGILGMLNG
FT                   LFISYGKLAPFIVTLATMTIFRGATLVYSNGNPITAGLSDSFLFQFLGQGYIVGIPFPV
FT                   ILMFLTFIILYILLHKTAFGKSVYALGGNEKAAYISGIKLNKVKIIIYTISGIMASISG
FT                   LIITSRLSSAQPTAGASYEMDAIAAVVLGGTSLSGGKGRIIGTLIGALIIGVLNNGLNI
FT                   IGVSAFWQQVVKGIVILMAVLLDRFKVAK"
FT   gene            complement(127743..129221)
FT                   /gene="rbsA"
FT                   /locus_tag="SAK_0168"
FT   CDS_pept        complement(127743..129221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="SAK_0168"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P04983; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45141"
FT                   /db_xref="GOA:Q3K3R2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3R2"
FT                   /protein_id="ABA45141.1"
FT                   /translation="MKIDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLM
FT                   NILTGLFPASTGTIYIDGEERTFSNPQEAEEFGISFIHQEMNTWPEMTVLENLFLGREI
FT                   KTTFGLLNQKLMRQKALEAFKRLGVTIPLDIPIGNLSVGQQQMIEIAKSLLSQLSILVM
FT                   DEPTAALTDRETENLFRVIRSLKQEGVGIVYISHRMEEIFKITDFVTVMRDGVIVDTKE
FT                   TSLTNSDELVKKMVGRKLEDYYPEKHSEIGPVAFEVSNLCGDNFEDVSFYVRKGEILGF
FT                   SGLMGAGRTEVMRTIFGIDKKKSGKVKIDDQEITITSPSQAIKQGIGFLTENRKDEGLI
FT                   LDFNIKDNMTLPSTKDFSKHGFFDEKTSTTFVQQLINRLYIKSGRPDLEVGNLSGGNQQ
FT                   KVVLAKWIGIAPKVLILDEPTRGVDVGAKREIYQLMNELADRGVPIVMVSSDLPEILGV
FT                   SDRIMVMHEGRISGELSRKEADQEKVMQLATGGK"
FT   gene            complement(129237..129635)
FT                   /gene="rbsD"
FT                   /locus_tag="SAK_0169"
FT   CDS_pept        complement(129237..129635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="SAK_0169"
FT                   /product="ribose ABC transporter protein RbsD"
FT                   /note="identified by similarity to SP:P04982; match to
FT                   protein family HMM PF05025"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46332"
FT                   /db_xref="GOA:Q3K3R1"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3R1"
FT                   /protein_id="ABA46332.1"
FT                   /translation="MKKTGILNSHLAKLADDLGHTDQVCIGDLGLPVPNGIPKIDLSLT
FT                   SGVPSFQEVLDIYLENILVEKVILAEEIKEANPDQLSRLLAKLDNSVSIEYVSHDHLKQ
FT                   MTQDVKAVIRTGENTPYSNIILQSGVII"
FT   gene            complement(129610..130521)
FT                   /gene="rbsK"
FT                   /locus_tag="SAK_0170"
FT   CDS_pept        complement(129610..130521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="SAK_0170"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="identified by similarity to SP:P36945; match to
FT                   protein family HMM PF00294; match to protein family HMM
FT                   TIGR02152"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45518"
FT                   /protein_id="ABA45518.1"
FT                   /translation="MSNIVIIGSISMDLVMETNRIAKEGETVFGQRFSMVPGGKGANQA
FT                   VAIGRLSQDRDNITILGAIGEDSFGPILLDNLNKNHVTTDFVGTIPPSSGVAQITLYNN
FT                   DNRIIYCPGANGKVDTKKWSQEWAIIKKADLVVLQNEIPHQANMKIANFCKEHSIKLLY
FT                   NPAPSRETDIEMLDKVDYFTPNEHECQELFPNQKLEDILATYPEKLIVTLGTKGAIYSD
FT                   GKESHLIPALETKAVDTTGAGDTFNGAFGYAISKKFKIANALRFATLAAHLSVQKFGAQ
FT                   GGMPTIKEMEDNQHYEKDWHIK"
FT   gene            complement(130514..131500)
FT                   /gene="rbsR"
FT                   /locus_tag="SAK_0171"
FT   CDS_pept        complement(130514..131500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="SAK_0171"
FT                   /product="ribose operon repressor"
FT                   /note="identified by similarity to SP:P36944; match to
FT                   protein family HMM PF00356; match to protein family HMM
FT                   PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45134"
FT                   /protein_id="ABA45134.1"
FT                   /translation="MSTIRQVAEKAGVSTSTVSRYISQNGYVSQKASQKIEQAIRELHY
FT                   VPNFLAQSLKTKKNQLVGLLLPDISNPFFPRLARGVEEFLKEQGYRVMLGNTNNKSHLE
FT                   EEYLNVLLQSNAAGIITTHDFTKNHPEIDIPVVVVDRVNQETQYGVFSDNKEGGKLAAQ
FT                   AIWTAGATNILLIRGPLDKADNLNQRFQGSQNYLLNKGACFAIEDSASFDFAEIQIEAK
FT                   TLLDHHPDIDSIIAPSDIHAIAYLHEILNRGKRIPEDVQIIGYDDILMSQFIYPSLSTI
FT                   HQSSYIMGQKAAELIFKITNQLPITNKRIKLPVHYVERETLRRKIDE"
FT   gene            131682..132770
FT                   /locus_tag="SAK_0172"
FT   CDS_pept        131682..132770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0172"
FT                   /product="permease, putative"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45749"
FT                   /protein_id="ABA45749.1"
FT                   /translation="MSHAWKELTFYKKKYLLIELLIIVMMFMVVFLSGLANGLGRAVSA
FT                   AIENNPAQTYILNEGAEQVITSSVLTTKDQTDLNSLNLKDSTTLNIQRSSLTRQGHEKK
FT                   IDISYFAIDKDSFMAPTLSEGKQLTSYKKAIILNDSLKAEGIKLGDKVIDKSSSISLTV
FT                   VGFVHNSMYGHGPVAFIDKDIYTEINKKINPQYQFLPQALVMKNDKSISHLPTQLEAVS
FT                   KKDVIQHIPGYSAEQSTLNMILWVLVVASAGILGVFFYIITLQKRHEFSVMKAIGTKMS
FT                   EIALFQLSQVIILALFGIIVGDGLAIALSYVLPAQMPFVINWQNIILVSFVFLVIAMIS
FT                   SALSIVKVAKIDPVEVINGGGE"
FT   gene            132770..133456
FT                   /locus_tag="SAK_0173"
FT   CDS_pept        132770..133456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0173"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44384"
FT                   /protein_id="ABA44384.1"
FT                   /translation="MSAILELKHISKHYPDGDELLSILDNLDLSVSAGEFVAILGPSGS
FT                   GKSTLLSIAGLLLGADQGSLYVNHENVTDLSQRQRTQLRREALGFIFQSHQLLPYLTIQ
FT                   EQLQQEARFAKHYDKKTSLEEINKLLSDLGIEQCAHKYPNQLSGGQKQRAAIARAFINH
FT                   PKVILADEPTASLDEERGRQVTELIRQEVKSHNTAAIMVTHDERVLDLVDTVYRLKDGK
FT                   LVKENF"
FT   gene            133487..134158
FT                   /locus_tag="SAK_0174"
FT   CDS_pept        133487..134158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0174"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44421"
FT                   /protein_id="ABA44421.1"
FT                   /translation="MIKILVVEDNIVQQKIITTKLTQEGYQFITASNGQEALNCLDTEE
FT                   VQLIITDIMMPMMDGYQLIQELRSAAYNVPIIVMTAKSQMEDMTKGFGLGADDYMVKPV
FT                   QLQELALRIKALLRRANIVAQHQLIIGNTCLNEDELSLKYFEQEIVFPQKEFRVLFHLL
FT                   SYPNRIFTRLELLDSIWGMDTDLDERVVDACINKIRRKVEHLPDFKIETVRGVGYRAKN
FT                   D"
FT   gene            134151..135221
FT                   /locus_tag="SAK_0175"
FT   CDS_pept        134151..135221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0175"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45660"
FT                   /protein_id="ABA45660.1"
FT                   /translation="MTKLRRFRFPLRFYFTLMFVLTMLFSVLASLLLVAAIVFTFFQGV
FT                   LTTHVLQVSALAVVFLSLVIASISMWYGSYHLTKPILDISHIVSNVADGDFEGHIYRNS
FT                   NRRKSYEYYNELDELSESINQMIVSLSHMDYMRKDFITNVSHELKTPIAAVANIVELLQ
FT                   DPELDEETQSELLGLVKTESLRLTRLCDTMLQMSRVDNQETIGELSSVRVDEQIRQAMI
FT                   SLTERWQAKRINFQLDSKPYTVYSNSDLLMQVWINLLDNAIKYSDDIVDLSVRMEETNN
FT                   HYLRVIISDKGRGISQYDVQHIFDKFYQADQSHNQQGNGLGLAIVKRIIVLCKGRISVS
FT                   SQLEIGTEFCVELPLS"
FT   gene            135375..136565
FT                   /gene="argG"
FT                   /locus_tag="SAK_0176"
FT   CDS_pept        135375..136565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SAK_0176"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45883"
FT                   /db_xref="GOA:Q3K3Q4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3Q4"
FT                   /protein_id="ABA45883.1"
FT                   /translation="MGKEKLILAYSGGLDTSVAIAWLKKDYDVIAVCMDVGEGKDLDFI
FT                   HDKALTIGAIESYILDVKDEFAEHFVLPALQAHAMYEQKYPLVSALSRPIIAQKLVEMA
FT                   HQTGATTIAHGCTGKGNDQVRFEVAIAALDPELKVIAPVREWKWHREEEITFAKANGVP
FT                   IPADLDNPYSIDQNLWGRANECGVLENPWNQAPEEAFGITKSPEEAPDCAEYIDITFQN
FT                   GKPIAINNQEMTLSDLILSLNEIAGKHGIGRIDHVENRLVGIKSREIYECPAAMVLLAA
FT                   HKEIEDLTLVREVSHFKPILENELSNLIYNALWFSPATKAIIAYVKETQKVVNGTTKVK
FT                   LYKGSAQVVARHSSNSLYDENLATYTAADSFDQDAAVGFIKLWGLPTQVNAQVNKG"
FT   gene            136584..137972
FT                   /gene="argH"
FT                   /locus_tag="SAK_0177"
FT   CDS_pept        136584..137972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SAK_0177"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45212"
FT                   /db_xref="GOA:Q3K3Q3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3Q3"
FT                   /protein_id="ABA45212.1"
FT                   /translation="MTKNHKLWGGRFESSLEKWVEEFGASISFDQKLAPYDMKASMAHV
FT                   TMLGKTDIISQEEAGLIKDGLKILQDKYRAGQLTFSISNEDIHMNIESLLTAEIGEVAG
FT                   KLHTARSRNDQVATDMHLYLKDKLQEMMKKLLHLRITLVNLAENHIYTVMPGYTHLQHA
FT                   QPISFGHHLMAYYNMFTRDTERLEFNMKHTNLSPLGAAALAGTTFPIDRHMTTRLLDFE
FT                   KPYSNSLDAVSDRDFIIEFLSNASILMMHLSRFCEEIINWCSYEYQFITLSDTFSTGSS
FT                   IMPQKKNPDMAELIRGKTGRVYGNLFSLLTVMKSLPLAYNKDLQEDKEGMFDSVETVSI
FT                   AIEIMANMLETMTVNEHIMMTSTETDFSNATELADYLASKGIPFRKAHEIVGKLVLECS
FT                   KNGSYLQDIPLKYYQEISELIENDIYEILTAKTAVKRRNSLGGTGFDQVKKQILLARKE
FT                   LKAE"
FT   gene            138113..138994
FT                   /gene="fba"
FT                   /locus_tag="SAK_0178"
FT   CDS_pept        138113..138994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SAK_0178"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45907"
FT                   /protein_id="ABA45907.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKLCKQLIETLVESMGITVPVAIHLDHGHYDDALECIEVGYTSIM
FT                   FDGSHLPVEENLEKAREVVAKAHAKGISVEAEVGTIGGEEDGIVGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPANWEGLDLDHLKKLTEAVPGFPIVLHGGSGIPDDQIQEAI
FT                   KLGVAKVNVNTECQLAFCQATRDYAVEFNANEAEYMKKKLFDPRKFLKPGFDAITEAVE
FT                   ERIDVFGSANKA"
FT   gene            complement(139079..139996)
FT                   /locus_tag="SAK_0179"
FT   CDS_pept        complement(139079..139996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0179"
FT                   /product="L-2-hydroxyisocaproate dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by similarity to SP:P14295; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45001"
FT                   /protein_id="ABA45001.1"
FT                   /translation="MTRKIGIIGMGHVGSTVAHALIAQGIGDDYVFIDTNVDKVNADMI
FT                   DFQDALANATYHANIVLNDYDALSDADVVISALGDISLQNNKEANRFAELPFTSKEVYD
FT                   VSQKLKSSGFRGILIVVTNPVDAITQLYQEYTQFPKSRVIGTGTLLDTARMKRVLGQRL
FT                   QVDPRSIGGYNLGEHGNSQFVAWSQVTVKGQPAISLLKVEELEQIKEASLKGGHTVFFG
FT                   KKYTSYGIATAAVRIVLAVLNDSHELLPVSTFYESEGVYLGYPAIIGRVGIVERISLSL
FT                   SPKEEQQLTDSAAFIRNYLKHINL"
FT   gene            140235..140423
FT                   /gene="rpmB"
FT                   /locus_tag="SAK_0180"
FT   CDS_pept        140235..140423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SAK_0180"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by similarity to SP:P37807; match to
FT                   protein family HMM PF00830; match to protein family HMM
FT                   TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45686"
FT                   /db_xref="GOA:Q3K3Q0"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3Q0"
FT                   /protein_id="ABA45686.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTVLIDGKPK
FT                   KVWVSARALKSGKVERV"
FT   gene            140555..140920
FT                   /locus_tag="SAK_0181"
FT   CDS_pept        140555..140920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO82795.1; match to
FT                   protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44849"
FT                   /protein_id="ABA44849.1"
FT                   /translation="MTVKINTRDGQIELSDDVIATVVGGSTTEIFGVVGMASKSAIKDN
FT                   FQALLRKENYAKGVVVRSSEAGIAVDVYTVMSYGVKISEVSKNIQERVKFNLENQLGLS
FT                   ADMVNVYVQSIKVVGED"
FT   gene            140953..142584
FT                   /locus_tag="SAK_0182"
FT   CDS_pept        140953..142584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0182"
FT                   /product="DAK2 domain protein"
FT                   /note="identified by match to protein family HMM PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45456"
FT                   /protein_id="ABA45456.1"
FT                   /translation="MVQAASTRLSKQAEYVNSLNVFPVPDGDTGTNMGMTMENGAKEVS
FT                   DKPATTVGEVGQILSKGVLMGARGNSGVITSQLFRGFGQSIKDKEELTGQDLAHAFQNG
FT                   VEVAYKAVMKPVEGTILTVSRGAATAALKKAEETDDAVEVMRATLKGAKRALAKTPDML
FT                   PVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFKATPATMTEMVNAEHHKAVVGH
FT                   VATEDIKYGYCTEVMVGLKQGPTYVKEFNYEEFQGYLSNLGDSLLVVNDDEIVKVHVHT
FT                   EDPGLVMQEGLKYGSLVKVKVENMRNQHDAQMQKVEVEETVKETKEYGIIAVVAGDGLA
FT                   EIFKSQGVDYIISGGQTMNPSTEDIVKAIEKVNARNVIILPNNKNIFMAAQSAADVVDI
FT                   PAAVVETRTVPQGFTSLLAFDPAKSLETNVADMTNSLSDVISGSVTLAVRDTTIDGLEI
FT                   HENDVLGMVDGKILVSTPDMEKALKDTFDKMIDEDSEIVTIYVGEDGKQALAETLSEYL
FT                   EETYEDVEVEIHQGDQPVYPYLMSVE"
FT   gene            142732..143616
FT                   /locus_tag="SAK_0183"
FT   CDS_pept        142732..143616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0183"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44360"
FT                   /protein_id="ABA44360.1"
FT                   /translation="MSLIILTVILVLVIVLLITSLYVVKQQTVAIIERFGKYQKTATSG
FT                   IHIRVPLGIDKIAARVQLRLLQSEIIVETKTKDNVFVTLNIATQYRVNENNVTDAYYKL
FT                   IKPEAQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQHQVAEEMSTYGYIIVKTLIT
FT                   KVEPDAEVKQSMNEINAAQRKRVAAQELANADKIKIVTAAEAEAEKDRLHGVGIAQQRK
FT                   AIVDGLADSIQELKDANVTLTEEQIMSILLTNQYLDTLNTFAINGNQTIFLPNNPEGVE
FT                   DIRTQVLSALKTR"
FT   gene            144017..145039
FT                   /locus_tag="SAK_0184"
FT   CDS_pept        144017..145039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0184"
FT                   /product="ISSag3, transposase"
FT                   /note="This element is related to but different from
FT                   ISSag2. The end sequences of this single copy element were
FT                   not identified.; identified by similarity to GB:BAC64953.1;
FT                   match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45108"
FT                   /protein_id="ABA45108.1"
FT                   /translation="MSTNHSTKKSLYSHLSASERGEISAYLKMGKKPSEIAHLLGRHRS
FT                   TISREIKRGSVSQVQDKNGKRIYSTVYFPDSGQRVYETNRRKSAYHKLSYCSQTFFKEL
FT                   EKALKTKPRCHSVDSFVQTYQEKPPLEVIPSTKTVYRYIKDGLLRVKPIDLPKMVCIRK
FT                   RAKVTPKATKKILGKSIEERPETITNRSEFGHWEIDLMLGKKTKGEAVVMTLVERQTRF
FT                   VIAVKLANKQAETINRAVKSLLSQYPIRSIASDNGSEFSSLSDLKGVEVYFAHPYASHE
FT                   RGTNENFNGLLREFLPKGVSLNSLTTEELNLYVSAINDRPRRIQKYKTANILFGLAQTA
FT                   "
FT   gene            complement(145294..145512)
FT                   /locus_tag="SAK_0185"
FT   CDS_pept        complement(145294..145512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46134"
FT                   /protein_id="ABA46134.1"
FT                   /translation="MSFLFDVEGNENTLFEVFKIPKTKDIVFEKFNEMISCFQFCVGVG
FT                   LLKDVDDILFAFENDFKDSLKKRMNLL"
FT   gene            complement(145690..149184)
FT                   /gene="bag"
FT                   /locus_tag="SAK_0186"
FT   CDS_pept        complement(145690..149184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bag"
FT                   /locus_tag="SAK_0186"
FT                   /product="IgA-binding beta antigen"
FT                   /note="identified by similarity to SP:P27951; match to
FT                   protein family HMM PF00746; match to protein family HMM
FT                   PF04650; match to protein family HMM PF05062; match to
FT                   protein family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44669"
FT                   /protein_id="ABA44669.1"
FT                   /translation="MFKSNYERKMRYSIRKFSVGVASVAVASLFMGSVAHASELVKDDS
FT                   VKTTEVAAKPYPSMAQTDQGNNSSSSELETTKMEIPTTDIKKAVEPVEKTAGETSATDT
FT                   GKREKQLQQWKNNLKNDVDNTILSHEQKNEFKTKIDETNDSDALLELENQFNETNRLLH
FT                   IKQHEEVEKDKKAKQQKTLKQSDTKVDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSM
FT                   LKKIEDIRKQAQQADKKEDAEVKVREELGKLFSSTKAGLDQEIQEHVKKETSSEENTQK
FT                   VDEHYANSLQNLAQKSLEELDKATTNEQATQVKNQFLENAQKLKEIQPLIKETNVKLYK
FT                   AMSESLEQVEKELKHNSEANLEDLVAKSKEIVREYEGKLNQSKNLPELKQLEEEAHSKL
FT                   KQVVEDFRKKFKTSEQVTPKKRVKRDLAANENNQQKIELTVSPENITVYEGEDVKFTVT
FT                   AKSDSKTTLDFSDLLTKYNPSVSDRISTNYKTNTDNHKIAEITIKNLKLNESQTVTLKA
FT                   KDDSGNVVEKTFTITVQKKEEKQVPKTPEQKDSKTEEKVPQEPKSNDKNQLQELIKSAQ
FT                   QELEKLEKAIKELMEQPEIPSNPEYGIQKSIWESQKEPIQEAITSFKKIIGDSSSKYYT
FT                   EHYFNKYKSDFMNYQLHAQMEMLTRKVVQYMNKYPDNAEIKKIFESDMKRTKEDNYGSL
FT                   ENDALKGYFEKYFLTPFNKIKQIVDDLDKKVEQDQPAPIPENSEMDQAKEKAKIAVSKY
FT                   MSKVLDGVHQHLQKKNHSKIVDLFKELEAIKQQTIFDIDNAKTEVEIDNLVHDAFSKMN
FT                   ATVAKFQKGLETNTPETPDTPKIPELPQAPDTPQAPDTPHVPESPKAPEAPRVPESPKT
FT                   PEAPHVPESPKAPEAPRVPESPKTPEAPHVPESPKTPEAPKIPEPPKTPDVPKLPDVPK
FT                   LPDVPKLPDAPKLPDGLNKVGQAVFTSTDGNTKVTVVFDKPTDADKLHLKEVTTKELAD
FT                   KIAHKTGGGTVRVFDLSLSKGGKETHVNGERTVRLALGQTGSDVHVYHVKENGDLERIP
FT                   SKVENGQVVFKTNHFSLFAIKTLSKDQNVTPPKQTKPSTQGSQVEIAESQTGKFQSKAA
FT                   NHKALATGNETVAKGNPTSTTEKKLPYTGVASNLVLEIMGLLGLIGTSFIAMKRRKS"
FT   gene            complement(149264..149791)
FT                   /locus_tag="SAK_0187"
FT   CDS_pept        complement(149264..149791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0187"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   (ICMT) family protein"
FT                   /note="identified by match to protein family HMM PF04140"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44397"
FT                   /protein_id="ABA44397.1"
FT                   /translation="MVLAIILVTFLIRLIFLKRSIENEKRILSNGGQEFGVENTKRLTL
FT                   AHIIFYLSCFVEAMVHKTNFDGMSMVGLVLLIFSMLMLMLVIHLLGDIWTVKLMLVNNH
FT                   KFVDHFLFRTVKHPNYFLNILPELVGLALVSHAYVTFIFIFPVYAVILYQRIAEEEKLL
FT                   QEVIIPNGRMKG"
FT   gene            complement(149900..151240)
FT                   /locus_tag="SAK_0188"
FT   CDS_pept        complement(149900..151240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0188"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45513"
FT                   /protein_id="ABA45513.1"
FT                   /translation="MIKNPKLLTKSFLRSFSLLGAIALVIHIAIYLIFPFYYIQQEGEK
FT                   FNESATIMSRYLEGKNFHELPSLLESYSKSLRISAHLKDDVLDKRISLVHDLEIKEGSP
FT                   TNYIVTIDRQITTADGKKVTIQFIQGVDIYKEATRIMLLYLPYTFLATLVFAFLFSYFY
FT                   TKRLLEPLFYISKVTGKMQELDHDIRFDETRKDEVGEVGKQINDVYENLLTVIDESERR
FT                   NERIVRLQKQKVSFVRGASHELKTPLASLRIILENMQYNIGDYKDHPKYIAKSIDQIDQ
FT                   MSHLLEEVLESSKFQEWTECSETLIVQTILTDVLSRYQELARSRGIEIENQLTDATRVV
FT                   MSLKALDKVLTNLISNAIKYSNKNGRVILSEQDGYLSIKNTCQPLNQEELNHLFDIFYH
FT                   SQVVTDKSEGSGLGLYIVNNILESYQMSYSFLPYEQGMVFKICLQAD"
FT   gene            complement(151237..151890)
FT                   /locus_tag="SAK_0189"
FT   CDS_pept        complement(151237..151890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0189"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45217"
FT                   /protein_id="ABA45217.1"
FT                   /translation="MNILVVDDEDMIREGVAAFLREEGYHVILAKDGQEALEKFHEFPI
FT                   HLMVLDLMLPKRSGFEVLKEINGNHDIPVIVLSALGDEETQMQVFDLYADDHVTKPFSL
FT                   VLLVKRIQALLRRYYVVEDIWHYQDVAVDFTSYQARVKNEEVAIKPKELLVLKCLIQHK
FT                   NQVLSREQILESISNDFADLPLDRVVDVYIRNLRKKLDLDCIVTVKNAGYKISL"
FT   gene            complement(152094..152483)
FT                   /locus_tag="SAK_0190"
FT   CDS_pept        complement(152094..152483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0190"
FT                   /product="IS1381, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46272"
FT                   /protein_id="ABA46272.1"
FT                   /translation="MKAQAIVTSQGRIVSLDIAVNYCHDMKLFKMSRRNIGQAAKILAD
FT                   SGYQGIMKMYSQAQTPRKSSKLKPLTLEDKTYNHTLSKERIKVENIFAKVKTFKIFSTT
FT                   YRNRRKRFGLRMNLIAGMINRELGF"
FT   gene            complement(152516..152899)
FT                   /locus_tag="SAK_0191"
FT   CDS_pept        complement(152516..152899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0191"
FT                   /product="IS1381, transposase orfA"
FT                   /note="identified by similarity to GB:AAT10382.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44857"
FT                   /protein_id="ABA44857.1"
FT                   /translation="MNYEASKQLTDVRFKRLVGVQRTTFEEMLAVLKTAYQRKHAKGGR
FT                   TPKLSLEDLLMATLQYMREYRTYEQIAADFGIHESNLIRRSQWVESTLIQSGFTISKTH
FT                   LSAEDTVIVDATEVKINRPKKIN"
FT   gene            complement(153000..153170)
FT                   /locus_tag="SAK_0192"
FT   CDS_pept        complement(153000..153170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46007"
FT                   /protein_id="ABA46007.1"
FT                   /translation="MKLKISVLTAASAVTLLLATSASLAKADTVSYPSRDAGFVYSRGY
FT                   APKHFLSAYDK"
FT   gene            complement(153511..154251)
FT                   /locus_tag="SAK_0193"
FT   CDS_pept        complement(153511..154251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0193"
FT                   /product="amino acid ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /note="identified by similarity to GB:AAL97043.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45083"
FT                   /protein_id="ABA45083.1"
FT                   /translation="MTQAILEIKHLKKSYGSNEVLKDISLSVNKGEVISIIGSSGSGKS
FT                   TFLRSINLLEEPSGGEILYHGHNVLEKGYDLNNYREKLGMVFQSFNLFENLNILENAIV
FT                   AQTTVLKRERQEAEKIAKENLNAVGMTEQYWKAKPKQLSGGQKQRVAIARALSVNPEAI
FT                   LFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTHEMEFAKEVSDRVIFMDKGIIAEQ
FT                   GTPKQLFENPTQERTKEFLQRFLK"
FT   gene            complement(154261..155811)
FT                   /locus_tag="SAK_0194"
FT   CDS_pept        complement(154261..155811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0194"
FT                   /product="amino acid ABC transporter, amino
FT                   acid-binding/permease protein, His/Glu/Gln/Arg/opine
FT                   family"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46284"
FT                   /protein_id="ABA46284.1"
FT                   /translation="MKKILLSLFTALLITSGGMTSIQADEYLRVGMEAAYAPFNWTQND
FT                   NTNGAVPIEGTDQYANGYDVQVAKKLAKKLNKKVVVVKTKWEGLVPALTSGKLDMIIAG
FT                   MSPTEERKKEINFSKPYYISEPTLVVNAEGKYTNAKNISDFKNAKVTAQQGVYLYNLID
FT                   QINGVKKEVAMGDFNQLRQAVESGVVDAYVSERPDATSAQTANPKLKMIELHQGFKTSD
FT                   ADTNISVGMRKGDNRINQVNQVLESISRDKQIALMDKMIKEQPSVKKEKNGKPNFFEQM
FT                   ATILKNNGSQFLRGTATTLLISMVGTIVGLFIGLLIGVFRTAPKSDNKLKAALQKLLGW
FT                   LLNIYIEVFRGTPMIVQSMVIYYGTAQAFGVSLDRTLAAIFIVSINTGAYMSEIVRGGI
FT                   FSVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVVE
FT                   LYFSGNTVATQTYQYFQTFTIIAIIYFILTFTVTRTLRYIEKRFDSDNYTTGANQLQV"
FT   gene            155947..157821
FT                   /locus_tag="SAK_0195"
FT   CDS_pept        155947..157821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK33351.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44436"
FT                   /protein_id="ABA44436.1"
FT                   /translation="MKKCFLAICLALSFFMVSVQADEVDYNIPHYEGNLTIHNDNSADF
FT                   TEKVTYQFDSSYNGQYVTLGTAGKLPDNFDINNKPQVEVSINGKARKVSCQIEDLEDGY
FT                   RLKVFNDGEAGDTVKVNVQWKLKNVLFMHKDVGELNWIPISDWDKTLEKVDFWISTDKK
FT                   VALSRLWGHLGYLKTPPKIRQNNNRYHLTAFNVNKRLEFHGYWDRSYFNLPTNSKNNYK
FT                   KKIEHQEKMIERHGFILSFLLRILLPSFFIIVTLFISIRVSLFRKKVNKYGQFPKDLHL
FT                   YEAPEDLSPLELTQSIYSMSFKNFQDEEKKTHLISQEQLIQSILLDLIDRKVLNYDDNL
FT                   LSLANLDRASDAEIDFIEFAFADSTSLKPDQLFSNYQFSYKETLRELKKQHKASDLQTQ
FT                   MRRRGSNALSRITRLTRLISKDNINSLRRKGISSPYRKMSSEESKELSRLKRFSYLSPL
FT                   ISFVVIIYTLFLNYFTYFCIYLLLFVVILLLNKIIFMMTRKISNGYIVTEDGASRVYQW
FT                   TSFRNMLRDIKSFDRSELESIVLWNRILVYATLFGYADRVEKVLRVNQIDIPERFANID
FT                   SHQFAISVNQSSNHFSTITENVSHASNFSVNSGGSSGGFSGGGGGGAF"
FT   gene            157867..158706
FT                   /locus_tag="SAK_0196"
FT   CDS_pept        157867..158706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0196"
FT                   /product="undecaprenol kinase, putative"
FT                   /note="identified by similarity to SP:P31054; match to
FT                   protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46299"
FT                   /db_xref="GOA:Q3K3N4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3N4"
FT                   /protein_id="ABA46299.1"
FT                   /translation="MLIIELLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLNQSKSF
FT                   VEMFNIVIQLGAIMAVIVIYFKRLNPFQPGKSAREIRLTWQLWLKVVIACIPSILIALP
FT                   FDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNAHLKPQVTELASMSYKTAFLIGCFQV
FT                   LSIVPGTSRSGATILGAIIIGTSRSVAADFTFFLAIPTMFGYSGLKAVKYFLDGNVLSL
FT                   DQSLILLVASLIAFVVSLYVIRFLTDYVKRHDFTIFGKYRIVLGSLLILYWLVVHLF"
FT   gene            158826..159581
FT                   /locus_tag="SAK_0197"
FT   CDS_pept        158826..159581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0197"
FT                   /product="negative regulator of competence MecA, putative"
FT                   /note="identified by similarity to SP:P37958; match to
FT                   protein family HMM PF05389"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45965"
FT                   /db_xref="GOA:Q3K3N3"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3N3"
FT                   /protein_id="ABA45965.1"
FT                   /translation="MEMKQISETTLKITISMEDLEDRGMELKDFLIPQEKTEEFFYSVM
FT                   DELDLPENFKNSGMLSFRVTPKKDRIDVFVTKSELSKDLNLEELADLGDISKMSPEDFF
FT                   KTLEQSMLEKGDTDAHAKLAEIENMMDKATQEVVEENVSEEQAEKEVETIGYVHYVFDF
FT                   DNIEAVVRFSQTIDFPIEASELYKNGKGYHMTILLDLENQPSYFANLMYARMLEHANVG
FT                   TKTRAYLKEHSIQLIHDDAISKLQMIEMG"
FT   gene            159583..160743
FT                   /locus_tag="SAK_0198"
FT   CDS_pept        159583..160743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0198"
FT                   /product="glycosyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF00953"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45029"
FT                   /protein_id="ABA45029.1"
FT                   /translation="MIPFTIEYIFVLIGAFLLSIILTPIIRVISLKVGAVDKPNARRIN
FT                   KVPMPSSGGLAIFLSFVVTTLFFMPMAASRHFIEVSYFHYILPVIIGGLVVTTTGFIDD
FT                   IFELRPRYKMLGIIIAAIIIWKFTHFRFDSFKIPIGGPLLEFGPILTFFLTVLWIISIT
FT                   NAINLIDGLDGLVSGVSIISLATMAVVSYFFLPKIDFFLTLTIVILIASIVGFFPYNYH
FT                   PAIIYLGDAGALFIGFMIGVLSLQGLKNSTAVAVITPVIILGVPILDTAVAIVRRKLSG
FT                   KKISEADKMHLHHRLLSMGFTHRGAVLVVYGIAIIFSLIALLLNVSSRIGGIFLLLALL
FT                   LVMEIFIEGLNIWGENRTPLFNLLKFIGNSDYRQSVIAKYSDKHQK"
FT   gene            160908..161678
FT                   /gene="sufC"
FT                   /locus_tag="SAK_0199"
FT   CDS_pept        160908..161678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="SAK_0199"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01978"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44616"
FT                   /protein_id="ABA44616.1"
FT                   /translation="MSVLEIKNLHVSIEDKEILKGLNLTLKTGEIAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTAGEILFDGEDILELEVDERARLGLFLAMQYPSEVPGITNAEFIRAA
FT                   MNAGKADDDKISIRQFITKLDEKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGEGFGAMIITHYQRLLNYITPDKVHVMMDG
FT                   KVVLSGGPELAVRLEKEGYAQIAEELGLEYKEEV"
FT   gene            161715..162977
FT                   /gene="sufD"
FT                   /locus_tag="SAK_0200"
FT   CDS_pept        161715..162977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="SAK_0200"
FT                   /product="FeS assembly protein SufD"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01981"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45791"
FT                   /protein_id="ABA45791.1"
FT                   /translation="MSKEAILNFLQAKGEPTWLQELRLKAFEKIEELELPVIERVKFHR
FT                   WNLGDGTILENDYTANIPDFTELGNNPKLVQIGTQTVLEQVPMELIEKGVVFTDFYSAL
FT                   EEIPEVIERYFGKARPFEEDRLAAYHTAYFNSGAVLYIPDNVEITQPIEGLFYQDSQSK
FT                   VPFNKHILLIVGKNAKVSYLERFESIGDGTERTSANISVEVIAQAGSQIKFASIDRLGE
FT                   NVTTFISRRGRHSSDATIDWALGVMNEGNVVADFDSDLIGDGSHANLKVVAASSGRQVQ
FT                   GIDTRVTNYGCNSVGHILQHGVILERGTLTFNGIGHVIKGAKGADAQQESRVLMLSDKA
FT                   RSDANPILLIDENDVTAGHAASIGQVDPEDLYYLMSRGLNQKTAEQLVIRGFLGTVIAE
FT                   IPVKEVRDEMIAVIDTKLEKR"
FT   gene            162979..164211
FT                   /gene="sufS"
FT                   /locus_tag="SAK_0201"
FT   CDS_pept        162979..164211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="SAK_0201"
FT                   /product="cysteine desulfurase SufS"
FT                   /EC_number="4.4.1.1"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45789"
FT                   /protein_id="ABA45789.1"
FT                   /translation="MTLLDSYKLKQDFPILNQLVNDEPLIYLDNAATTQKPNQVLETLR
FT                   DYYQNDNANVHRGVHTLAERATAQYETAREKARQFLNAKSSKEILFTRGTTTGLNWVAK
FT                   FAESILERGDEVLISIMEHHSNIIPWQQACERTGAKLVYAYLKDGSLDLEDFYNKLSSK
FT                   TKFVSLAHISNVLGCITPVKAIAERVHQVGAYMVVDGAQSAPHMAIDVQDLDCDFFALS
FT                   GHKMLGPTGIGVLYGKESILDKMPPVEFGGEMIDFVYEHSATWKELPWKFEAGTPNIAG
FT                   AIAFGEALDYLTDVGMDEIHQYEQSLVSYVLPKLQAIDGLTIYGPSDAESHVGVIAFNL
FT                   EGLHPHDVATAMDYEGVAVRAGHHCAQPLINHLGIHSAVRASFYFYNTKEDCDKLVDAI
FT                   QKTKEFFNGTL"
FT   gene            164198..164641
FT                   /locus_tag="SAK_0202"
FT   CDS_pept        164198..164641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0202"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="identified by match to protein family HMM PF01592;
FT                   match to protein family HMM TIGR01994"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44601"
FT                   /protein_id="ABA44601.1"
FT                   /translation="MALSKLDNLYMAVVADHSKHPHHHGFLEGVEQVQLNNPTCGDVIS
FT                   LSVKFDGNIISDIAFAGNGCTISTASSSMMTDAVIGKTKEEALQLADVFSKMVQGDQNP
FT                   KQEKLGDAEFLAGVSKFPQRIKCATLSWNALRKAIERDNQAEL"
FT   gene            164741..166159
FT                   /gene="sufB"
FT                   /locus_tag="SAK_0203"
FT   CDS_pept        164741..166159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="SAK_0203"
FT                   /product="FeS assembly protein SufB"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01980"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46218"
FT                   /protein_id="ABA46218.1"
FT                   /translation="MSEINEKVEPQPIDLGEYKFGFHDDVKPIYSTGKGLNEAVIRELS
FT                   AAKGEPEWMLDFRLKSLETFNKMPMQTWGADLSDIDFDDIIYYQKASDKPARDWDDVPE
FT                   KIKETFERIGIPEAERAYLAGASAQYESEVVYHNMKEEYDKLGIVFTDTDSALKEYPEL
FT                   FKKYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RATAKKDATVEWIDGNLGAKTTMKYPSVYLDGEGARGTMLSIAFANKGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKGGGKVDYRGQVTFNKDSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSEAEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(166231..167418)
FT                   /locus_tag="SAK_0204"
FT   CDS_pept        complement(166231..167418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0204"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45133"
FT                   /protein_id="ABA45133.1"
FT                   /translation="MPKLIVSFLCILLSLTCVNSVQAEEHKDIMQITREAGYDVKDINK
FT                   PKASIVIDNKGHILWEDNADLERDPASMSKMFTLYLLFEDLAKGKTSLNTTVTATETDQ
FT                   AISKIYEISNNNIHAGVAYPIRELITMTAVPSSNVATIMIANHLSQNNPDAFIKRINET
FT                   AKKLGMTKTHFYNPSGAVASAFNGLYSPKEYDNNATNVTTARDLSILTYHFLKKYPDIL
FT                   NYTKYPEVKAMVGTPYEETFTTYNYSTPGAKFGLEGVDGLKTGSSPSAAFNALVTAKRQ
FT                   NTRLITVVLGVGDWSDQDGEYYRHPFVNALVEKGFKDAKNISSKTPVLKAVKPKKEVTK
FT                   TKTKSIQEQPQTKEQWWTKTDQFIQSHFVSILIVLGTIAILCLLAGIVLLIKRSR"
FT   gene            complement(167571..168806)
FT                   /locus_tag="SAK_0205"
FT   CDS_pept        complement(167571..168806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0205"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by similarity to SP:P08750; match to
FT                   protein family HMM PF00768; match to protein family HMM
FT                   PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45584"
FT                   /protein_id="ABA45584.1"
FT                   /translation="MKKIITSILLLSCIFFMPTISAESFNASAKHALAVDLDSGKILYE
FT                   KDANKPAAIASLTKIMTVYMVYKEIDNGNLKWNTKVNISDYPYQLTRESDASNVPLEKR
FT                   RYTVKQLVDAAMISSANSAAIALAEHISGTESKFVDKMTAQLEKWGIHDSHLVNASGLN
FT                   NSMLGNHIYPKSSQNDENKMSARDIAIVAYHLVNEYPSILKITSKSVAKFDKDIMHSYN
FT                   YMLPDMPVFRPGITGLKTGTTELAGQSFIATSTESGMRLLTVIMHADKADKDKYARFTA
FT                   TNSLLNYITNTYEPNLVLAKGAAYKGKEASVRDGKEQSVIAVAKNDLKVVQKKNITKQN
FT                   QLKINFKKELTAPITKKENLGKAYYVDLNKVGKGYLIKEPSVHLVAKDSIERSFFLKVW
FT                   WNHFVRYVNEKL"
FT   gene            169047..170702
FT                   /locus_tag="SAK_0206"
FT   CDS_pept        169047..170702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0206"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /note="identified by similarity to GB:AAM99056.1; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44722"
FT                   /protein_id="ABA44722.1"
FT                   /translation="MAKQKNNWRRVGVGVLTLASVATLAACGSKSASQDSNGAINWAIP
FT                   TEINTLDLSKVTDTYSNLAIGNSSSNFLRLDKDGKTRPDLATKVDVSKDGLTYTATLRK
FT                   GLKWSDGSKLTAKDFVYSWQRLVDPKTASQYAYLAVEGHVLNADKINEGQEKDLNKLGV
FT                   KAEGDDKVVITLSSPSPQFIYYLAFTNFMPQKQEVVEKYGKDYATTSKNTVYSGPYTVE
FT                   GWNGSNGTFTLKKNKNYWDAKNVKTKEVRIQTVKKPDTAVQMYKRGELDAANISNTSAI
FT                   YQANKNNKDVTDVLEATTAYMEYNTTGSVKGLDNVKIRRALNLATNRKGVVQAAVDTGS
FT                   KPAIAFAPTGLAKTPDGTDLAKYVAPGYEYNKTEAAKLFKEGLAESGLTKLKLTITADA
FT                   DAPAAKNSVDYIKSTWEAALPGLTVEEKFVTFKQRLEDSRKQNFDIVVSLWGGDYPEGS
FT                   TFYGLFKSDSQNNDGKFANKDYDAAYNKAISEDAMKPAESAKDYKEAEKILFEQGAYNP
FT                   LYFRSGKGLQNPKLKGVIRNTTGLSIDFTHAYKK"
FT   gene            170821..171735
FT                   /gene="oppD"
FT                   /locus_tag="SAK_0207"
FT   CDS_pept        170821..171735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="SAK_0207"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P24138; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45753"
FT                   /protein_id="ABA45753.1"
FT                   /translation="MIKYILKRVAILLVTLWVVITLSFFLMQILPGTPYNNPKLTEEMI
FT                   ALLNKQYGLDKPVWQQYLTYLWNVLHGDFGTSYQSVNQPVSRMISLRLGVSVHLGVQAL
FT                   VFGVLGGILVGAISARHKNDKVDGILSVIATLGISMPSFIIGILLLDYFGFKWNLLPLS
FT                   GWGTFSQTILPSLALGLPTLASVSRFFRSEMIETLNSDYVQLARSKGMTIRQVTRKHAY
FT                   RNSMIPILTLIGPLAAGLLTGSALIEQIFSIPGIGQQFVTSIPTKDYPVIMGTTIVYAV
FT                   MLMVAILITDVVISIVDPRVRLQ"
FT   gene            171745..172776
FT                   /locus_tag="SAK_0208"
FT   CDS_pept        171745..172776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0208"
FT                   /product="oligopeptide ABC transporter, permease protein
FT                   OppC, putative"
FT                   /note="identified by similarity to SP:P24139; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44636"
FT                   /protein_id="ABA44636.1"
FT                   /translation="MADKNRTFKLVGAGSSSTQEKIEKPALSFMQDAWRRLKKNKLAVV
FT                   SLYLLALLLTFSLASNLFVTQKDANGFDSKKVTTYRNLPPKLSSNLPFWNGSIKYAGNT
FT                   ESTDAYKSQNVPEKVKYALGTDSLGRSVAKRIIVGIRISLLVAIAATFIDLIIGVTYGL
FT                   VSGFAGGRLDTLMQRIVEVISSIPNLVIVTMLGLVLGNGITAIIISIAFTGWTSMSRQV
FT                   RNLTLSYREREFVLAARSLGESPIKIAFKHILPNISGIIIVQIMMTIPSAIMYEAVLSA
FT                   INLGVKPPTASLGSLISDAQENLQYYPYQVILPALALVMISLAFILLGDGLRDAFDPKS
FT                   SDE"
FT   gene            172789..173835
FT                   /gene="oppD"
FT                   /locus_tag="SAK_0209"
FT   CDS_pept        172789..173835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="SAK_0209"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P24136; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44991"
FT                   /protein_id="ABA44991.1"
FT                   /translation="MEKETILSVNNLHVDFHTYAGEVKAIRDVNFELKKGETLAIVGES
FT                   GSGKSVTTRTLIGLNAKNSEISGNVQFKGRNLVELSEEEWTKVRGNEISMIFQDPMTSL
FT                   DPTMKIGMQIAEPMMIHQKISKKDALKLALELMKDVGIPNAEEHINDYPHQWSGGMRQR
FT                   AVIAIALAADPEILIADEPTTALDVTIQAQILNLMKKIQAERDSSIVFITHDLGVVAGM
FT                   ADRVAVMYAGKIVEFGTVDEVFYNPQHPYTWGLLNSMPTTDTESGSLESIPGTPPDLLN
FT                   PPKGDAFAARNEFALDIDHEEEPPYFKVSETHFAATWLLDERSPKVLPPLPIQKRWEKW
FT                   NEIEGRKA"
FT   gene            173835..174767
FT                   /gene="oppF"
FT                   /locus_tag="SAK_0210"
FT   CDS_pept        173835..174767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="SAK_0210"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P24137; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45978"
FT                   /protein_id="ABA45978.1"
FT                   /translation="MTENRKKLVEVKNVSLTFNKGKANEVRAIDNVSFDIYEGEVFGLV
FT                   GESGSGKTTVGRSILKLYDISDGEITFNGEVISHLKGKALHSFRKDAQMIFQDPQASLN
FT                   GRMKIRDIVAEGLDIHKLAKSKSDRDSKVQALLDLVGLNKDHLTRYPHEFSGGQRQRIG
FT                   IARALAVEPKFIIADEPISALDVSIQAQVVNLMQKLQREQGLTYLFIAHDLSMVKYISD
FT                   RIGVMHWGKLLEVGTSDDVYNNPIHPYTKSLLSAIPEPDPESERQRVHQPYNPAIEQDG
FT                   QERQMHEITPGHFVLSTPQEAEEYKKQIL"
FT   gene            175172..176678
FT                   /gene="rrsD"
FT                   /locus_tag="SAK_0211"
FT   rRNA            175172..176678
FT                   /gene="rrsD"
FT                   /locus_tag="SAK_0211"
FT                   /product="16S ribosomal RNA"
FT   gene            176768..176840
FT                   /locus_tag="SAK_0212"
FT   tRNA            176768..176840
FT                   /locus_tag="SAK_0212"
FT                   /product="tRNA-Ala"
FT   gene            176997..179899
FT                   /gene="rrlD"
FT                   /locus_tag="SAK_0213"
FT   rRNA            176997..179899
FT                   /gene="rrlD"
FT                   /locus_tag="SAK_0213"
FT                   /product="23S ribosomal RNA"
FT   gene            179974..180089
FT                   /gene="rrfD"
FT                   /locus_tag="SAK_0214"
FT   rRNA            179974..180089
FT                   /gene="rrfD"
FT                   /locus_tag="SAK_0214"
FT                   /product="5S ribosomal RNA"
FT   gene            180095..180168
FT                   /locus_tag="SAK_0215"
FT   tRNA            180095..180168
FT                   /locus_tag="SAK_0215"
FT                   /product="tRNA-Asn"
FT   gene            180308..181159
FT                   /gene="ispE"
FT                   /locus_tag="SAK_0216"
FT   CDS_pept        180308..181159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SAK_0216"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45272"
FT                   /db_xref="GOA:Q3K3L9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3L9"
FT                   /protein_id="ABA45272.1"
FT                   /translation="MKIFEKAPAKLNLGLDIKGRCDDGYHELAMIMVSIDLNDYVTISE
FT                   LKEDCIVIDSDSSKMPLNNDNDVFKAADIIKNQYGINKGVHIRLEKSIPVCAGLGGGST
FT                   DAAATIRALNRLWNLQMDYDEMVAIGFKIGSDVPYCLGGGCSLVLGKGEIVKPLPTLRP
FT                   CWIVLVKPDFGISTKSIFRDIDCKSISRVDIDLLKSAILSSDYQLMVKSMGNSLEDITI
FT                   TKNPVISTIKERMLNSGADVALMTGSGPTVFSMCSTEKKADRVFNSMKGFCKEVYKVRL
FT                   LR"
FT   gene            181245..181688
FT                   /gene="adcR"
FT                   /locus_tag="SAK_0217"
FT   CDS_pept        181245..181688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="SAK_0217"
FT                   /product="adc operon repressor AdcR"
FT                   /note="identified by similarity to GB:AAO43167.1; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46120"
FT                   /protein_id="ABA46120.1"
FT                   /translation="MTVLEQKLDHLVSQILLKAENQHELLFGTCQSDVKLTNTQEHILM
FT                   LLSQEQLTNSDLAKKLNISQAAVTKAVKSLISQDMLKANKDSKDARITYFELSELAKPI
FT                   ADEHTHHHDNTLGVYGRLVNHFSKDEKVVLERFLDLFSRELEG"
FT   gene            181691..182401
FT                   /gene="adcC"
FT                   /locus_tag="SAK_0218"
FT   CDS_pept        181691..182401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="SAK_0218"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:O87862; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45367"
FT                   /protein_id="ABA45367.1"
FT                   /translation="MRYITVSGLTFQYDSDPVLEGVNYHLDSGEFVTLTGENGAAKSTL
FT                   IKATLGILTPKVGTVNISKENKEGKKLRIAYLPQQIASFNAGFPSSVYEFVKSGRYPRN
FT                   GWFRRLTKHDEEHIRVSLEAVGMWDNRHKKIGSLSGGQKQRAVIARMFASDPDIFVLDE
FT                   PTTGMDAGTTEKFYELMHHNAHKHGKSVLMITHDPDEVKGYADRNIHLVRNQSLPWRCF
FT                   NVHTNEMEVESDAT"
FT   gene            182391..183203
FT                   /gene="adcB"
FT                   /locus_tag="SAK_0219"
FT   CDS_pept        182391..183203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="SAK_0219"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /note="identified by similarity to GB:CAA96187.1; match to
FT                   protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46179"
FT                   /protein_id="ABA46179.1"
FT                   /translation="MLLDMLSYDFMQRALLAVVAISIFAPILGIFLILRRQSLMSDTLS
FT                   HVSLAGVALGVVLGISPTWSTIFVVTLAAVVLEYLRTVYKHYMEISTAILMSMGLAISL
FT                   IVMSKAHNVGNVSLEQYLFGSIITIGKEQVIALFVIALITFILTILFIRPMYILTFDED
FT                   TAFVDGLPVRTMSILFNVVTGIAIALTIPAAGALLVSTIMVLPASIAMRLGRNFKTVIF
FT                   LGMLIGFVGMVAGIFLSYYWETPASATITMIFIGIFLLVSLVGLLRKR"
FT   gene            complement(183414..184445)
FT                   /locus_tag="SAK_0220"
FT   CDS_pept        complement(183414..184445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D86644"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45473"
FT                   /protein_id="ABA45473.1"
FT                   /translation="MKLSKQLYKSLPLLTVVLCVGALQQNVEAKAKHYKTTSHVETQYV
FT                   STSSKKILPFTHNKQIKVGSLDNLGRATYSHIQLRDADEPKIKRERLTYNPTGWHNYKF
FT                   TTEKGKTTWLMDRGHLVGYQFSGMNNVPENLVTMTKYLNTGFSENNPDGMLYYENRLDS
FT                   WLANHKNFWLDYKVTPIYEGNNLVPSRVELQYVGIDKQGKLLEIKLGGGKEQVDEYGVT
FT                   TVTLENTSPLAKIDYKTGMLIKEDGKQAEEGEDPNSDADENEAAIESASDIEENTNTNT
FT                   SESDTNNVAPQNRIVYVANKGRSNTYWYSLENIKNANTANIVQMTEQEALNQHKHHSTT
FT                   EAQ"
FT   gene            complement(185024..186283)
FT                   /gene="tyrS"
FT                   /locus_tag="SAK_0221"
FT   CDS_pept        complement(185024..186283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SAK_0221"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by similarity to SP:P22326; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44596"
FT                   /db_xref="GOA:Q3K3L4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3L4"
FT                   /protein_id="ABA44596.1"
FT                   /translation="MNIFDELKERGLVFQTTDEDALRKALEEGFVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDVERSLQTKETVVSWGNKIRGQ
FT                   LSNFLEFETGDNKAVLVNNYDWFSNISFIDFLRDVGKYFTVNYMMSKESVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNKNYNVTLQIGGSDQWGNMTAGTELIRRKSNGVSHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDADAVRFLKIFTFLSLKEIEDIR
FT                   IQFEEAPHQRLAQKTLAREVVTLVHGEKAYKEAVNITEQLFAGNIKGLSVKELKQGLRG
FT                   VPNYHVQTEDNLNIIDLLVTSGVVNSKRQAREDVSNGAIYINGDRIQDLEYTISENDKL
FT                   ENEITVIRRGKKKYFVLNFK"
FT   gene            186394..188691
FT                   /locus_tag="SAK_0222"
FT   CDS_pept        186394..188691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0222"
FT                   /product="penicillin-binding protein 1B"
FT                   /note="identified by similarity to GB:BAD00819.1; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45670"
FT                   /protein_id="ABA45670.1"
FT                   /translation="MFKGNKKLNSSKLGDYTPLEFGSIFLRIVKLLSDFIYVIISLFVM
FT                   LGVGLAVGYLASQVDSVKVPSKNSLVTQVNTLTRVSRLTYSDKSQISEIDTDLQRTPVA
FT                   KDAISDNIKKAIIATEDENFNDHKGVVPKAVLRAAAGSVLGFGESSGGSTLTQQLLKQQ
FT                   ILGDDPSFKRKSKEIIYALALERYMDKDSILSDYLNVSPFGRNNKGQNIAGIEEAAQGI
FT                   FGVSAKDLTIPQAAFLAGLPQSPIVYSPYTADAQLKSDKDLSFGIKRQKNVLYNMYRTR
FT                   ALTKDEYKSYKDYDIKKDFIKPAVATTNHHDYLYYSALSEAQKVMYNYLIKKDNVSEHD
FT                   LKNDETRATYRHRAIEEIQQGGYTIKTTINKSVYQAMQDAAAQYGGLLDDGTGKVQMGN
FT                   VLTDNSSGAIIGFIGGRNYSENQNNHAFDTARSPGSSIKPILPYGIAIDQGMLGSGSVL
FT                   SNYPTTYSSGEKIMHADEEGTAMVNLQESLDISWNIPAFWTYKMLRDRGVDVKNYMEKL
FT                   DYPIENFGIESLPLGGGIDTSVAQQTNLYQMIANGGVYHKQYMIESIEDSNGKVIYNHE
FT                   SKPVRVFSKATATILQQLLHGPINSGKTTTFKNRLQGLNSGLAGVDWIGKTGTTNSTSD
FT                   VWLMLSTPKVTLGGWAGHDNNASLAKLTGYNNNANYMAHLVNAINNADGNTFGKSERFR
FT                   LDDSVIKAKVLKSTGLQPGVVTVNGRRITVGGESTTSYWAKNGPGTMTYRFAIGGTDSD
FT                   YQKAWSTLGGKR"
FT   gene            189215..192790
FT                   /gene="rpoB"
FT                   /locus_tag="SAK_0223"
FT   CDS_pept        189215..192790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SAK_0223"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37870; match to
FT                   protein family HMM PF00562; match to protein family HMM
FT                   PF04560; match to protein family HMM PF04561; match to
FT                   protein family HMM PF04563; match to protein family HMM
FT                   PF04565; match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45663"
FT                   /db_xref="GOA:Q3K3L2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3L2"
FT                   /protein_id="ABA45663.1"
FT                   /translation="MAGHEVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDAGL
FT                   KEVFEDVLPISNFTDTMDLEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDAKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGDSELVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLVARFFDPRRYDLAAVGRYKIN
FT                   KKLNLKTRLLNQTIAENLVDGETGEILVEAGTVMTRDVIDSIAEHIDGDLNKFVYTPND
FT                   YAVVTEPVILQKFKVVAPTDPDRVVTIVGNSNPEDKVRALTPADILAEMSYFLNLAEGI
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNEVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRSTGAVTNEIVWLTADEEDEF
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFPSSIVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAKHDGRVIFSDAEKV
FT                   EVRREDGSLDVYHVQKFRRSNSGTAYNQRTLVKVGDLVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEDSLRDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWETVQEAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDVMHVDD
FT                   LEKARVKQEAEEKQAEQVSEVVQED"
FT   gene            192907..196557
FT                   /gene="rpoC"
FT                   /locus_tag="SAK_0224"
FT   CDS_pept        192907..196557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SAK_0224"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37871; match to
FT                   protein family HMM PF00623; match to protein family HMM
FT                   PF04983; match to protein family HMM PF04997; match to
FT                   protein family HMM PF04998; match to protein family HMM
FT                   PF05000; match to protein family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44773"
FT                   /db_xref="GOA:Q3K3L1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3L1"
FT                   /protein_id="ABA44773.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIICDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPMDTPLEPKSLLTEREYREKLQEYG
FT                   YGSFVAKMGAEAIQDLLKRVDLDAEIAVLKEELKSATGQKRVKAVRRLDVLDAFKKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARDLAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDHDEAVMAYQNGYVHLHTRVGIAVDSMPNKPWTEEQKHKIMVTTVGKILFNDIMPEDL
FT                   PYLIEPNNANLTEKTPDKYFLEPGQDIQAVIDNLEINIPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEDINKAFRRGLMT
FT                   EEDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLTITAITDGKEVTETLEERLIGRYTKKSIKHPETGEILVGADTLITE
FT                   DMAAKVVKAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGEVVAIEEDSST
FT                   RTKKVFVKGQTGEGEYVVPFTARMKVEVGDEVARGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPLAVNEVEIIEGTPVDAEVTEVSTPTTED"
FT   gene            196671..197036
FT                   /locus_tag="SAK_0225"
FT   CDS_pept        196671..197036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06279"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45903"
FT                   /protein_id="ABA45903.1"
FT                   /translation="MYQVVKMFGDWEPWWFIEGWEEDITEIAEYDTLSEALLYFQEEWD
FT                   RGQEKWPYFQSKSSLLATFWSIKEKRWCEECDEYLQQYHSLMLLKEWQEIPKEESIERF
FT                   EVFNKIAELPSACSLNL"
FT   gene            197209..198180
FT                   /gene="comGA"
FT                   /locus_tag="SAK_0226"
FT   CDS_pept        197209..198180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comGA"
FT                   /locus_tag="SAK_0226"
FT                   /product="competence protein ComGA"
FT                   /note="identified by similarity to GB:AAC45310.1; match to
FT                   protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45021"
FT                   /protein_id="ABA45021.1"
FT                   /translation="MVQSLAKQVIHQAVEVNAQDIYIIPKGDCYELYMRIDDERRFIDV
FT                   FEFNRMASLISHFKFVAGMNVGEKRRSQLGSCDYELSEGRLVSLRLSSVGDYRGQESLV
FT                   IRILYSGHQDLKYWFDNIKQMKEVLGIRGLYLFSGPVGSGKTTLMYQLASEVFKNKQII
FT                   TIEDPVEIKNDKMLQLQLNEDIGMTYDALIKLSLRHRPDILIIGEIRDQATARAVIRAS
FT                   LTGVMVFSTIHAKSIPGVYDRLIELGVNYQELENSLKLIAYQRLIGGGSLIDFETGNFK
FT                   KHSSDKWNRQVDILAEEGHISKKQAQVEKIIPQETTESSPTF"
FT   gene            198215..199117
FT                   /locus_tag="SAK_0227"
FT   CDS_pept        198215..199117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0227"
FT                   /product="ComG operon protein 2, putative"
FT                   /note="identified by similarity to SP:P25954; similarity to
FT                   GB:AAC23738.1; match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45187"
FT                   /protein_id="ABA45187.1"
FT                   /translation="MVTFLKRSKLLSDCYTDSMNKALLEGKDLSKMLGELGFSDTVITQ
FT                   VALADLHGNISRSLLKIESYLANLLLVRKKVIEVATYPLILLSFLVLIMIGLRNYLMPQ
FT                   LGENNFATRLITNVPNIFLLLLAVVLIFSLIFYIIQKRLSRIKVACFLTTIPLVGSYVK
FT                   LYLTAYYAREWGNLLSQGIELDQIVKVMQNQKSKLFREIGYDMEEGFLSGKAFHQKVLD
FT                   YPFFLTELSLMIEYGQVKAKLGTELDIYADEKWEDFFTKLARATQLIQPVIFIFVALII
FT                   VMIYAAMLLPMYQNMEILS"
FT   gene            199114..199443
FT                   /locus_tag="SAK_0228"
FT   CDS_pept        199114..199443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0228"
FT                   /product="competence protein, putative"
FT                   /note="identified by similarity to SP:P25955; similarity to
FT                   GB:AAC23739.1; match to protein family HMM PF07963; match
FT                   to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44440"
FT                   /protein_id="ABA44440.1"
FT                   /translation="MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKES
FT                   VTRTGNAAVVKVVESQAELFELQETGRKASLSTLKSGGYITEKQEKAYLDYYKDSSNGS
FT                   QKISS"
FT   gene            199493..199831
FT                   /locus_tag="SAK_0229"
FT   CDS_pept        199493..199831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0229"
FT                   /product="competence protein, putative"
FT                   /note="identified by similarity to GB:AAC23740.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45571"
FT                   /protein_id="ABA45571.1"
FT                   /translation="MTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTL
FT                   TISHNYLENTYERLYLPKTVKVVKSDTLAFDTNGGNSSLAKIQFECYRKTVTYQLYIGS
FT                   GNYRKKEN"
FT   gene            199803..200102
FT                   /locus_tag="SAK_0230"
FT   CDS_pept        199803..200102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN59587.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45631"
FT                   /protein_id="ABA45631.1"
FT                   /translation="MVIIVRKKIRAYILLESLVGLAILVTITRLVISEINRQQSHIARR
FT                   QHEQEVLILARMAVQTDQKILEANGVNIRIEESKNKIVLFEDNKEILHVSKVKG"
FT   gene            200125..200517
FT                   /locus_tag="SAK_0231"
FT   CDS_pept        200125..200517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN59586.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46083"
FT                   /protein_id="ABA46083.1"
FT                   /translation="MVALVTITGALLVYQGLTKLLAQQIVVMSSSSQSEWVLLTQQLNA
FT                   EFEGAHLEYLRQNKLYLRKQDKIVTFGKSNKDDFRKTGYDGRGYQPMVYGLDNCQMSQT
FT                   KSMVKLVFYFKDGLKRTFYYDFKEET"
FT   gene            200495..200866
FT                   /locus_tag="SAK_0232"
FT   CDS_pept        200495..200866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK33225.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44895"
FT                   /protein_id="ABA44895.1"
FT                   /translation="MILKKKLKAGILLQAIVLAAVFTLVLQFYLARILATERQYHSQIE
FT                   ASKAYLTAQLAYKTIEGDSISGKCYFTGGYASYLQEGNYLQVKVTLDKGGNYNHKFYRK
FT                   TDTLQVPLKSNDNKASHKH"
FT   gene            200981..201955
FT                   /locus_tag="SAK_0233"
FT   CDS_pept        200981..201955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL96922.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46309"
FT                   /protein_id="ABA46309.1"
FT                   /translation="MNFEKIETAYELILENIQTIENQLKTHIYDALIEQNSYYLGSSCD
FT                   LDMVVVNNQKLRQLDLSQEEWRRTFQFIFIKSAQTEQLQANHQFTPDSIGFILLFLLEE
FT                   LTSQETVDVLEIGSGTGNLAQTLLNNSSKELNYMGIEVDDLLIDLSASIAEIIGSSAQF
FT                   IQEDAVRPQILKESDVIISDLPVGYYPNDGIAKRYAVSSSKEHTYAHHLLMEQSLKYLK
FT                   KDGIAIFLAPENLLTSPQSDLLKEWLKGYADVIAVLTLPETIFGSRQNAKSIFVLKKQA
FT                   EQKPETFVYPLTDLQNRENMANFIENFQKWSRENSHYSKNMIK"
FT   gene            201987..203180
FT                   /gene="ackA"
FT                   /locus_tag="SAK_0234"
FT   CDS_pept        201987..203180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SAK_0234"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45194"
FT                   /db_xref="GOA:Q3K3K1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3K1"
FT                   /protein_id="ABA45194.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYEMPEEKVVAKGIIERIGLKDSISTVK
FT                   FDDKKDEQILDIVDHTQAVKILLEDLTKHGIIKDFNEITGVGHRVVAGGEYFKESALVD
FT                   DKVVEQVEELSALAPLHNPAAAAGIRAFREILPDITSVCVFDTAFHTTMQPHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHQYVAQEAAKQLGRPLEELKLITAHVGNGVSITANYHGQSI
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLVANDPELEDAAAVVNMLNKQSGLLGVSGTS
FT                   SDMRDIEAGLQSKDPNAVLAYNVFIDRIKKFIGQYLAVLNGADAIIFTAGMGENAPLMR
FT                   QDVIAGLSWFGIELDPEKNVFGYFGDITKPDSKVKVLVIPTDEELMIARDVERLKAK"
FT   gene            203332..203538
FT                   /locus_tag="SAK_0235"
FT   CDS_pept        203332..203538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0235"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44580"
FT                   /protein_id="ABA44580.1"
FT                   /translation="MKNSLQKLRKSRKLSQAELAVALGVTRQTIISLEKEKYTASLELA
FT                   FKIARYFDKQIEEVFIYTESEGG"
FT   gene            203597..203734
FT                   /locus_tag="SAK_0236"
FT   CDS_pept        203597..203734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0236"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45448"
FT                   /protein_id="ABA45448.1"
FT                   /translation="MSRMWTIDFCPPIVYQQYVFIITISISIAMSIFAIYRYASLKKTI
FT                   "
FT   gene            203775..204230
FT                   /locus_tag="SAK_0237"
FT   CDS_pept        203775..204230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN59581.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45885"
FT                   /protein_id="ABA45885.1"
FT                   /translation="MLIKGLLSPNSKVSPKDYKVYMRVLSFVFSVCSLIMIVSSFLHTF
FT                   ESNFTKGFSFGSGIALFAGSFYFLVITFSEKRFQHYYTKVFDERNQFIANMSCRLLFLL
FT                   SVLVLVVLCLINVWFGITFSYAKFLLLILSFILYGYLLIYFILQKLL"
FT   gene            204299..204964
FT                   /locus_tag="SAK_0238"
FT   CDS_pept        204299..204964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0238"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45711"
FT                   /protein_id="ABA45711.1"
FT                   /translation="MSFIIRKGKILALLIAFLVINQLVPILAVWLLKNHYQTPFTSILL
FT                   IGLELLIIALFLYYAKVKQIIRWKALLTRKALVTILLGWLSLRVPQIIGYLIMTMQGVK
FT                   DTANQTVIMELTKQLPLALMLIFAIIGAPIMEEIIFRYIIPKELFAKHQKWGFVIGTLA
FT                   FALIHSPSDIGSFIIYAGMGAILSFVYYKTEHLEYSIMIHFINNALAYSVLISTMMNN"
FT   gene            complement(204985..205755)
FT                   /gene="proC"
FT                   /locus_tag="SAK_0239"
FT   CDS_pept        complement(204985..205755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SAK_0239"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF01089;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46070"
FT                   /protein_id="ABA46070.1"
FT                   /translation="MKIGIIGVGKMASAIIQGLKQTQHDIIISGSCLERSKEIAERLDV
FT                   TYAESHQSLINQADIIMLGIKPQLFEKVLLPLDITKPIISMAAGISLARLSQLTRSDLP
FT                   LIRIMPNINAQILQSCTAICYNNHVSDELRQLAKEITDSFGSSFDIAETNFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKYGFPKEQALSIVGQTVLASSQNLLQGQNSTSDLIDNICSP
FT                   GGTTIAGLLDLEKNGLTHSVISAIDATIEKAKKL"
FT   gene            complement(205825..206892)
FT                   /gene="pepA"
FT                   /locus_tag="SAK_0240"
FT   CDS_pept        complement(205825..206892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SAK_0240"
FT                   /product="glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="identified by similarity to SP:Q48677; match to
FT                   protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44388"
FT                   /protein_id="ABA44388.1"
FT                   /translation="MSDLFNKIKTVTELDGIAGYEHNIRNFLRQEITPLVDQVETDGLG
FT                   GIFGVKNTHETNAPKVMVAAHMDEVGFMVSHIQPDGTFRVLEVGGWNPLVVSSQRFTLY
FT                   TRSGDAIPVISGSVPPHFLRGQSGGTTLPKISDIVFDGGFTDKNEAESFGIAPGDIIVP
FT                   KSETILTANQKHIMSKAWDNRYGVLMVTELLKSLKDQSLSNTLIAGANVQEEVGLRGAH
FT                   VSTTKFNPDIFLAVDCSPAGDIYGEQGKIGEGTLIRFYDPGHIMLKDMRDFLLTTAEEA
FT                   GIKYQYYAANGGTDAGAAHLKNSGIPSTTIGVCARYIHSHQTLYAMDDFLQAQAYLQAI
FT                   VNKLDRSTVDIIKGY"
FT   gene            complement(207077..207316)
FT                   /locus_tag="SAK_0241"
FT   CDS_pept        complement(207077..207316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45840"
FT                   /protein_id="ABA45840.1"
FT                   /translation="MKEKLLVPALNCLLGLLFLGDHWFLFRLQNGELFAIVTLILLCTT
FT                   SFLINKNHPKNLTLIAMVITFLAVLSFLSTFLLA"
FT   gene            207477..207761
FT                   /locus_tag="SAK_0242"
FT   CDS_pept        207477..207761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL96928.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44501"
FT                   /protein_id="ABA44501.1"
FT                   /translation="MKNKKILFGTGLAGVGLLAAAGYTLTKKVTDYKRQQITQTLREFF
FT                   SQMGDIQVFYFNEFESDIKMTSGGLVLEDGRIFEFIYRQGVLDYVEVSK"
FT   gene            207758..208081
FT                   /locus_tag="SAK_0243"
FT   CDS_pept        207758..208081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0243"
FT                   /product="thioredoxin family protein"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45873"
FT                   /protein_id="ABA45873.1"
FT                   /translation="MILPESYEEIAAYIDSTKKVVFFFTADWCPDCQFIYPVMPSIEKD
FT                   FSDFVFVRVNRDDYIELAQQWNIFGIPSFVVVENGQELGRLVNKNRKTKAEITKFLAEI
FT                   NYK"
FT   gene            208114..208740
FT                   /locus_tag="SAK_0244"
FT   CDS_pept        208114..208740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0244"
FT                   /product="tRNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF01588"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44988"
FT                   /protein_id="ABA44988.1"
FT                   /translation="MIFTYNREHVGDTLMVIVKDSQGAKLDVDRRGQVARVYLQDSKET
FT                   VAWNIFEVSSLIVIEGAGQITLSDQDIKILNAELLKEGFEDSLVNNIEPTFVVAQIKEM
FT                   IDHPDSDHLHICQAEINDGKTVQIVCGAPNASVGLKTVAALPGAMMPNGSLIFPGKLRG
FT                   EDSFGMLCSARELALPNAPQVRGIIELSDQVIVGESFDANKHWKN"
FT   gene            complement(208794..209510)
FT                   /locus_tag="SAK_0245"
FT   CDS_pept        complement(208794..209510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45738"
FT                   /protein_id="ABA45738.1"
FT                   /translation="MTNVTSYKEMLAKPWGKIQYEITFAQLSHIKNQNVLDFGAGFCLT
FT                   EQHLAKENNVTAIEPNPKLLYDNQSDNIYKILGSYEALRDLPDQSFDTIICHNVLEYID
FT                   KHNHPAYFDEFSRLLKPNGELSLIKHNITGKILQSVIFSNDTSTAMELLTGEANFKSAS
FT                   FDQGNIYTLEELKQNTNLLVERYQGIRTFYSLQPNHFKTETGWLNKMLAIELSVADKAP
FT                   YKDIAFLQHITLKKSL"
FT   gene            209591..209986
FT                   /gene="ssb2"
FT                   /locus_tag="SAK_0246"
FT   CDS_pept        209591..209986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb2"
FT                   /locus_tag="SAK_0246"
FT                   /product="single-strand binding protein 2"
FT                   /note="identified by similarity to SP:Q8E220; match to
FT                   protein family HMM PF00436; match to protein family HMM
FT                   TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44830"
FT                   /protein_id="ABA44830.1"
FT                   /translation="MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGERE
FT                   ADFINVVMWGRLAETLASYGTKGSLISIDGELRTRKYEKDGQTHYITEVLASSFQLLES
FT                   RAQRAMRENNVSGDLSDLVLEEEELPF"
FT   gene            210110..210754
FT                   /locus_tag="SAK_0247"
FT   CDS_pept        210110..210754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0247"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44391"
FT                   /protein_id="ABA44391.1"
FT                   /translation="MEKVIIFDMDGVIVDSEYTFLDNKTEMLREEGIDTDVSYQYQYMG
FT                   TTFEFMWQAMKEEFGLPKTVKEYIAEMNRRRQAIVARDGVRPIKGAQRLIHWLHQHGYR
FT                   LAVASSSPMVDIKRNLKELGVTECFEYMVTGEDVSSSKPAPDVFLRAAELLDVDPKVCI
FT                   VIEDTRNGSLAAKAAGMYCFGFANPDYPPQDLSMADKVISDYQDIYIYLPE"
FT   gene            210781..212526
FT                   /locus_tag="SAK_0248"
FT   CDS_pept        210781..212526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0248"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF01590;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF06580; match to protein family HMM PF07694"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45540"
FT                   /protein_id="ABA45540.1"
FT                   /translation="MLMVLLFQRLGIIMILAFLLVNNSYFRQLIEERSKRETVVLVIIF
FT                   GLFVIISNITGIEIKGDRSLVERPFLTTISHSDSLANTRTLVITTASLVGGPLVGSIVG
FT                   FIGGVHRFFQGSFSGSFYIVSSVLVGIVSGKIGDKLKENHLYPSTSQVILISIIAESIQ
FT                   MLFVGIFTGWELVKMIVIPMMILNSLGSTLFLAILKTYLSNESQLRAVQTRDVLELTRQ
FT                   TLPYLRQGLTPQSARSVCEIIKRHTNFDAVGLTDRSNVLAHIGVGHDHHIAGQPVKTDL
FT                   SKSVIFDGEPRIAQDKAAISCPDHNCQLNSAIVVPLKINDKTVGALKMYFAGDKTMSEV
FT                   EENLVLGLAQIFSGQLAMGITEEQNKLASMAEIKALQAQINPHFFFNAINTISALIRID
FT                   SDKARYALMQLSTFFRTSLQGGQDREVTLEQEKSHVDAYMNVEKLRFPDKYQLSYDISA
FT                   PEKMKLPPFGLQVLVENAVRHAFKERKTDNHILVQIKPDGHYYCVSVSDNGQGISDTII
FT                   DKLGQETVAESKGTGTALVNLNNRLNLLYGSVSCLHFSSDKNGTKVWYRIPNRIREDEH
FT                   ENFNS"
FT   gene            212507..213247
FT                   /locus_tag="SAK_0249"
FT   CDS_pept        212507..213247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0249"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46130"
FT                   /protein_id="ABA46130.1"
FT                   /translation="MKILILDDEMFARQELSFLVEHSQEVDNPEIFQAEDISEAEKILF
FT                   RQQIDLIFLDISLSEENGFTLANQLSQLAHPPLVVFATAYDNYAVKAFESNAVDYIMKP
FT                   FEQQRVDMALSKVKKLSQLTTASDVEQAIPKKASVELLTLTLSDRSVVVKMQDIVAASV
FT                   EDGELTVSTVQKTYTIRKTLNWFKSRAVAPYFLQIHRNTVINLEMIEEIQPWFNHTLLL
FT                   IMSNGEKFPVGRSYLKDLNEHLTM"
FT   gene            213417..213872
FT                   /locus_tag="SAK_0250"
FT   CDS_pept        213417..213872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0250"
FT                   /product="LrgA family protein"
FT                   /note="identified by match to protein family HMM PF03788"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45275"
FT                   /protein_id="ABA45275.1"
FT                   /translation="MKHTSKETKTKEAPMFIQMSIYAAILLVSQMISMLLPKSLPIPTT
FT                   VIGLVLMYVLLTAKIIKVEWVDSFGALMISMIGFMFVPSGISVAANLDILKAEGLQLVA
FT                   VITISTVVMLVVVAYVARLILAIRELSVTDLFKKILPNHYSKKVEEK"
FT   gene            213874..214602
FT                   /locus_tag="SAK_0251"
FT   CDS_pept        213874..214602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0251"
FT                   /product="lrgB-like family protien"
FT                   /note="identified by match to protein family HMM PF04172"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44835"
FT                   /protein_id="ABA44835.1"
FT                   /translation="MELLKTPIFGICFSLILYTIGQHLFKKSKGFFLLQPLFFAMVSGI
FT                   VILWLMSKGLGTDVKTFYTQAYKPGGDLIFWFLNPATIAFAVPLYKKNDVVKKYWVEIL
FT                   SSLVIGMIVSLILIVAISKMVGLSQVGIASMLPQAATTAIALPITAAIGGNTAVTAMAC
FT                   ILNAVIIYALGKKLVSFFHLNDSKIGAGLGLGTSGHTVGAAFALELGELQGAMAAIAVV
FT                   VIGLVVDLVIPIFSHLIGLL"
FT   gene            214845..216473
FT                   /locus_tag="SAK_0252"
FT   CDS_pept        214845..216473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0252"
FT                   /product="peptide/opine/nickel uptake (PepT) family ABC
FT                   transporter, substrate-binding protein"
FT                   /note="identified by similarity to SP:P42061; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44567"
FT                   /protein_id="ABA44567.1"
FT                   /translation="MTKYLKYISFVALFLASIFLVACQNQNSQTKERTRKQRPKDELVV
FT                   SMGAKLPHEFDPKDRYGIHNEGNITHSTLLKRSPELDIKGELAKKYKISKDGLTWSFDL
FT                   NDDFKFSNGEPVTADDVKFTYDMLKADGKAWDLTFIKNVEVVGKNQVNIHLTEAHSTFT
FT                   AQLTEIPIVPKKHYNDKYKSNPIGSGPYMVKEYKAGEQAIFVRNPYWHGKKPYFKKWTW
FT                   VLLDENTALAALESGDVDMIYATPELASKKVKGTRLLDIASNDVRGLSLPYVKKGVVKN
FT                   SPDGYPVGNDVTSDPAIRKALTIGLNRQKVLDTVLNGYGKPAYSIIDRTPFWNPKTAIK
FT                   DNKVAKAKQLLTKAGWKEQADGSRKKGNLKAEFDLYYPTNDQLRANLAVEVAEQAKALG
FT                   ITIKLKASNWDEMATKSHDSALLYAGGRHHAQQFYESHYPSLAGKGWTNITFYNNPTVT
FT                   KYLDKAMTSPDLDKANKYWKLAQWDGKTGASTLGDLPNVWLVSLNHTYIGDKRINVGKQ
FT                   GVHSHGHDWSLLTNIAEWTWDESAK"
FT   gene            216586..217563
FT                   /locus_tag="SAK_0253"
FT   CDS_pept        216586..217563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0253"
FT                   /product="peptide/opine/nickel uptake (PepT) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:P42062; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45434"
FT                   /protein_id="ABA45434.1"
FT                   /translation="MKHITTVVIWKILRCLSLVFGVSILTFILLKQSPVDPVMASVNYD
FT                   TSLTPVQYKAIAHHYGLDKPAPVQYFIWLKNFIQGHLGTSLVYRQPVIDIIRSRAGASF
FT                   ILMGLSWVLSGLIGFILGTLSAFHQGKLLDRIVRWFSYLQISVPTFWIGLIFLLIFSVQ
FT                   LGWFPIGISSPIGTLSQDITLADRIKHLILPVFTLSILGIANVTLHTRTKMMSVLSSEY
FT                   VLFARARGETEWQIFKNHCLRNAIVPAITLHFSYFGELFGGSVLAEQVFSYPGLGSTLT
FT                   EAGLKSDTPLLLAIVMIGTLFVFAGNLIADILNSIINPQLRRKV"
FT   gene            217560..218381
FT                   /locus_tag="SAK_0254"
FT   CDS_pept        217560..218381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0254"
FT                   /product="peptide/opine/nickel uptake (PepT) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:P26904; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45313"
FT                   /protein_id="ABA45313.1"
FT                   /translation="MILRRRTIVLWQLGIAISLILSILALNLYFHSTPLQTNAALRNLA
FT                   PSLNHLFGTDGLGRDMFVRTIKGLYFSLQVGLLGALMGVILATVFGVLAGLGNSIIDKI
FT                   IAWLVDLFIGMPHLIFMILISFVVGKGAQGVIIATAVTHWPSLARLIRNEVYHLKNKEF
FT                   VQLSKSMGKTPYYIVRHHILPLIASQIFIGFILLFPHVILHEASMTFLGFGLSAEQPSV
FT                   GIILSEAAKHISLGNWWLVIFPGLYLILVVNAFDTIGESLKKLFYPQTDHF"
FT   gene            218393..219196
FT                   /locus_tag="SAK_0255"
FT   CDS_pept        218393..219196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0255"
FT                   /product="peptide/opine/nickel uptake (PepT) family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46224"
FT                   /protein_id="ABA46224.1"
FT                   /translation="MTETLLSIKDLSITFTQYGRFLKPFQSTPIQALNLEIKKGELLAI
FT                   IGASGSGKSLLAHAIMDILPKNASVTGDMIYRGQSLNSKRIKQLRGKDITLIPQSVNYL
FT                   DPSTKVKHQVRLGISENSKATQEGLFQQFGLKESDGDLYPFQLSGGMLRRVLFTTCISD
FT                   KVSLIIADEPTPGLHPDALQMVLDQLRSFADKGISVIFITHDIVAASQIADRITIFKEG
FT                   KAIETAPASFFSGNGEQLQTEFARSLWRSLPQQEFLKGVTHDLRG"
FT   gene            219180..219806
FT                   /locus_tag="SAK_0256"
FT   CDS_pept        219180..219806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0256"
FT                   /product="peptide/opine/nickel uptake (PepT) family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44980"
FT                   /protein_id="ABA44980.1"
FT                   /translation="MTLEAKKLGFYHKKDQWLFKEINLEVAPGQVLGIFGQSGCGKTSL
FT                   SRVLAGFLHPKSGEVLVDGSNLPSKAFRPVQLIQQHPEKTMNPLWPMKKSLEEAYYPSR
FT                   DLLDAFGIQEKWLNRRPSELSGGELQRFSIVRSLHPETKYLIADEMTTMLDSITQASVW
FT                   KSLLEIVKDRNLGLIVISHDFAMLEKLCNQCYMIEENRIVSFNGD"
FT   gene            220089..222119
FT                   /locus_tag="SAK_0257"
FT   CDS_pept        220089..222119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0257"
FT                   /product="PTS system, trehalose-specific IIBCA component"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00826;
FT                   match to protein family HMM TIGR00830; match to protein
FT                   family HMM TIGR01992"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45896"
FT                   /protein_id="ABA45896.1"
FT                   /translation="MEQFKHDAKALLEAIGGKENISAVTHCATRMRFVLNDSSKAKVKV
FT                   IEELPSVKGTFTNAGQFQVIIGNDVPIFYNAFVAVSGIEGVSKEAAKSAAQKNQNPLQR
FT                   VLTMLAEIFTPIIPAIIVGGLILGFRNILDAVPFEFLGQKVVDGVRQVDSSGHPIWNTL
FT                   VDVSTFWSGVDSFLWLPGEAIFHFLPVGIVWSVTRKMGTTQILGIVLGICLVSPQLLNA
FT                   YSVASTSAADIAKNWSWNFGYFTVQKIGYQAQVIPALLAGLSLSYLEIFWRKHIPEVVS
FT                   MIFVPFLSLVPAIILAHTVLGPIGWTLGKWISAIVLIGLTGPVKWLFGAIFGALYAPFV
FT                   ITGLHHMTNAIDTQLIADTKTHTTGLWPMIALSNIAQGSAVLAYYFMHRHDEKEAQISL
FT                   PAAISAYLGVTEPAIFGVNVKYIYPFVAGMIGSSVAGLLATTFNVQANSIGVGGLPGFL
FT                   SINVKYMGYFFICMAVAIFIPLFLTLFFKKSGILTKTEEEKLVPDAVIASTTETKSAKE
FT                   KAVVSGTKLSVVSPLSGLAKPLDQASDPVFSQGIMGKGVVIDPSDGELVSPVDATVSVL
FT                   FPTKHAIGLLTSEGVEFLIHIGMDTVNLEGKGFTSHVAQGDTVKVGDKLITFDIPMIKE
FT                   EGYIVETPILITNQQEFRPEELIDLPKQIKRGQALMVAKKI"
FT   gene            222341..223966
FT                   /locus_tag="SAK_0258"
FT   CDS_pept        222341..223966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0258"
FT                   /product="alpha amylase family protein"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02403"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45066"
FT                   /protein_id="ABA45066.1"
FT                   /translation="MTIDKRKVVYQIYPKSYKDTTGNGVGDLRGIIEKLPYLAELGIDM
FT                   VWLNPFYPSPQRDNGYDISDYTAINPDFGTMDDFEEMIEVGRQYRIDFMLDMVLNHCSI
FT                   EHEWFKKALAGDRYYQDFFILRDNPTDWVSKFGGNAWTPFGDTGKYYLHLFDITQADLN
FT                   WRNADVRKELFKVVNFWRDKGVKGFRFDVINLIGKDEILENCPINDGKPAYTDRPITHD
FT                   YLKMLNNASFGQDDSFMTVGEMSSTTIANCILYTAPEREELSMAFNFHHLKVDYKDGQK
FT                   WTIMAFDFPALRDLFHSWGEGMSEGNGWNALFYNNHDQPRALNRFVDVKRFRNEGATML
FT                   AASIHLSRGTPYIYMGEEIGMLDPDYSSMDDYVDIESLNAYQIMLDEGKSQEEAFSIIR
FT                   AKSRDNSRVPMQWDDSTNAGFSEGAPWLKVGKSYKEINVAKEKTGLIFTFYQELIRLRK
FT                   QLPIIADGNYKAAFKDNEKVYAFERHLDKEKLLVLNNFFAEKVKIKLPENYLQGQVLLS
FT                   NYKDVTLDETVTLQPYQTLAILVS"
FT   gene            224182..226218
FT                   /locus_tag="SAK_0259"
FT   CDS_pept        224182..226218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0259"
FT                   /product="PRD domain/PTS system IIA domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44981"
FT                   /protein_id="ABA44981.1"
FT                   /translation="MVDNKTVVIMLVFLARKNLSLYELTVQTKFSIKVIIEQINYLNSF
FT                   LAKNHLPAIAHSAGRYQLLGDEKEHDKIVSLLEAEQFYLTQEERVCLIYLYSFCRREFV
FT                   SNVHYQDFLKVSKNTTLSDIKMLRSKLAKRGISLTYTRAKGYSLVGDEMDKHQVAFQMI
FT                   TQLLESPIGFWSLNYILSSWKFALSYEKLEKTVEYFYESFQLSPIQDRLEKSLYFIILI
FT                   LCRYQRSVDRVLQGSPIVSEQLKELTTIIVTNLSQDISLSKPLDQKEKDYITLILSGCF
FT                   EGEGTKDDDFFEALAKAIVDEMETVSLLNFSNKEELLQGLKRHIIPAYFRLKYGLTGDS
FT                   GYTQNIKEHYSDLFLLVKKALRPLEEQVGLIPDSEISYFVIHFGGYLRQSGGTQSMSYK
FT                   ALILCPNGVSSSLVIKEKLRGLFPQIHFHRVSKIEQLKLIDNQTYDMVFSTIFVETKKP
FT                   NYLVSLMMTAEQVQQLKELVISDFPKACLDDFQLDQLIATIKKYAHVHCEEELKLALRT
FT                   MVKQDILRKDVRPLLHQLITEETYQTSSEQMNWKEAIRLAAKPLLASGKITESYPEAMI
FT                   EKVEEFGPFINLGKGIAIPHARPEDGVNSVGMSMLVLEQPIYLLDDPKQEIYLLLCIAA
FT                   IDNETHLKALSHLTTILRDNNNVKALLASRRYQDIEMIIKQED"
FT   gene            226221..226505
FT                   /locus_tag="SAK_0260"
FT   CDS_pept        226221..226505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0260"
FT                   /product="PTS system, IIB component, lactose/cellobiose
FT                   family"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45930"
FT                   /protein_id="ABA45930.1"
FT                   /translation="MLRIGTACGSGLGSSFMVQMNIESILKDLGVSDVEVEHYDLGGAD
FT                   PSAADVWIVGRDLEDSAGHLGDVRILNSIIDMDELRELVTGICQEKGLI"
FT   gene            226518..227873
FT                   /locus_tag="SAK_0261"
FT   CDS_pept        226518..227873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0261"
FT                   /product="PTS system, sugar-specific IIC component,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45250"
FT                   /protein_id="ABA45250.1"
FT                   /translation="MKGLLDFLVNIASTPAILVALIAIIGLVLQKKGVPDIVKGGIKTF
FT                   VGFLVVSGGTGIVQNSLNPFGKMFEHAFHLVGVVPNNEAIVAVALTKYGSATALIMLAG
FT                   MIFNILIARFTKFKYIFLTGHHTLYMACMIAVIFAVAGFTSFSLILFGGLALGIIMSVS
FT                   PAFVQKYMIQLTGNDKVALGHFGSLGYWLSGFIGGIVGDKSKSTEDIKFPKSLSFLRDS
FT                   TVSITISMAIIYLIVAVFAGEAYIAKEISNGVNGLVYALQLAGQFAAGVFVILAGVRLI
FT                   LGEIVPAFKGISEKLVPNSKPALDCPIVYPYAPNAVLIGFISSFVGGLVSMIVMIVTGT
FT                   TVILPGVVPHFFCGATAGVIGNASGGVRGATIGAFVQGILISFLPIFLMPVLGGLGFKG
FT                   STFSDADFGLTGIILGALNHVGGAIAIVIGIVVILIGLFGISFVGKSTHKEG"
FT   gene            227876..228733
FT                   /locus_tag="SAK_0262"
FT   CDS_pept        227876..228733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0262"
FT                   /product="transketolase, N-terminal subunit, putative"
FT                   /note="identified by similarity to SP:Q58094; match to
FT                   protein family HMM PF00456"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45231"
FT                   /protein_id="ABA45231.1"
FT                   /translation="MTSPEERYSSLRRFATEIRLNTLETLNHLGFGHYGGSLSIVEALA
FT                   VLYGDIMDINPEKFKESDRDYMVLSKGHAGPALYSTLYLKGFFDKTFLHSLNTNGTKLP
FT                   SHPDRNLTPGIDVTTGSLGQGISIATGIAYAQKIENSSYYTYTIVGDGELNEGQCWEAI
FT                   QFAAHHQLHHLIVFVDDNKKQLDGLTADICNPGDFVAKFEAFGFDAVRVKGDDIEAIDK
FT                   AIKTFQDSNSVRPKCIVLDSIKGQGVKELEELASNHHLRPDLQQKTMLERALISLRESL
FT                   EVVE"
FT   gene            228730..229659
FT                   /locus_tag="SAK_0263"
FT   CDS_pept        228730..229659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0263"
FT                   /product="transketolase, C-terminal subunit, putative"
FT                   /note="identified by similarity to SP:Q58092; match to
FT                   protein family HMM PF02779; match to protein family HMM
FT                   PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44468"
FT                   /protein_id="ABA44468.1"
FT                   /translation="MRCSTKEMRLVYRDFLLQANQENKQITVLEADLSSSMSTNALASE
FT                   FGKRYINLGIMEAEMVGLAAGLAIKGYKPYLHTFGPFASRRVFDQVFLSLGYSQLSATI
FT                   IGSDAGISAEMNGGTHMPFEELGLLRLIPKATIFEVSDDIQFEAILKQTLSIDGLKYIR
FT                   TIRKAPTAVYEGREDFSKGFIQLRQGKDITLVASGIMVSRAIEAADYLKELGIEASVID
FT                   LFKIKPLPEELKPLLIDQSIVTIENHNRIGGIGSALCEWLSMEKDTTVSRMGIDERFGQ
FT                   VGQMEYLLEEYGLAVKDIVQHCKSIYKS"
FT   gene            229768..231027
FT                   /locus_tag="SAK_0264"
FT   CDS_pept        229768..231027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0264"
FT                   /product="oxidoreductase, NAD-binding"
FT                   /note="identified by match to protein family HMM PF00175"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45588"
FT                   /protein_id="ABA45588.1"
FT                   /translation="MRAWKGIVLILSSIVVTLVAWQNAGLSEFVVPGLALTSLSLTFLL
FT                   STKFRILESYFQGIENMYFYHKVMAVFSMILLLLHKIGLGQGGHGSEFAKTIGSAGLYL
FT                   FLSIVFVAYFGNFLKYEIWRFIHRFVYLAYILGLVHTFMILGDRILGNTLLSLIVLGYA
FT                   VIGVISGFYIIFLYSRMRFRRVGYVQKVTHLNHDTTEIEIAMKRPYRYDYGQFTFLKIY
FT                   QAGFESAAHPFSISGGHDRVIFLTVKASGDYTKSIYKQLKVGTKIALDRAYGHMLFDKD
FT                   KKEQVWIAGGIGITPFISFIRENSILTKRVDFFYTFSNQDNLIYQDMLESYAKANPNFK
FT                   LHLNNSSLKGRLDFSQSVFEGQPTIFMCGPTSMTSTYAKVFRQKDAKSRLVYEGFSFRD
FT                   SWLSIFLLKTFDKVYSNLIK"
FT   gene            231115..231384
FT                   /gene="rpsO"
FT                   /locus_tag="SAK_0265"
FT   CDS_pept        231115..231384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="SAK_0265"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by similarity to SP:P21473; match to
FT                   protein family HMM PF00312; match to protein family HMM
FT                   TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44702"
FT                   /db_xref="GOA:Q3K3H0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3H0"
FT                   /protein_id="ABA44702.1"
FT                   /translation="MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQ
FT                   HKKDHATYRGLMKKIGHRRNLLAYLRRTDVNRYRELIQSLGLRR"
FT   gene            231765..233894
FT                   /gene="pnp"
FT                   /locus_tag="SAK_0266"
FT   CDS_pept        231765..233894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="SAK_0266"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by similarity to SP:P50849; match to
FT                   protein family HMM PF00013; match to protein family HMM
FT                   PF00575; match to protein family HMM PF01138; match to
FT                   protein family HMM PF03725; match to protein family HMM
FT                   PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45814"
FT                   /db_xref="GOA:Q3K3G9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3G9"
FT                   /protein_id="ABA45814.1"
FT                   /translation="MSKQVFEMIFAGKKLVVETGQVAKQANGSVVVRYGDSTVLTAAVM
FT                   SKKMSTGDFFPLQVNYEEKMYAAGKFPGGFNKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEVQVINTVLSFDENASAPMAAMFGSSLALSISDIPFNGPIAGVQVAYVDGNFIINP
FT                   TAQEQEASALELTVAGTKEAINMVESGAKELSEEIMLEALLKGHEAVCELIAFQEEIVT
FT                   AIGKEKAEVELLQVDPELQAEIIATHNIALQAAVQVEEKKAREAATEAVKEVVIGEYEA
FT                   RYAEHEEYDRIMRDVAEILEQMEHAEVRRLITEDKIRPDGRRVDEIRPLDAEIDFLPQV
FT                   HGSGLFTRGQTQALSVLTLAPMGEAQIIDGLTPEYKKRFMHHYNFPQYSVGETGRYGAA
FT                   GRREIGHGALGERALEQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGTNYTVLTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIEGI
FT                   TPQILEEALAQAKKARFEILDVLHGAIAEPRPQLAPTAPKIDMIKIDVDKIKVVIGKGG
FT                   ETIDKIIAETGVKIDIDEEGNVSIFSSDQAAIDRTKDIIASLVREAKVGEVYHAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEIAWTRTANVADVLEIGEEVDVKVIKIDDKGRVDASMKA
FT                   LLPRPPKADNPKKES"
FT   gene            233896..234648
FT                   /locus_tag="SAK_0267"
FT   CDS_pept        233896..234648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F86856"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44925"
FT                   /protein_id="ABA44925.1"
FT                   /translation="MTSTNELDIRLRAFINAPDNFLDSIGLVNALHHSTVWASKEPYAI
FT                   QVDGQEVVPVFTDITDLNHFKEEQESARDMFWESRRSLDVLDEAISHGLAGLVYNLKKE
FT                   GDFGNSTIFYCEDMVQFMNNYTTILNQLLNEDNIVADIMDKTYLVPAFVHPREEGSFDR
FT                   LFPTMSTPEGKSYVPVFSNLLSFEKWYNHNDFGGAFRKAQGVILAWTIDDIYKPRNGEN
FT                   EIDDTFGVAINPFDEQQVLVDWSDVEND"
FT   gene            234657..235241
FT                   /gene="cysE"
FT                   /locus_tag="SAK_0268"
FT   CDS_pept        234657..235241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SAK_0268"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46091"
FT                   /protein_id="ABA46091.1"
FT                   /translation="MGWWKESIAIVKEQDPAARSSLEVILTYPGIKALAAHRLSHFLWN
FT                   HNFKLLARMHSQFWRFWTQIEIHPGATISEGVFIDHGSGLVIGETAIVEKGAMLYHGVT
FT                   LGGTGKDKGKRHPTIRKGALISAHSQIIGPIEVGENAKVGAAAVVLADVPADVTVVGVP
FT                   AKVVRVHGQKDDLQIRSIEHDREESYYSSKL"
FT   gene            235251..235433
FT                   /locus_tag="SAK_0269"
FT   CDS_pept        235251..235433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0269"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44964"
FT                   /protein_id="ABA44964.1"
FT                   /translation="MKDYVTTQILSILGILAAACLSYLKFAQGNPLLGIIWAAFVLMYV
FT                   VRLYKAYQKQKKEKP"
FT   gene            235430..236773
FT                   /gene="cysS"
FT                   /locus_tag="SAK_0270"
FT   CDS_pept        235430..236773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SAK_0270"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by similarity to SP:Q06752; match to
FT                   protein family HMM PF01406; match to protein family HMM
FT                   TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45206"
FT                   /db_xref="GOA:Q3K3G5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3G5"
FT                   /protein_id="ABA45206.1"
FT                   /translation="MIKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVV
FT                   AFDTIRRYFEYCGYQVNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALG
FT                   VKPATKNPRVIDYMDEIIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLE
FT                   IGASGRVDGEGEIKENPLDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEIFGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHD
FT                   MLKSVDGQVIRFFLATQQYRKPVNFTEKAVHDAEVNLKYLKNTFNLPIQENANDEELEQ
FT                   FVKAFQGAMDDDFNTANGITVIFEMAKWINSGHYTSRVKETFAELLEIFGIVFQEEVLD
FT                   ADIESLIEQRQEARANRDFATADRIRDELAKQGIKLLDTKDGVRWTRD"
FT   gene            236766..237152
FT                   /locus_tag="SAK_0271"
FT   CDS_pept        236766..237152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05948"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46108"
FT                   /protein_id="ABA46108.1"
FT                   /translation="MIDVRLINGIALAFEGDAVYSLYIRRHLIMQGFTKPNQLHRKATQ
FT                   YVSANAQALLINAMLEENILTDEEQLIYKRGRNANSHTKAKNADIITYRMSTGFEALMG
FT                   YLDMTGQIKRLETLIQWCIETIEK"
FT   gene            237255..238010
FT                   /locus_tag="SAK_0272"
FT   CDS_pept        237255..238010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0272"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44909"
FT                   /protein_id="ABA44909.1"
FT                   /translation="MTMKDKQFKEESSDLVYGLHAVTESLRANTGNKLYLQDDLRGKNV
FT                   DKVKALATEKKVSISWTPKKTLSDMTNGGVHQGFVLKVSEFAYADLSEIMTKAENEENP
FT                   LILILDGLTDPHNLGSILRTADATNVTGIIIPKHRSVGVTPVVSKTSTGAVEHVPIARV
FT                   TNLSQTLDTLKDKEFWIFGTDMNGTPSHKWNTKGKLALVIGNEGKGISHNIKKQVDEMI
FT                   TIPMNGHVQSLNASVAAAILMYEVFRNRL"
FT   gene            238007..238525
FT                   /locus_tag="SAK_0273"
FT   CDS_pept        238007..238525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45808"
FT                   /protein_id="ABA45808.1"
FT                   /translation="MKKHSILLVDGYNMIAFWKDTRQLFKSNRLEEAREVLLRKLNHYA
FT                   HFEHIDIICVFDAQYVPGVRQRYDQYKISVIFTEEDETADSYIERAAAELNQSVLNLVS
FT                   VATSDLNEQWTIFSQGALRVSARELEQRVATVKSDLDKMSSQIDLSTPKLRPWNDEQLG
FT                   KLKDFLDGM"
FT   gene            238618..239478
FT                   /locus_tag="SAK_0274"
FT   CDS_pept        238618..239478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0274"
FT                   /product="DegV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45706"
FT                   /protein_id="ABA45706.1"
FT                   /translation="MTFKILTDSTSDLDEKWAQEHNVDIIGLTIELDGKTYETVGDEKI
FT                   TSDFLLERMQEGAKPTTSQINVGQFEEVFSTYAENDHALLYLALSSHLSGTYQSATIAR
FT                   EMVLDKYPDAQIEIVDTMAASCGEGVLAMLATKERQEGKSLEEVKQKIESLLPKLNTYF
FT                   LVDDLNHLMRSGRLSKGAAIIGSVAKIKPLLKLDSEGKLVPFAKTRGRKKGIKEIVTQA
FT                   TKTLSYSTLIIAYSGEKDSAQVMKEQLLADERIEEVIIRPLGPVISAHVGSGALALFSL
FT                   GEENR"
FT   gene            239823..239942
FT                   /locus_tag="SAK_0275"
FT   CDS_pept        239823..239942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44853"
FT                   /protein_id="ABA44853.1"
FT                   /translation="MENVFVAGAFALIGITILLMLLLGRLILLLIFQGEMMQF"
FT   gene            240359..240805
FT                   /gene="rplM"
FT                   /locus_tag="SAK_0276"
FT   CDS_pept        240359..240805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SAK_0276"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by similarity to SP:Q00990; match to
FT                   protein family HMM PF00572; match to protein family HMM
FT                   TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45376"
FT                   /protein_id="ABA45376.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDAADVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKASDKIYYTHSMYPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQPEVLDISGLI"
FT   gene            240826..241218
FT                   /gene="rpsI"
FT                   /locus_tag="SAK_0277"
FT   CDS_pept        240826..241218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SAK_0277"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by similarity to SP:P21470; match to
FT                   protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44527"
FT                   /db_xref="GOA:Q3K3F8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3F8"
FT                   /protein_id="ABA44527.1"
FT                   /translation="MAQAQYAGTGRRKNAVARVRLVPGTGKITINKKDVEEYIPHADLR
FT                   LVINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDFRDSLKRAGLL
FT                   TRDARMVERKKPGLKKARKASQFSKR"
FT   gene            complement(241346..242500)
FT                   /locus_tag="SAK_0278"
FT   CDS_pept        complement(241346..242500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0278"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44681"
FT                   /protein_id="ABA44681.1"
FT                   /translation="MSIHKYPSKKAKNGYLYLVKVYMTRDGQRADHIKRGFRTRKEAKD
FT                   YEARLIYLKASGKLEEFIKPTHKTYNEIFEKWYQAYQDTVEPTTASRTLDMFRLHILPV
FT                   MGDLPISKISPLDCQNFIIEKAKVFKNIKQIKSYTGKVFDFAIKMKLLKHNPMTEIIMP
FT                   KRKKTRIENYWTVQELQEFLAIVLQEEPYKHYALFRLLAYSGLRKGELYALKWADIDFQ
FT                   SETLSVNKSLGRLDGQAIEKGTKNDFSVRRIKLDSETISILQEWKANCQKEKAQLAVAP
FT                   LSIEQDFIFTYCTRSGSIEPLHADYINNVLSRIIRKHGLRKISPHGFRHTHATLMIEIG
FT                   VDPVNTAKRLGHASSQMTLDTYSHSTTNGEDKSIKQFADYLKAK"
FT   gene            complement(242569..243120)
FT                   /locus_tag="SAK_0279"
FT   CDS_pept        complement(242569..243120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0279"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44673"
FT                   /protein_id="ABA44673.1"
FT                   /translation="MNTRIPYLVALSGKTLKQISEETGIAYPTLTSYNQGVRNPKKNNA
FT                   VILAKYFGVSVGYLLGDEKEPNLINPGDESLIKGLFRVAQGKTNLDKVTEWTPFKDDVS
FT                   FVKTMLLSTPTLERKIDEIFEGIEPNIIQALKQRIKEVAEEFPYTINHSGDEKSDYHFV
FT                   WQAWEESDEYKKRMAEKHKK"
FT   gene            243285..243578
FT                   /locus_tag="SAK_0280"
FT   CDS_pept        243285..243578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45110"
FT                   /protein_id="ABA45110.1"
FT                   /translation="MAYTLEERETIVRYDEMDKCWYFESNVRRHVTKILKMEHAFDEIE
FT                   KELENDFCIYVRAKLSDLNNFSVNPFVKNKRKLSDEQRLELSRLAKKRFSSD"
FT   gene            243719..244000
FT                   /locus_tag="SAK_0281"
FT   CDS_pept        243719..244000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO82898.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44784"
FT                   /protein_id="ABA44784.1"
FT                   /translation="MTEGFTIQLPKVTEKKLLARYDDMLQKAIEKALEDKELYKPIVRM
FT                   AGLCRWLDVSTTTVVKWQKQGGMPHMVIDGVTLYDKHKVAQWLQQFER"
FT   gene            244006..244332
FT                   /locus_tag="SAK_0282"
FT   CDS_pept        244006..244332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0282"
FT                   /product="replication initiation factor, RepA family"
FT                   /note="identified by match to protein family HMM PF06970"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45411"
FT                   /protein_id="ABA45411.1"
FT                   /translation="MDYDNENYLIPKILLQDDFYSSLSAKDILVYAVLKDRQIEALEKG
FT                   WIDTDGSIYLNFKLIELAKMFSCSRTTMIDVMQRLEEVNLIERERVDVFYGYSLPYKTY
FT                   INEV"
FT   gene            244336..244977
FT                   /locus_tag="SAK_0283"
FT   CDS_pept        244336..244977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0283"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:F98022"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46269"
FT                   /protein_id="ABA46269.1"
FT                   /translation="MIKIYFGKDAALNQAIQSRLDSYQIDYQAFSSKDIDAKTLMEWLF
FT                   KSTDIFELLSTKMLKYKLNTQITLSQFVRKILKDVNSTLKLPIVVTDEVIYSNMSPDYV
FT                   TVLLPKEYRKIKRIQLMRKMEQLDEGRLFWKNFELFRKQSELRWFELNELLFADVSDDL
FT                   GEIKKAKDRFFSYKKNNQVPPNEIIERILKIFLVDREDFFKKSPSDLQNF"
FT   gene            245277..246152
FT                   /locus_tag="SAK_0284"
FT   CDS_pept        245277..246152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0284"
FT                   /product="replication initiation factor family protein"
FT                   /note="identified by match to protein family HMM PF02486"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45702"
FT                   /protein_id="ABA45702.1"
FT                   /translation="MELKVSLDNITITAYIKSYKLLGLKRLVEGHTAIIIQTAMTDMFR
FT                   AYTKDGGQVVLHMEYDKIKGQAFNARPFRLEFNPNKLRSVDTEIIDTIIPYLEDISISR
FT                   ADLAFDLFEVDCSEFVLEKKGRPTATKEFRSDTGKLETKYLGASRSEKQVRLYNKKKEQ
FT                   LENGTDKEKEFASQFKHWWRLEFQLRSRSVEEIFEVINTVVFKPFKFEGLPVETQIYLV
FT                   ALTRDKNLWKQLHRNTRAKYKKILETYQTSDIDYLGLLKDLLKHERLRLENQLAYYGGR
FT                   IDKNSFQPFC"
FT   gene            246188..246622
FT                   /locus_tag="SAK_0285"
FT   CDS_pept        246188..246622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46323"
FT                   /protein_id="ABA46323.1"
FT                   /translation="MRIKDYADSLGVSSQSIYKRIRSPKYKERLKGHLYRDNQKVENLD
FT                   LIGIKILEDYHFENDVIELEKTLGDIQEEFEQEKKGMQYRIDRLADKLTPLLEDNQNLV
FT                   QKNYELLNYVRSLERQKLLLIIALAVMVITLLVAIWLAIF"
FT   gene            246939..248195
FT                   /gene="pre"
FT                   /locus_tag="SAK_0286"
FT   CDS_pept        246939..248195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pre"
FT                   /locus_tag="SAK_0286"
FT                   /product="plasmid recombination enzyme"
FT                   /note="identified by similarity to SP:P13925; match to
FT                   protein family HMM PF01076"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44955"
FT                   /protein_id="ABA44955.1"
FT                   /translation="MSYVVARMAKYKSGQLTAIYNHNERIFKNHSNKEIDVEKSHLNYE
FT                   LTNRDQAQNYHKQIKEHINENRLSTRGVRKDAILCNEWIITSDKTFFNSLDEKQTREFF
FT                   DTAKDYFAEKYGDANIAYARVHLDESTPHMHLGIVPMKNGKLSSKALFGNKEKLVAIQD
FT                   ELPKYLNEHGFNLQRGEIGSKKKHLETAEFKEKQRLLDNADRKLADKHEELKALDDKIS
FT                   NVNDTIADKESRLKELEAKEWDAVGDLKQYELEKQSLAESIEDIKDIELLQLDRIQKED
FT                   LVKQSFDGKLKMDKETYNRLFQTASKHASSNAELKRDLVKAQSQNNHLSRELLNHRKTA
FT                   EKNIKLSQENRKLKDKVKMLDEQVKILNKSLSVWKEKAKEFMPKQVYRETLSIINTLNP
FT                   IGLAKTAIRQVKKMVDSNS"
FT   gene            248363..248833
FT                   /locus_tag="SAK_0287"
FT   CDS_pept        248363..248833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46067"
FT                   /protein_id="ABA46067.1"
FT                   /translation="MTDKKIVYYFDHDLSKKDMGGVGPTYTGKNLLFLLWWTYSYVAED
FT                   NLDIDTSLFEVPEFNDFYNNGLELYRIKNELANYNIRFGYEVNPKDSTKMLIGILPTDE
FT                   EDYVKGYRNFIADISNPDTRYAIYHRLIKTMDTMLPIEQINVYKSLAKGNKK"
FT   gene            complement(249138..249473)
FT                   /locus_tag="SAK_0288"
FT   CDS_pept        complement(249138..249473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0288"
FT                   /product="RelE/ParE family protein"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44651"
FT                   /protein_id="ABA44651.1"
FT                   /translation="MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDI
FT                   EKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKDYIVLYHIEEEENSVVIDYLLPTRS
FT                   DYMKLFK"
FT   gene            complement(249463..249750)
FT                   /locus_tag="SAK_0289"
FT   CDS_pept        complement(249463..249750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34628.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44699"
FT                   /protein_id="ABA44699.1"
FT                   /translation="MVTVEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVV
FT                   VTNEVDLLTEEELEKEKLFKQFQAEISKNIEDVRQGKFYTSEEVRAELGL"
FT   gene            250257..250547
FT                   /locus_tag="SAK_0290"
FT   CDS_pept        250257..250547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06013"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44419"
FT                   /protein_id="ABA44419.1"
FT                   /translation="MSQIKLTPEELRISAQKYTTGSQSITDVLTVLTQEQAVIDENWDG
FT                   TAFDSFEAQFNELSPKITQFAQLLEDINQQLLKVADVVEQTDSDIASQINK"
FT   gene            250649..251056
FT                   /locus_tag="SAK_0291"
FT   CDS_pept        250649..251056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45100"
FT                   /protein_id="ABA45100.1"
FT                   /translation="MKKSTQIILLIVALFILVFSGGFYMKEQQRKEELKRNREYEVSLV
FT                   KALKNSYENIEEIKITHPVSTEIPGDWHCTVKISFNDKKSIVYNITHNLESKKNYSGKF
FT                   NEKNMNFFDSRIGKTKKTIKIIFSDGQEKIQ"
FT   gene            251056..251616
FT                   /locus_tag="SAK_0292"
FT   CDS_pept        251056..251616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45600"
FT                   /protein_id="ABA45600.1"
FT                   /translation="MVFTYTEKELREFNIGDNVYSVNPDYAEKNHSTVITDLPQKDNET
FT                   NIITTEDRKKFKVLKTSPDDMSGYQGMAVAPIIKGKVDYNSVAVISAATDSSNYKDLIG
FT                   AVSSAQPHQSSTQLKSADKFLKDVQSHDKWTVTQLSGYSQSAYMLKLGAQYHIPTTVFN
FT                   GWFRYSTLNEDEKNSWLSILNIL"
FT   gene            251589..252269
FT                   /locus_tag="SAK_0293"
FT   CDS_pept        251589..252269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0293"
FT                   /product="conserved hypothetical protein, truncation"
FT                   /note="identified by similarity to PIR:AC1425"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44994"
FT                   /protein_id="ABA44994.1"
FT                   /translation="MAKHPEYFVNFRHKEDNVTWWNDFNKLDDKDYGTVKWVNGKSHKI
FT                   ESWKFTDDGKLKDEKGNIVNPKSPAVQSVLYEEVHFQKAKAKLKKSGGKLSHSEKVYLD
FT                   SEQAIFIANGLTTASQTASDDIKKNAELVKEKASELFAKTKVMPPGITDLSPEELADTY
FT                   SEGGVREDTIVTPIETFFDEKVTNAQEITTSYINLQKQIESGVQKLLEEDSKLAGEFKE
FT                   WSQY"
FT   gene            252254..252640
FT                   /locus_tag="SAK_0294"
FT   CDS_pept        252254..252640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46164"
FT                   /protein_id="ABA46164.1"
FT                   /translation="MVTVLDQNENKINSLKINLGKLEDNYHRENMEIEDKLYSLEDKKN
FT                   ELETYLQEVYEETSHLLRQNDSDGSTFMSLNRIIESYQMELIDEYENYKQTIIVQEENS
FT                   RTQFLKDRVKLENDISSLEGRKYY"
FT   gene            252674..252955
FT                   /locus_tag="SAK_0295"
FT   CDS_pept        252674..252955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45993"
FT                   /protein_id="ABA45993.1"
FT                   /translation="MSLIGAVLKGTKEDKEFKKQIQRALVRIVYAPEIVEEADSIKMTY
FT                   SDKIDNVSETAKSSIKTIANQIDSGLVGQFGEKVKAQVDLNKGSYDDL"
FT   gene            253046..253144
FT                   /locus_tag="SAK_0296"
FT   CDS_pept        253046..253144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45101"
FT                   /protein_id="ABA45101.1"
FT                   /translation="MKDNKVYYLHFGKAIDKNEAKNDKYLNQIINN"
FT   gene            253572..253676
FT                   /locus_tag="SAK_0297"
FT   CDS_pept        253572..253676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44671"
FT                   /protein_id="ABA44671.1"
FT                   /translation="MEEFCMVSTQYMKVTLREKFPDKLTYVDLEELVI"
FT   gene            253798..254658
FT                   /locus_tag="SAK_0298"
FT   CDS_pept        253798..254658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0298"
FT                   /product="transcriptional activator, Rgg/GadR/MutR family"
FT                   /note="identified by match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45530"
FT                   /protein_id="ABA45530.1"
FT                   /translation="MFKYVPIFREFRLNRQFSLKQVASNELSVSQLSRFERGESDLSLT
FT                   KFLGALEAIDLSISEFMDRVNKYQKSDQISLMSQMAQYHYQRDVAGLEKMISVEEGKLK
FT                   KDSSDIRCRLNIVLFRGMICECDSSRKMSEEDLCFLSDYLFQKDSWEISDYILIGNLYR
FT                   YYNTRHICQLVKEVINQKEYYRDIYTNRNVVEATLLNVVETLIERRALEEATFFLEKVE
FT                   ALLNNERNAYHRIILLYEKGFLAYAKGDSRGIQSMKQAIFCFQAIGSKHHVENFQEHFN
FT                   RVTRL"
FT   gene            254731..255912
FT                   /locus_tag="SAK_0299"
FT   CDS_pept        254731..255912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0299"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44783"
FT                   /protein_id="ABA44783.1"
FT                   /translation="MNINGIKLLSSRAVSKLGDVFYDYGNSTWIASMGGLGQKILGIYQ
FT                   IVELLVSIVLNPFGGALADRFQRRKILLITDAICAIMCFLLSFIGDDKVMVYGLIVANA
FT                   ILAVSNAFSSPAYKSYIPEIVDKADIITYNANLETIVQIISVSSPVLGFLIFNNFGIRI
FT                   TLIVDAITFLISFLFLYAIKVERVQLSKQEKVAIKNILADIADGFTYIKKEKEIMFFLI
FT                   IAALLNTFLAMFNYLLPFTNSLLKTSGAYATILSISAIGSIIGALIARKIKSSINSMLS
FT                   MLVFSSLGVIVMGFPSLFELPIWIPYSGSFLFNSLLTMFNIHFFSQVQIRVDEAYMGRV
FT                   MSTIFTIAIMFMPIGTLFMTIFSFALSNVSFIVIGCAIAILGGLGFSYSKKQF"
FT   gene            complement(255974..256624)
FT                   /locus_tag="SAK_0300"
FT   CDS_pept        complement(255974..256624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0300"
FT                   /product="quaternary amine uptake (QAT) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:O34742; similarity to
FT                   SP:P39775; match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45074"
FT                   /protein_id="ABA45074.1"
FT                   /translation="MKQMNTFQQFIYYFQHNGSYILEQFIHHFLISVYGVILAAIVGIP
FT                   LGIFIARRGKIKTFVMGIANVIQTIPSLAMISIIMLGLGLGIKTVVATVFLYSLLPIIT
FT                   NTYTGIRNVDSDLLDAAKGMGMTKRQRLFMVELPLSISVIMAGLRNALVVAIGITAIGA
FT                   FVGGGGLGDIIIRGTNATNGGAIILAGSLPTALMAIFSDLILGGIQRMLEPRK"
FT   gene            complement(256625..257551)
FT                   /locus_tag="SAK_0301"
FT   CDS_pept        complement(256625..257551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0301"
FT                   /product="quaternary amine uptake (QAT) family ABC
FT                   transporter, amino acid-binding protein"
FT                   /note="identified by similarity to SP:O32243; match to
FT                   protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45979"
FT                   /protein_id="ABA45979.1"
FT                   /translation="MLKKSHFLQIFTLCLALLTISGCQLTDTKKSGHTTIKVAAQSSTE
FT                   SSIMANIITELIHHELGYNTTLISNLGSSTVTHQALLRGDADIAATRYTGTDITGTLGL
FT                   KAVKDPKEASKIVKTEFQKRYNQTWYPTYGFSDTYAFMVTKEFARQNKITKISDLKKLS
FT                   TTMKAGVDSSWMNREGDGYTDFAKTYGFEFSHIYPMQIGLVYDAVESNKMQSVLGYSTD
FT                   GRISSYDLEILRDDKKFFPPYEASMVVNNSIIKKDPKLKKLLHRLDGKINLKTMQNLNY
FT                   MVDDKLLEPSVVAKQFLEKNHYFRGDK"
FT   gene            complement(257554..258189)
FT                   /locus_tag="SAK_0302"
FT   CDS_pept        complement(257554..258189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0302"
FT                   /product="quaternary amine uptake (QAT) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:O34878; similarity to
FT                   SP:Q45461; match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44750"
FT                   /protein_id="ABA44750.1"
FT                   /translation="MVNFLSQYGMQILVKTWEQVYISFFAIALGIAIAVPLGVVLTRFP
FT                   KVAKIIIAIASMLQTIPSLALLALMIPLFGIGKIPAIVALFIYSLLPILRNTYIGMNNV
FT                   NPTLKDCAKGMGMKPIQSIFQVELPLATPIIMAGIRLSTIYVIAWATLASYIGAGGLGD
FT                   LIFSGLNLFQSKLILGGTIPVIILSLIIDYLLGLLETALTPRTTRREA"
FT   gene            complement(258189..259334)
FT                   /locus_tag="SAK_0303"
FT   CDS_pept        complement(258189..259334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0303"
FT                   /product="quaternary amine uptake (QAT) family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:O34992; similarity to
FT                   SP:Q45460; match to protein family HMM PF00005; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   TIGR01186"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44820"
FT                   /protein_id="ABA44820.1"
FT                   /translation="MGQEPIIEYQNINKVYGENVAVEDINLKIYPGDFVCFIGTSGSGK
FT                   TTLMRMVNHMLKPTNGTLLFKGKDISTINPIELRRRIGYVIQNIGLMPHMTIYENIVLV
FT                   PKLLKWSEEAKRAKARELIKLVELPEEYLDRYPSELSGGQQQRIGVIRALAADQDIILM
FT                   DEPFGALDPITREGIQDLVKSLQEEMGKTIILVTHDMDEALKLATKIIVMDNGKMVQEG
FT                   TPNDLLHHPATSFVEQMIGEERLLHAQADITPVKQIMLNNPVSITAEKTLTEAITLMRQ
FT                   KRVDSLLVTDNGKLIGFIDLESLSSKYKKDRLVSDILKHTDFYVMEDDLLRNTAERILK
FT                   LGLKYAPVVDHENNLKGIVTRASLVDMLYDIIWGDTETEDQ"
FT   gene            259761..261267
FT                   /gene="rrsE"
FT                   /locus_tag="SAK_0304"
FT   rRNA            259761..261267
FT                   /gene="rrsE"
FT                   /locus_tag="SAK_0304"
FT                   /product="16S ribosomal RNA"
FT   gene            261357..261429
FT                   /locus_tag="SAK_0305"
FT   tRNA            261357..261429
FT                   /locus_tag="SAK_0305"
FT                   /product="tRNA-Ala"
FT   gene            261584..264486
FT                   /gene="rrlE"
FT                   /locus_tag="SAK_0306"
FT   rRNA            261584..264486
FT                   /gene="rrlE"
FT                   /locus_tag="SAK_0306"
FT                   /product="23S ribosomal RNA"
FT   gene            264561..264676
FT                   /gene="rrfE"
FT                   /locus_tag="SAK_0307"
FT   rRNA            264561..264676
FT                   /gene="rrfE"
FT                   /locus_tag="SAK_0307"
FT                   /product="5S ribosomal RNA"
FT   gene            264680..264752
FT                   /locus_tag="SAK_0308"
FT   tRNA            264680..264752
FT                   /locus_tag="SAK_0308"
FT                   /product="tRNA-Val"
FT   gene            264758..264828
FT                   /locus_tag="SAK_0309"
FT   tRNA            264758..264828
FT                   /locus_tag="SAK_0309"
FT                   /product="tRNA-Gly"
FT   gene            264865..264941
FT                   /locus_tag="SAK_0310"
FT   tRNA            264865..264941
FT                   /locus_tag="SAK_0310"
FT                   /product="tRNA-Ile"
FT   gene            264949..265020
FT                   /locus_tag="SAK_0311"
FT   tRNA            264949..265020
FT                   /locus_tag="SAK_0311"
FT                   /product="tRNA-Glu"
FT   gene            265034..265123
FT                   /locus_tag="SAK_0312"
FT   tRNA            265034..265123
FT                   /locus_tag="SAK_0312"
FT                   /product="tRNA-Ser"
FT   gene            265134..265207
FT                   /locus_tag="SAK_0313"
FT   tRNA            265134..265207
FT                   /locus_tag="SAK_0313"
FT                   /product="tRNA-Met"
FT   gene            265210..265282
FT                   /locus_tag="SAK_0314"
FT   tRNA            265210..265282
FT                   /locus_tag="SAK_0314"
FT                   /product="tRNA-Phe"
FT   gene            265294..265374
FT                   /locus_tag="SAK_0315"
FT   tRNA            265294..265374
FT                   /locus_tag="SAK_0315"
FT                   /product="tRNA-Tyr"
FT   gene            265381..265451
FT                   /locus_tag="SAK_0316"
FT   tRNA            265381..265451
FT                   /locus_tag="SAK_0316"
FT                   /product="tRNA-Trp"
FT   gene            265466..265538
FT                   /locus_tag="SAK_0317"
FT   tRNA            265466..265538
FT                   /locus_tag="SAK_0317"
FT                   /product="tRNA-His"
FT   gene            265545..265616
FT                   /locus_tag="SAK_0318"
FT   tRNA            265545..265616
FT                   /locus_tag="SAK_0318"
FT                   /product="tRNA-Gln"
FT   gene            265627..265710
FT                   /locus_tag="SAK_0319"
FT   tRNA            265627..265710
FT                   /locus_tag="SAK_0319"
FT                   /product="tRNA-Leu"
FT   gene            265841..267331
FT                   /locus_tag="SAK_0320"
FT   CDS_pept        265841..267331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0320"
FT                   /product="ISSag8, transposase"
FT                   /note="The translational stop site for this transposase
FT                   gene is located outside the IS element.; identified by
FT                   match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45543"
FT                   /protein_id="ABA45543.1"
FT                   /translation="MFHKENPDYNRNQVGFYSLDELVPKDHLLRQIDEAIDFSFIYDLV
FT                   KDSYCADNGRPSLDPVMLVKIPMIQCLFGIRSMRQTIKDIEVNVAYRWFLGLTLEDKVP
FT                   HFTTYGKNYNRRFQDKQVIEAIFAYILGLCLNAGLIDPTDIFVDGTHIKAAANNHKYIN
FT                   QEVDAQAKFMSDQLEKEIAKDREKHGKKSLGIAKEKEPISKKISTTDPDSGWFHKGEHK
FT                   QVFAYNAQVACDKYGWALGYSIHAGNVHDSQAFPELFDKIKALTPHYLIADSGYKTPSI
FT                   AHYLLTIGIIPVFSYTRPRSKKGMLRLKDFIYDEYYDVYLCPENHPLSYSTTTRDGYRE
FT                   YKSNPAVCQSCPLLSVCTQSKNHQKVITRHLWKDDLEVCEDIRHQRGMKERYQQRKETI
FT                   ERLFGTAKEYHNLRYTRLRGKSKMEATLGLTLACLNMKKYSKIMAGIVFLVCLKVIISR
FT                   PIVITIVKEKTSWINIPVCLQSETRFLNLVFFLLDNLL"
FT   gene            267582..268040
FT                   /locus_tag="SAK_0321"
FT   CDS_pept        267582..268040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0321"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44404"
FT                   /protein_id="ABA44404.1"
FT                   /translation="MRKYIKWLIPISIFGMILGGCQMNSEHKSQSNEVKNSKQSEVKKD
FT                   KKMTKKEQLAYLKEHEQEIIDYVKLHNNQIESVQFDWSSVKVEQSGNGTPQGGDYNLSL
FT                   RGKFNHLQNSKLIVDFYLAHKNDIPNIKSMGMLNKPYIHKNGIWHIYE"
FT   gene            268104..269738
FT                   /locus_tag="SAK_0322"
FT   CDS_pept        268104..269738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0322"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AI1798"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45235"
FT                   /protein_id="ABA45235.1"
FT                   /translation="MSNWNLDNFDNLHSSLAESAYNSRPNSFPELFETDSVTEVKFSQP
FT                   SEDNKGQITQGGTNLPNDGIVYLQPDKSLKSIDENVKVLIPDVNGGYHTEHYVTHSYQK
FT                   GVLTDDKAGFNAYYLSDTEKIDSTTKHTYLAIRGSDGIGLDTLNDWVSNNAMFAVSNKY
FT                   IPQAKLANKAMKEKIAELKGKAPGAIMDVTGHSLGTIVSSQAVVNLSYAELENVGQVVL
FT                   FDGPDVSRSLEKMEGISAKKIQEAGKHVTYYVNPFDIVSMLNREKPWKDQFGKVNVIVP
FT                   SKYTGTFDEQSSHDFGAFQIDSSGNPLVASESYHPELLTSGQDLARLEKKFIKNLLGEH
FT                   YDSDKLGPVLKGALTGDLTRLIATLKACGISVTVNEAKKLYDNFQKDYKAIISKAKKDG
FT                   LEWDRKNIASFHSRIKSASGSQRILLRTQMLYMATQLAEADVSEKVSATKKHISEAKDT
FT                   IVEISTSTISSAEIMAMHLDQSEVDALVSDIKMSTVWNDGVETSDYEALDHYKTKMTTF
FT                   TTNLVTVAQNLTAQDEQLAGDIVTNLS"
FT   gene            269757..270029
FT                   /locus_tag="SAK_0323"
FT   CDS_pept        269757..270029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45265"
FT                   /protein_id="ABA45265.1"
FT                   /translation="MSKELKLPLNEMLKEQERIAIKAIVATAKSTITDTGTNLKATLES
FT                   DAQDLKNYASTYNANITDGLEGQSAQAASDFLTQLPKPELDNPVN"
FT   gene            270039..270389
FT                   /locus_tag="SAK_0324"
FT   CDS_pept        270039..270389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0324"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45489"
FT                   /protein_id="ABA45489.1"
FT                   /translation="MIDTKKLQELDQEYDQNLRNIYRNREQLEDDFHLFMARTDSLKES
FT                   VYQATLGQGWELPQEAHAHLYNMDDNKDTFISEFNEYMEKLEEKEIDLRRVYNDRVDEL
FT                   YQKAKQNEAKKG"
FT   gene            271250..271831
FT                   /locus_tag="SAK_0325"
FT   CDS_pept        271250..271831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0325"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44479"
FT                   /protein_id="ABA44479.1"
FT                   /translation="MNNKNKWTIILLIFTIIVIDVSLLFGGNRLSLPIKLLILLVTSIA
FT                   EFCSIFIMIKVPTPQKYKKEPFGLKAKFYSIVLFLSTILYTIGIWNVTPASPYNVKESI
FT                   LGVGILIQVVFFIYFLLKKINESPDERFYSNLALSASLMFLISIMLLILIAIYLNIYGT
FT                   LELKSGYLYIMVGLLLLMFAVTYYFLEGRR"
FT   gene            271834..272052
FT                   /locus_tag="SAK_0326"
FT   CDS_pept        271834..272052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0326"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45213"
FT                   /protein_id="ABA45213.1"
FT                   /translation="MGKETKIISSLKQVREDIGMTQQELAIRIGVRRETIGHLENNRYN
FT                   PSLEMALKIVKIFDMKIEDIFQLRKED"
FT   gene            272625..273185
FT                   /locus_tag="SAK_0327"
FT   CDS_pept        272625..273185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0327"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46236"
FT                   /protein_id="ABA46236.1"
FT                   /translation="MNKFFLESERLIIRPLEESDYDSWYTSFMNRGPSLTPFDDGILDM
FT                   SMCDINWFKNLVNLQRKEWESDIVYIFGVFLKSGEHVGMLNIVTLARADMQWGELGYVF
FT                   HNQFWSNGYAFESILALLNSTYEKLGFHHIEAQITPGNERSEKLVRRLGLTYETTRKDF
FT                   SFENGKWTDKLIYSINLHNNNLE"
FT   gene            273285..273863
FT                   /locus_tag="SAK_0328"
FT   CDS_pept        273285..273863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0328"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44870"
FT                   /protein_id="ABA44870.1"
FT                   /translation="MNNLDTLYCKLAMCNTVLTERLRLQPVELTNVNDFLEFSSDSETV
FT                   FYMQRYKANTVEEAQVVLANVCMKSPLGIYAMIEKESQKMIGIIELEIRDEFSAEFGYI
FT                   LNKNYNGKGYMTEACSKLMSIGFEHLDLERIYARFDINNKKSGNVMERIGMKKEGELRH
FT                   LAKNPKGEWKTRAYYSILKEEYFNKVNTK"
FT   gene            273906..274586
FT                   /locus_tag="SAK_0329"
FT   CDS_pept        273906..274586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0329"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44725"
FT                   /protein_id="ABA44725.1"
FT                   /translation="MGDVVENFTEGKNPKIDTLNGKTVRIEKINPDHFEDLFQVYGELS
FT                   TEDSLTYISFSKFNSKNEFDVFFQTLLKSEDPYYLAIVDNNTGKVLGTFSLMRIDTKNR
FT                   VVEMGWVVYSSKLKQTRIATEAQYLVMKYVFEELCYRRYEWKCDSLNAPSNNSAKRLGF
FT                   TFEGTFRQAVVYKGRNRDTNWYSILDKEWPEKKTRFEKWLDDSNFAVNGYQIRSLSSIE
FT                   QKTK"
FT   gene            complement(274846..275793)
FT                   /locus_tag="SAK_0330"
FT   CDS_pept        complement(274846..275793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT29250.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45641"
FT                   /protein_id="ABA45641.1"
FT                   /translation="MIKTKFSDPLEQLAKKRKRKTLFKTVVLALITVLLVVGIAFKGFT
FT                   YLTSKNGQKTYHNFELLSEIAYPNISYDSLYYQPSGQFTGKVHADRFKDIDGVQIPYSS
FT                   FEENYSISGTFGTNADEKSEKNGLYDRGTRQKVPQFFNKNVKYKKGEAKTTPTNDLKYV
FT                   NKLNNDLIEIAITFDKSYSYKEIKTMIPNNIKQNWLWIGTSTELDTSYWPTKYQFGTDP
FT                   ETLNTPQIFIDKIKENLKGNSKVYFNNINIYSDLEKYAKKYDKVNNSDKLKFSGIILTG
FT                   KAENFKQLKEKEWVHASSIGANIEYKPYYKLDKE"
FT   gene            complement(275790..276281)
FT                   /locus_tag="SAK_0331"
FT   CDS_pept        complement(275790..276281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0331"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by similarity to SP:O05404; match to
FT                   protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44464"
FT                   /protein_id="ABA44464.1"
FT                   /translation="MSILDDYEKELLVISHQIIAYLIKSGVNPSQAQDVTQDVFLQILE
FT                   SDFSLPLDKIKAWMYRTTIRRYIDLYRRNKRYNEILQKEFFIENNLYYTESEKFFELHE
FT                   AILHLKKDYQTLIDLYYFNDFSIKEISEITGQSQSTIKIRLMRARREVKKYLEKDNFKI
FT                   "
FT   gene            complement(276861..277469)
FT                   /locus_tag="SAK_0332"
FT   CDS_pept        complement(276861..277469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0332"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45399"
FT                   /protein_id="ABA45399.1"
FT                   /translation="MKNNIIFSIEQYINDQEMPKGKQKVILSAIELFASQGFHGTSTAQ
FT                   LAKNAEVSQATIYKYFETKDKLLVFILELIVQTIGRPFFTELSTFSTKEELIHFFVQDR
FT                   FKFIEKNNDLIKILMQELLINSETSTIFTKLINSTDPNITKIFNCLSEGNSLNKMEILR
FT                   AVIGQFITFFIQLYILNIKPENLEEELKQIEKQILKLLS"
FT   gene            complement(277493..278590)
FT                   /locus_tag="SAK_0333"
FT   CDS_pept        complement(277493..278590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0333"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45283"
FT                   /protein_id="ABA45283.1"
FT                   /translation="MRIIAITEKVIKELFRDKRTLAMMFLAPILIMFLMNVMFSANSNT
FT                   KVKIGTINVNTKVVSNLDNIKHIQVRSFKFNSSAKKALKSNKIDALISEDNKSYTVFYA
FT                   NTDSSKTTLTRQAFKTAVNTMNSKELISQVKILANKNPKLAQSLQTRSKYIKEKYNYGN
FT                   KNTGFFAKMIPILMGFMVFFFVFLISGMALLKERTSGTLDRLLATPVKRSDIVFGYMLS
FT                   YGILEIIQTIVIVLSTIWLLDIQVVGSIFSVIIVNFILALVALSLGILMSTLAKSEFQM
FT                   MQFIPLIIMPQLFFSGIIPLENMASWAQTVGKILPLSYSGDALTKIIMYGQGLPNVSSN
FT                   LLVLLLFLIILTIANIFGLKRYRKV"
FT   gene            complement(278593..279309)
FT                   /locus_tag="SAK_0334"
FT   CDS_pept        complement(278593..279309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0334"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46206"
FT                   /protein_id="ABA46206.1"
FT                   /translation="MKKVIDLKKLQKAYASETVLNNINLEVFKGEIIGLIGPSGAGKST
FT                   LIKTMLGMEKADKGTALVLDTQMPDHNILNQIGYMAQSDALYESLTGLENLLFFGKMKG
FT                   IQKTELKQQITHISKVVDLENQLDKFVSGYSGGMKRRLSLAIALLGNPTVLILDEPTVG
FT                   IDPSLRRKIWQELINIKDEGRSIFITTHVMDEAELTSKVALLLRGNIIAFDTPLHLKKQ
FT                   FNVSTIEEVFLKAEGE"
FT   gene            complement(279573..280256)
FT                   /locus_tag="SAK_0335"
FT   CDS_pept        complement(279573..280256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS43182.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45370"
FT                   /protein_id="ABA45370.1"
FT                   /translation="MDKLKKLQKENTLLEGRIDNSNNQTYTDMIVYLRGASISPYHQEL
FT                   IRNDIVNMLLEAQERQASLVSVFGEDRHDFINQVIKSTPKISKKEETLQRWDLAILLLT
FT                   IQMIIFLGGYLITEALQQSVPDLIPITLLDVLFAIFISIIAVKIADTIIYATYNFDKSK
FT                   EKKYFFRYIFLILSLIIAYILIGKYYHLPFINIPLWIYLIILGLSFSLHIIVKKYLNKH
FT                   YYIEF"
FT   gene            complement(280277..280588)
FT                   /locus_tag="SAK_0336"
FT   CDS_pept        complement(280277..280588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0336"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45704"
FT                   /protein_id="ABA45704.1"
FT                   /translation="MIPSQMLKGLLEGAILKIIQQEETYAYEISKKLNSYGFGEISEGT
FT                   IYPIILRLQSNKYIKGQQKPSPQGPKRKYYTLTNEGVEQLAQFKQNWESLSKALNKLL"
FT   gene            280780..281487
FT                   /locus_tag="SAK_0337"
FT   CDS_pept        280780..281487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44793"
FT                   /protein_id="ABA44793.1"
FT                   /translation="MKIDKKELLALIASIILLIFASVTFFLFKDHGTTQMDTVESSVNH
FT                   VSDSQLTEAQDMLDKFEKKPSEKLLKDVELALNKLSNSSKKEALQKRFKKAKDKYLKDE
FT                   ADKKATKDATDLVEILEQAPSEENVLKAEAAVNKLTVKESKEALQKRIDTVKTQYGLIG
FT                   NQTPSSSVAETTEQGTANPASQDTSSYVNQNVAPTYEQPQANNTPVTPGVNNTVPTPGT
FT                   GTVPATNGTGVAQ"
FT   gene            281765..282913
FT                   /gene="nagA"
FT                   /locus_tag="SAK_0338"
FT   CDS_pept        281765..282913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SAK_0338"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00221"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45269"
FT                   /protein_id="ABA45269.1"
FT                   /translation="MTKYIKADRFFYADHVKENGYLEIKDNHFGKWIENISGQEEILDY
FT                   SGYQIAPGLVDTHIHGFAGADVMDCDSEGILRMSAGLLSTGVTSFLPTTLTSDTKRLEE
FT                   ASKSVAAVAGKEQGAKIQGIYFEGPYFTEEYKGAQNPIYMRNPNLEEFAQWQKAAKGLI
FT                   TKIALAPEREGVEEFVSAITKQGVTVALGHSNGTYKEAKKAVKAGASVWVHAYNGMRGL
FT                   THREPGMVGAVYNLPNTYAELICDGHHVDPVACDILMTQKGHNHVALITDCMAAGGAPD
FT                   GDYMLGELPVVVSNGTARLKDGGNLAGSILKLKDGLKNVVEWGIATPEEAVRMASYVPA
FT                   VSVGIDNVCGQIKEGYAADFIVLDKHLDLVATYLDGEKRWQS"
FT   gene            283032..283574
FT                   /locus_tag="SAK_0339"
FT   CDS_pept        283032..283574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0339"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   (ICMT) family protein"
FT                   /note="identified by match to protein family HMM PF04140"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45879"
FT                   /protein_id="ABA45879.1"
FT                   /translation="MSIIIGLMAAMFIIRLAYLKLSIANEKALRKNGAKEYGVGVSKAI
FT                   TVLHIIIYFSSVTEAILTKASFNFVSVIGLSLMIFSVFMLHTVTRLLGRIWTVKLMVDK
FT                   NHQFVDHWLFRVVKHPNYFLNIAPELLGVTLLCHAKYTALFVLPIYAFVIYLRIREENL
FT                   LLKTIIIPNGIKKSRVY"
FT   gene            283887..284801
FT                   /gene="glyQ"
FT                   /locus_tag="SAK_0340"
FT   CDS_pept        283887..284801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="SAK_0340"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44566"
FT                   /db_xref="GOA:Q3K3B1"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3B1"
FT                   /protein_id="ABA44566.1"
FT                   /translation="MSKKLTFQEIILTLQQFWNDQGCMLMQAYDNEKGAGTMSPYTFLR
FT                   AIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLKSLELLG
FT                   INPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLQTGPVTSEVTY
FT                   GLERLASYIQEVDSVYDIEWAPGVKYGEIFTQPEYEHSKYSFEISDQVMLLENFEKFER
FT                   EAKRALEEGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVA
FT                   ERKKLGFPLLDEETRIKLLAEED"
FT   gene            284801..285442
FT                   /locus_tag="SAK_0341"
FT   CDS_pept        284801..285442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0341"
FT                   /product="acyl carrier protein phosphodiesterase, putative"
FT                   /note="identified by similarity to SP:P41407; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46328"
FT                   /db_xref="GOA:Q3K3B0"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3B0"
FT                   /protein_id="ABA46328.1"
FT                   /translation="MNTLIVNSHPDFSNPYSFTTILQEKFIELYNEHFPNHQLSILNLY
FT                   DCVLPEITKEVLLSIWSKQRKGLELTADEIVQAKISKDLLEQFKSHHRIVFVSPMHNYN
FT                   VTARAKTYIDNIFIAGETFKYTENGSVGLMTDDYRLLMLESAGSIYSKGQYSPYEFPVH
FT                   YLKAIFKDFMAFDDFCVVRAEGTDILDRQVVLDKMNQDLREAFEAFYSKE"
FT   gene            285446..287485
FT                   /gene="glyS"
FT                   /locus_tag="SAK_0342"
FT   CDS_pept        285446..287485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="SAK_0342"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44827"
FT                   /db_xref="GOA:Q3K3A9"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3A9"
FT                   /protein_id="ABA44827.1"
FT                   /translation="MTKDLLLELGLEELPAYVVTPSEKQLGQKMVKFLEDHRLSFETVQ
FT                   TFSTPRRLAVRVKGLADQQTDLTEDFKGPSKKIALDAEGNFSKAAQGFVRGKGLSVDDI
FT                   EFREVKGEEYVYVTKHETGKSAIDVLASVTEVLTELTFPVNMHWANNSFEYIRPVHTLV
FT                   VLLDDQALELDFLDIHSGRISRGHRFLGSDTEISSASSYEDDLRQQFVIADAKERQQMI
FT                   VNQIHAIEEKKNISVEIDEDLLNEVLNLVEYPTAFLGSFDEKYLDVPEEVLVTSMKNHQ
FT                   RYFVVRDRDGKLLPNFISVRNGNAEHIENVIKGNEKVLVARLEDGEFFWQEDQKLNIAD
FT                   LVEKLKQVTFHEKIGSLYEHMDRVKVISQYLAEKADLSDEEKLAVLRAASIYKFDLLTG
FT                   MVDEFDELQGIMGEKYALLAGEQPAVAAAIREHYMPTSADGELPETRVGAILALADKFD
FT                   TLLSFFSVGLIPSGSNDPYALRRATQGIVRILEAFGWDIPLDELVTNLYGLSFASLDYA
FT                   NQKEVMAFISARIEKMIGSKVPKDIREAVLESDTYIVSLILEASQALVQKSKDAQYKVS
FT                   VESLSRAFNLAEKVTHSVLVDSSLFENNQEKALYQAILSLELTEDMHDNLDKLFALSPI
FT                   INDFFDNTMVMTDDEKMKQNRLALLNSLVAKARTVAAFNLLNTK"
FT   gene            287497..287754
FT                   /locus_tag="SAK_0343"
FT   CDS_pept        287497..287754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P60082; match to
FT                   protein family HMM PF05979"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45594"
FT                   /db_xref="GOA:Q3K3A8"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3A8"
FT                   /protein_id="ABA45594.1"
FT                   /translation="MDPKKIARINELSKKKKTVGLTGEEKVEQAKLREEYIEGFRRSVR
FT                   HHVEGIKLVDDEGNDVTPEKLRQVQREKGLHGRSLDDPNS"
FT   gene            287843..288106
FT                   /locus_tag="SAK_0344"
FT   CDS_pept        287843..288106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:H95145; match to
FT                   protein family HMM PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44590"
FT                   /protein_id="ABA44590.1"
FT                   /translation="MIELLLALLLWNILVFATYAIDKRRAIRGAWRISEKTLMIESLLL
FT                   GGFGAFLGGEVFRHKTTKWYFRLVWYIGMIIDLAIIWLIWCY"
FT   gene            288221..289729
FT                   /gene="glpK"
FT                   /locus_tag="SAK_0345"
FT   CDS_pept        288221..289729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="SAK_0345"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45689"
FT                   /db_xref="GOA:Q3K3A6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K3A6"
FT                   /protein_id="ABA45689.1"
FT                   /translation="MSSEEKYIMAIDQGTTSSRAIIFNKKGEKIASSQKEFPQIFPQAG
FT                   WVEHNANQIWNSVQSVIAGAFIESSIKPGQIEAIGITNQRETTVVWDKKTGLPIYNAIV
FT                   WQSRQTAPIADQLKQEGHTNMIHEKTGLVIDAYFSATKVRWILDHVPGAQERAEKGELL
FT                   FGTIDTWLVWKLTDGLVHVTDYSNAARTMLYNIKELKWDDEILELLNIPKAMLPEVKSN
FT                   SEVYGKTTPFHFYGGEVPISGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEM
FT                   QLSQNNLLTTIGYGINGKVHYALEGSIFIAGSAIQWLRDGLRMIETSSESEGLAQSSTS
FT                   DDEVYVVPAFTGLGAPYWDSNARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQV
FT                   DSGIDIQQLRVDGGAAMNNLLMQFQADILGIDIARAKNLETTALGAAFLAGLSVGYWES
FT                   MDELKELNATGQLFQATMNESRKEKLYKGWRKAVKATQVFAQED"
FT   gene            289742..291571
FT                   /gene="glpO"
FT                   /locus_tag="SAK_0346"
FT   CDS_pept        289742..291571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpO"
FT                   /locus_tag="SAK_0346"
FT                   /product="glycerol-3-phosphate oxidase"
FT                   /EC_number="1.1.3.21"
FT                   /note="identified by similarity to SP:P35596; match to
FT                   protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45920"
FT                   /protein_id="ABA45920.1"
FT                   /translation="MEFSRETRRLALQRMQDRTLDLLIIGGGITGAGVALQAAASGLDT
FT                   GLIEMQDFAEGTSSRSTKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPML
FT                   LPVYDEPGSTFSMFRLKVAMDLYDLLAGVTNTPAANKVLSAEDVLKREPDLQKEGLLGG
FT                   GVYLDFRNNDARLVIENIKRANRDGAYIASHVKAEDFLFDDNNQIIGVRARDLLTDQVI
FT                   DIKARLVINTTGPWSDTVRNFSNEGKQIHQLRPTKGVHLVVDRQKLNISQPVYVDTGLN
FT                   DGRMIFVLPREDKTYFGTTDTDYHGDLEHPTVTKEDVDYLLNIVNKRFPEAELTIDDIE
FT                   SSWAGLRPLLSGNSASDYNGGNSGKLSDESFEELIDSVKDYIAHKNHREDVEKAISHVE
FT                   SSTSEKELDPSAVSRGSSFERDDNGLLTLAGGKITDYRKMAEGAMETIINILDKEYNRK
FT                   FKLINSKTYPVSGGEINPSNVDSEIEAYAQLGTLSGLSIEDARYIANLYGSNAPKLFAL
FT                   TRQITEAEGLSLVETLSLHYAMDYEMALSPTDFFLRRTNHMLFMRDNLDSLIQPVIDEM
FT                   AKHYQWSDQDKTFYEEELHETLKDNDLAALKDN"
FT   gene            291583..292281
FT                   /gene="glpF"
FT                   /locus_tag="SAK_0347"
FT   CDS_pept        291583..292281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="SAK_0347"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by similarity to SP:P18156; match to
FT                   protein family HMM PF00230; match to protein family HMM
FT                   TIGR00861"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45692"
FT                   /protein_id="ABA45692.1"
FT                   /translation="MDIFGEFLGTALLVLLGNGVVAGVVLPKTKNHNSGWIVITFGWGL
FT                   AVAIAALVSGNISPAHLNPAVSLAFAIKGDLAWGTAILYMIAQIIGAMLGSLLVYLQFR
FT                   PHYEAAENRADILGTFATGPALKDNFSNFLSEVLGTLVLVLTIFAIGKYNMPPGVGTMS
FT                   VGMLVVGIGLSLGGTTGYAINPARDFGPRLLHALLPMKNKGDSDWTYSWIPIVGPMVGA
FT                   ILAALIFAMM"
FT   gene            292369..293706
FT                   /locus_tag="SAK_0348"
FT   CDS_pept        292369..293706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0348"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44533"
FT                   /protein_id="ABA44533.1"
FT                   /translation="MTEKYVNKVIVILGASFAGMTCAQKLRQLNPNWDIVLIDKEIHPD
FT                   YVPNGLNWYYRHEISGLNQAMWQTEEEQRLQNIRCLFGLKVEKINKEDRELMLSDGSSV
FT                   YYDQLICAMGSQAESTYIDGADAQGVLTTKTYATSQNAKQVLDKSHKVAVVGAGIIGLD
FT                   IAYSLHESGKAVTLLEAQERPDFRHTDPDMSLPLLDAMAESKLHFFQNQKVEKITVTRE
FT                   EKLCLRTLTGDTFTVDAVILAVNFRPDSRLLTGLVDLSVDNSVVVNDYFQTSDPNIYAI
FT                   GDLIWSYFKGLNSAYYMPLINQAIRSAQMLAYHLSGHAVPKLKITRATGSKHFGYYRAN
FT                   IGLTELEAGFYEDTVSVTYFPKEQYDLRIKLIANQKTGHLLGAQLISKENCLATANQLV
FT                   QAISCDMTDFDLAFQDFIYTARESEMAYMLHQAAINLYEKRIGLCE"
FT   gene            293697..295127
FT                   /locus_tag="SAK_0349"
FT   CDS_pept        293697..295127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E98120"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45381"
FT                   /protein_id="ABA45381.1"
FT                   /translation="MRIEALMEKERRVQYRLLSFLRGSPQAIALKLALLETGLSRATLL
FT                   KYINNLNSYFEQEKVNCRIVYYKDKLFLEEDYNLSNQEVLKALMKDSIKYTILISLFNQ
FT                   RQFTIVGLSQELMVSEATLNRHLAHLNELLAEFDIAISQGKQIGDELQWRYFYYELFKQ
FT                   LWSYDKCQNMIKKLDLDSLILLIERLAQHTLTREAHQNLGLWFSICHHRLLAMEKISDN
FT                   LKPIVKHYQCNAFYKRLDAALVLYMSRFALEYREGEVLATFAFLHSQNILPINTMEYIM
FT                   GFGGPIIDCVTETIIYFKKESILADETSDQVIYQLGQLYSHYYFFKGHILVEQPDLEQT
FT                   YRLIDHNMRDKLHHISKKIIANVNRIRPLTEDGCSLLTLHLLELLIFSKNSQKMPFRIG
FT                   LDMTGNAVEQSLLEYRIRQHFSGNNSIQVEPYDEGKGFDMVIYQSHSRPYKAKLTYCLN
FT                   KGASERELQEIDSLIYDN"
FT   gene            295252..297237
FT                   /gene="tkt"
FT                   /locus_tag="SAK_0350"
FT   CDS_pept        295252..297237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="SAK_0350"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45336"
FT                   /protein_id="ABA45336.1"
FT                   /translation="MTFDTIDQLAVNTVRTLSIDAIQAANSGHPGLPMGAAPMAYVLWN
FT                   KFLNVNPKTSRNWTNRDRFVLSAGHGSALLYSLLHLAGYDLSIDDLKQFRQWGSKTPGH
FT                   PEVNHTDGVEATTGPLGQGIANAVGMAMAEAHLAAKFNKPGFDLVDHYTYTLHGDGCLM
FT                   EGVSQEAASLAGHLKLGKLVLLYDSNDISLDGPTSQSFTEDVKGRFESYGWQHILVKDG
FT                   NDLEAIAAAIEAAKAETDKPTIIEVKTIIGFGAEKQGTSSVHGAPLGAEGITFAKKAYG
FT                   WEYPDFTVPAEVADRFASDLQARGAKAEEAWNDLFAKYEVEYPELATEYKEAFAGQAET
FT                   VELKAHDLGSSVASRVSSQQAIQQLSTQLPNLWGGSADLSASNNTMVAAETDFQASNYA
FT                   GRNIWFGVREFAMAAAMNGIALHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPTVYVMT
FT                   HDSIAVGEDGPTHEPIEQLASVRSMPNLNVIRPADGNETNAAWQRAVSETDRPTMLVLT
FT                   RQNLPVLEGTSELAQEGVNKGAYILSEAKGELDGIIIATGSEVKLALDTQDKLESEGIH
FT                   VRVVSMPAQNIFDEQEASYQEQVLPSAVTKRLAIEAGSSFGWGKYVGLNGLTLTIDTWG
FT                   ASAPGNRIFEEYGFTVENAVSLYKEL"
FT   gene            297450..297755
FT                   /locus_tag="SAK_0351"
FT   CDS_pept        297450..297755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL98224.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46191"
FT                   /protein_id="ABA46191.1"
FT                   /translation="MKKECRDFYRQIQHTYNDISVREDAVLSSILLSASNGLIKTSDVP
FT                   RVAYELTQQLENNEIEKSFESLATVKELKKSAKKLSERYEQNKVTTGLLSKVFGNH"
FT   gene            297775..298509
FT                   /locus_tag="SAK_0352"
FT   CDS_pept        297775..298509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0352"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45311"
FT                   /protein_id="ABA45311.1"
FT                   /translation="MIKFEHVSKVYGEKEALSDLTLSVKDGEIFGLIGHNGAGKTTTIS
FT                   ILTSIIDATYGQVYIDDLLLTEHRDQIKKKIGYVPDSPDIFLNLTAEEYWYFLAKIYDV
FT                   APEDIEARITKLVDIFELEEQRYNPIESFSHGMRQKVIVIGALLPNPDIWILDEPLTGL
FT                   DPQASFDLKEMMKEHAKNGKTVIFSTHVLAVAEQLCDRIGILKQGKLIFVGSLGELKMK
FT                   YPDKDLETIYLELAGRQASREG"
FT   gene            298513..300117
FT                   /locus_tag="SAK_0353"
FT   CDS_pept        298513..300117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0353"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GB:AAK34431.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46024"
FT                   /protein_id="ABA46024.1"
FT                   /translation="MNWSRIWELVKINILYSNPQTLSALRKKQEKHPKKEFSAYKSMFR
FT                   NQLFQILLFSIIYVFLFVSLDFKEYPGYFTFYIGIFTLVSIIYSFIAMYSVFYESDDVK
FT                   QYAYLPIKSEELYVAKIFATFGMSVTFLMPILTLMIVAYWRIIGGPLAVLLAIINFAIL
FT                   FLSVTVISLYINSLIGRAIIRSANRKLISTILISLATFGAIVPLLFVNMTSQKMVQGKL
FT                   QDIAPIPYVRGYYDIVTAPFSMESLLNYYLPLLIILFLIGAIYKWVMPRYYQELLYGQV
FT                   KQRKVHRQIDFSKRESINKTLVKHHLSSLQNATLLTNTFLMPLLYLAMFIVPILNNGKE
FT                   IGRFFNENYFGIAFLAGILIGSLCVMPASIVGVGISLEKSNFYFIKSLPISFSYFLKHK
FT                   FVTLITLQLAVPTFIYFLVGFFLLKLSILVLLSFILGLVFMGLIEGQFIYRRDYKHLFL
FT                   NWQEVTQLFNRGLGQWLLVGSLFGMMIIGSFLIGISIFWSMVWNTVAVNIIILIIGLLI
FT                   LSICQYLLLKNFWKKLV"
FT   gene            complement(300325..301710)
FT                   /locus_tag="SAK_0354"
FT   CDS_pept        complement(300325..301710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0354"
FT                   /product="PTS system, IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45003"
FT                   /protein_id="ABA45003.1"
FT                   /translation="MSREYITLSKNIIKHLGGQNNINNVYHCQTRLRFSLNDPTKVNLE
FT                   QLKTLKEVKTVVISGGQHQIVIGTHVAKVFEEINSLIETNSTTKIEQTKKAKAVSRIID
FT                   FVSGTFQPILPALSGAGMIKALLALLLVFKILTPSSQTYILLNLFADGVFYFLPILIAI
FT                   TAAQKLKANPILALGTVVMLLHPNWANLVASGKPVSLFHTIPFTLTNYASSVIPIILII
FT                   CVQAYIEKYLKQIIPKSLRLVLVPMLIFLSMGILSFSILGPMGTIAGQYLAVIFTFLSK
FT                   YASWAPAFLVGAFAPILIMFGVHSGIAALGITQLAKLGVDSIFGPGMLCSNIAQATAGT
FT                   VVTLITKEKKLKEIAGPAAITAYMGITEPILYGVNLPKRYPLIASLIGGGLGGLYAGIM
FT                   NAHRFAVGSSGLPGLFLYISHTSTHLFITMLIAVIITVSTTAILTFILAQYYEKQVSIR
FT                   QRD"
FT   gene            301851..302654
FT                   /gene="proB"
FT                   /locus_tag="SAK_0355"
FT   CDS_pept        301851..302654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SAK_0355"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45982"
FT                   /db_xref="GOA:Q3K396"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K396"
FT                   /protein_id="ABA45982.1"
FT                   /translation="MKRHFETTRRIVIKVGTSSLVQTSGKINLSKIDHLAFVISSLMNR
FT                   GMEVILVSSGAMGFGLDILKMDKRPQEISQQQAVSSVGQVAMMSLYSQIFSHYQTHVSQ
FT                   ILLTRDVVVFPESLQNVTNSFESLLSMGILPIVNENDAVSVDEMDHKTKFGDNDRLSAV
FT                   VAKITKADLLIMLSDIDGLFDKNPNIYDDAVLRSHVSEITDDIIKSAGGAGSKFGTGGM
FT                   LSKIKSAQMVFDNNGQMILMNGANPRDILKVLDGHNIGTYFAQGK"
FT   gene            302664..303917
FT                   /gene="proA"
FT                   /locus_tag="SAK_0356"
FT   CDS_pept        302664..303917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SAK_0356"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44846"
FT                   /db_xref="GOA:Q3K395"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K395"
FT                   /protein_id="ABA44846.1"
FT                   /translation="MTYIEILGQNAKKASQSVARLSTASKNEILRDLARNIVADTETIL
FT                   TENARDVVKAKDNGISEIMVDRLRLNKDRIQAIANGIYQVADLADPIGQVVSGYTNLDG
FT                   LKILKKRVPLGVIAMIFESRPNVSVDAFSLAFKTGNAIILRGGKDAIFSNTALVNCMRQ
FT                   TLQDTGHNPDIVQLVEDTSHVVAEELMQATDYVDVLIPRGGAKLIQTVKEKSKIPVIET
FT                   GVGNVHIYIDEFADLDMAAKIVINAKTQRPSVCNAAEGLVVHQAIAKGFLSQLEKMLKE
FT                   SNQSVEFRADEEALQLLENAVAASESDYATEFLDYIMSVKVVDSFEQAISWINKYSSHH
FT                   SEAIITNNISRAEIFQDMVDAAAVYVNASTRFTDGFVFGLGAEIGISTQKLHARGPMGL
FT                   EALTSTKYYINGTGQVRE"
FT   gene            304000..304947
FT                   /gene="mraW"
FT                   /locus_tag="SAK_0357"
FT   CDS_pept        304000..304947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SAK_0357"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45811"
FT                   /db_xref="GOA:Q3K394"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K394"
FT                   /protein_id="ABA45811.1"
FT                   /translation="MTNDFHHITVLLHETVDMLDIKPDGIYVDATLGGAGHSEYLLSQL
FT                   GPDGHLYAFDQDQKAIDNAHIRLKKYVDTGQVTFIKDNFRNLSSNLKALGVSEINGICY
FT                   DLGVSSPQLDERERGFSYKQDAPLDMRMNREQSLTAYDVVNTYSYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQVRAEKTISTTTELAEIIKSSKSAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDLLAVDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLQPK
FT                   MELVNRKPILPSQEELEANNRAHSAKLRVARRIR"
FT   gene            304962..305288
FT                   /locus_tag="SAK_0358"
FT   CDS_pept        304962..305288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0358"
FT                   /product="cell division protein FtsL, putative"
FT                   /note="identified by similarity to SP:Q07867; match to
FT                   protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44697"
FT                   /protein_id="ABA44697.1"
FT                   /translation="MTNEKRTEAVTQTLQRHIKTFSRIEKAFYGAIVITAIIMAVGIIY
FT                   LQSNSLQVKQEVNQLNSKINDKQTEFDNAKQEVNELSNRDRITKIAKDAGLTIQNDNIY
FT                   RKVD"
FT   gene            305397..307550
FT                   /gene="pbpX"
FT                   /locus_tag="SAK_0359"
FT   CDS_pept        305397..307550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="SAK_0359"
FT                   /product="penicillin-binding protein 2X"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45085"
FT                   /protein_id="ABA45085.1"
FT                   /translation="MILTIFLFFIFIINFVIIVGTDSKFGVNLSKEAKKVYQQSMTVQA
FT                   KRGTIYDRNGNPIAEDATTYSLYAIISKNYTTATGQKLYVQPSQYEKVASILENKLGMK
FT                   KNLVLKQLNQKKLFQVSFGSSGSGLSYTKMADIKKTMEKSDIKGIGFSTSPGRIYPNGI
FT                   FASQFIGFTLPQDDGDGKKLVGNTGLEAALNKVLSGTDGKVTYEKDRSGNVLLGTATTE
FT                   RRAVNGKDIYTTLSEPIQTVLETQMDVFAEKTKGKFASATVVNAKTGEILATSQRPTYN
FT                   PSTLKGYDKKNLGTYNTLLYDNFFEPGSTMKVMTLASAIDSKHFNSTEVYNSAQYKIAD
FT                   AIIRDWDVNEGLSSGSYMTFPQGFAHSSNVGMVTLEQKMGRDKWLNYLSKFKFGYPTRF
FT                   GMLHESGGLFPSDNEVTIAMSSFGQGIGVTQVQMLRAFTSISNDGVMLQPQFISSIYDP
FT                   NTGTSRTARKEVVGKPVSKEAASKTRDYMVTVGTDPYYGTLYAAGAPVIQVGNQSVAVK
FT                   SGTAQIAQEGGGGYLQGKNDTINSVVAMVPSENPDFIMYVTIQQPEKFSITFWKDVVNP
FT                   VLEQATAMKETILKPGLNDSEHQTKYKLSKIVGENPGHVAEELRRNLVQPIILGNGSKV
FT                   SKVSKRPGANLAENEQLLVLTNKLTELPDMYGWSKANVEQFAKWTGIKVTYKGSTSGKV
FT                   RKQSIDVGKSINKIKKIKITIGD"
FT   gene            307552..308562
FT                   /gene="mraY"
FT                   /locus_tag="SAK_0360"
FT   CDS_pept        307552..308562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SAK_0360"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45959"
FT                   /db_xref="GOA:Q3K391"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K391"
FT                   /protein_id="ABA45959.1"
FT                   /translation="MFLSIMAGVIAFVLTVIAIPRFIKFYQLKKIGGQQMHEDVKQHLA
FT                   KAGTPTMGGTVFLIVALLVSLIFSIILSKENSGNLGATFGILSVVLIYGIIGFLDDFLK
FT                   IFKQINEGLTPKQKMSLQLIAGLIFYFVHVLPSGTSAINIFGFYLEVGYLYAFFVLFWV
FT                   VGFSNAVNLTDGIDGLASISVVISLITYGIIAYNQTQFDILLIIVIMIGALLGFFVFNH
FT                   KPAKVFMGDVGSLALGAMLAAISIALRQEWTLLFIGFVYVFETSSVMLQVAYFKYTKKK
FT                   TGVGKRIFRMTPFHHHLELGGVSGKGNKWSEWKVDAFLWAIGIFMSAITLAILYL"
FT   gene            308660..310003
FT                   /locus_tag="SAK_0361"
FT   CDS_pept        308660..310003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0361"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45357"
FT                   /protein_id="ABA45357.1"
FT                   /translation="MSFKDFNFKPYIQRALDELKFVDPTDVQAKLIPVVRSGRDLVGES
FT                   KTGSGKTHTFLLPIFEKLDESSDDVQVVITAPSRELGTQIYQATKQIAEHSEQEIRVVN
FT                   YVGGTDKLRQIEKLKVSQPHIVIGTPGRIYDLVKSGDLAIHKAHTFVVDEADMTLDMGF
FT                   LDTVDKIAGSLPKDVQILVFSATIPQKLQPFLKKYLTNPVMEKIKTATVIADTIDNWLL
FT                   STKGRDKNAQILELSKLMQPYLAMIFVNTKERADELHSYLSSNGLKVAKIHGGIAPRER
FT                   KRIMNQVKNLEFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGLSG
FT                   TAITLYQPSDDSDIRELEKLGINFIPKVIKNGEFQDTYDRDRRNNREKSYQKLDTEMIG
FT                   LVKKKKKKIKPGYKKKIQWKVDEKRRKERRASNRAKGRAERKAKKQSF"
FT   gene            310141..310953
FT                   /locus_tag="SAK_0362"
FT   CDS_pept        310141..310953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0362"
FT                   /product="polar amino acid uptake (PAAT) family ABC
FT                   transporter, amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45520"
FT                   /protein_id="ABA45520.1"
FT                   /translation="MFKKIILSIATIAATASLAVSVQASEKVELKVATDSDTAPFTYQK
FT                   DGKFKGYDVDVVKAVFKGSKYKVTFKTVPFDTISTGIDAGKFDLSANDFSYNKERAEKY
FT                   LFSDPISRSNYAVVGKKGSHYKSLSDLSGKSTEVLSGVNYAQVLENWNKNHPNKKPIKI
FT                   KYVSGTTGVTSRLKNIESGKIDFILYDAISSDYIVKDQSLNLSVSPLKGKIGNNKDGLE
FT                   YLLLPKDKKGKTLQKFINKRIKVLKENGTLARLSKQYFGGDYVSNIDK"
FT   gene            311048..311851
FT                   /locus_tag="SAK_0363"
FT   CDS_pept        311048..311851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0363"
FT                   /product="polar amino acid uptake (PAAT) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44587"
FT                   /protein_id="ABA44587.1"
FT                   /translation="MNQFILTGGWSWYNNLVSQVPAGKLFSWKAVLDAIPSILERLPIT
FT                   LLLTVAGALFGLILALIFAVVKINRVKILYPIQALFVSFLRGTPILVQLMLSYYGIPLF
FT                   LKFLNQKYGFDWNINAIPASVFAITAFAFNEAAYTSETIRAAILSVDQGEIEAARSLGM
FT                   TSAQVYRRVIIPNAAVVATPTLINTLIGLTKGTSLAFNAGIVEMFAQAQIMGGSDYRYF
FT                   ERYISVALVYWAVSFLIEQLGNAIERKMAIKAPRHLTDEIPGGVR"
FT   gene            311851..312594
FT                   /locus_tag="SAK_0364"
FT   CDS_pept        311851..312594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0364"
FT                   /product="polar amino acid uptake (PAAT) family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45523"
FT                   /protein_id="ABA45523.1"
FT                   /translation="MIKLRQLTKSFSGQKVLDKLDLDIEKGQVVALVGASGAGKSTFLR
FT                   SMNYLEEPDYGTIEIDDFKVDFKSISKDDILTLRRKLAMVFQQFNLFERRTALDNVKEG
FT                   LKIVKKMSDQEATRIARDELAKVGLADREKYYPRHLSGGQKQRVALARALAMKPDVLLL
FT                   DEPTSALDPELVGEVEKSIADAAKQGQTMVLVSHDMNFVYQVADKVLFLEKGRILESGT
FT                   PEQLFNHPLEERTKEFFASYNKSYL"
FT   gene            312716..312940
FT                   /locus_tag="SAK_0365"
FT   CDS_pept        312716..312940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34421.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44780"
FT                   /protein_id="ABA44780.1"
FT                   /translation="MFLEIAKVYLQGLGLASITVILVGIIWVFWRAKKNIDKTARERQS
FT                   VLYDVLLIALMTAPILAFAFVAIILMIKA"
FT   gene            313009..313923
FT                   /gene="trxB"
FT                   /locus_tag="SAK_0366"
FT   CDS_pept        313009..313923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SAK_0366"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46065"
FT                   /protein_id="ABA46065.1"
FT                   /translation="MYDTLIIGSGPGGMTAALYAARSNLKVGLIEQGAPGGQMNNTAEI
FT                   ENYPGYDHISGPELSMKMYEPLEKFEVEHIYGIVQRVENDGDVKRVITEDESYEAKTVI
FT                   LATGAKNSLLGVPGEEEYTSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEAVFLTQFA
FT                   KSVTIIHRRDQLRAQKVLQDRAFANEKIKFVWDSVVKEIKGNEIKVSGVTVENLKTGEI
FT                   SEMTFGGVFIYVGLKPHSSMVSELGITDETGWVLTDTNMKTSIPGLYAIGDVRQKDLRQ
FT                   IATAVGEGAIAGQGVYNYITEHF"
FT   gene            314081..315541
FT                   /locus_tag="SAK_0367"
FT   CDS_pept        314081..315541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0367"
FT                   /product="nicotinate phosphoribosyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45735"
FT                   /protein_id="ABA45735.1"
FT                   /translation="MYKDDSLTLHTDLYQINMMQVYFNKGIHNKRAVFEAYFRKVPFEN
FT                   GYAVFAGLERIVRYLENLSFSDSDLSYLEELGYPEEFLDYLKNLKMELTVKSAKEGDLV
FT                   FANEPLVQIEGPLAQCQLVETAILNIINYQTLVATKAARIRSVIEDEPLLEFGTRRAQE
FT                   MDAAIWGTRAAIIGGANATSNVRAGKIFNIPVSGTHAHALVQTYGDDYQAFKAYAETHK
FT                   DCVFLVDTYDTLRVGVPNAIRVAKEMGEKINFLGVRLDSGDLAYLSKKVRQQLDDAGFP
FT                   NAKIYASNDLDENTILNLKMQKAKIDVWGVGTKLITAYDQPALGAVYKIVSIETDAGSM
FT                   RDTIKLSNNAEKVSTPGKKQVWRITSRAKGKSEGDYITFADTDVTQLDEIEMFHPTYTY
FT                   INKTVRDFDAVPLLVDIFDKGKLVYQLPSLQEIQEYGRKEFDQLWDEYKRVLNPQDYPV
FT                   DLARDVWQNKMDLIDRIRKEALAKGEVR"
FT   gene            315538..316359
FT                   /gene="nadE"
FT                   /locus_tag="SAK_0368"
FT   CDS_pept        315538..316359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SAK_0368"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by similarity to SP:P18843; match to
FT                   protein family HMM PF02540; match to protein family HMM
FT                   TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45292"
FT                   /db_xref="GOA:Q3K383"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K383"
FT                   /protein_id="ABA45292.1"
FT                   /translation="MTLQDQIIKELGVKPVINPSQEIRRSVEFLKDYLLKHSFLKTYVL
FT                   GISGGQDSTLAGRLAQLAVEELRADTGENYQFIAIRLPYGIQADEEDAQKALDFIKPDI
FT                   ALTINIKEAVDGQVRALNAAGVEITDFNKGNIKARQRMISQYAVAGQYAGAVIGTDHAA
FT                   ENITGFFTKFGDGGADLLPLFRLNKSQGKQLLAELGADKALYEKIPTADLEENKPGIAD
FT                   EIALGVTYQEIDAYLEGKVVSDKSRGIIENWWYKGQHKRHLPITIFDDFWK"
FT   gene            316472..317806
FT                   /gene="pepC"
FT                   /locus_tag="SAK_0369"
FT   CDS_pept        316472..317806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="SAK_0369"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by similarity to SP:Q56115; match to
FT                   protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46150"
FT                   /protein_id="ABA46150.1"
FT                   /translation="MSKLTQTFTDKLFADYQANTKFSAIENAVTHNGLLKSLETRQSEI
FT                   ENDYVFSIDLTKDEVSNQKQSGRCWMFAALNTFRHKLISDFKLENFELSQAHTFFWDKY
FT                   EKSNWFMEQIIATANQELSSRKVKFLLDVPQQDGGQWDMVVALFEKYGVVPKTVYPESV
FT                   SSSASRELNQYLNKLLRQDAQILRELIAQGADGATVQNKKEELLQEIFNFLAMNLGLPP
FT                   QSFDFAYRDKDNHYQSDKNITPKAFYQKYVNLDLSDYVSIINAPTVDKPYGQSYTVEML
FT                   GNVVGGPAVKYLNLDMKRFKELAIAQMKSGETVWFGSDVGQVSNRQKGILATTTYDFNS
FT                   SMDIKLSQDKAGRLDYSESLMTHAMVLTGVDLDESGQPLKWKVENSWGEKVGKDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTKEELEAYNAEPITLAPWDPMGALAN"
FT   gene            complement(317852..320098)
FT                   /locus_tag="SAK_0370"
FT   CDS_pept        complement(317852..320098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0370"
FT                   /product="pencillin-binding protein, 1A family"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45033"
FT                   /protein_id="ABA45033.1"
FT                   /translation="MITIKKESVIKLLKYAFGIIMGFIILAIVIGGLLFAYYVSRSPKL
FT                   TDQALKSVNSSLVYDGNNKLIADLGSEKRESVSADSIPLNLVNAITSIEDKRFFKHRGV
FT                   DIYRILGAAWHNLVSSNTQGGSTLDQQLIKLAYFSTNKSDQTLKRKSQEVWLALQMERK
FT                   YTKEEILTFYINKVYMGNGNYGMRTTAKSYFGKDLKELSIAQLALLAGIPQAPTQYDPY
FT                   KNPESAQTRRNTVLQQMYQDKNISKKEYDQAVATPVTDGLKELKQKSTYPKYMDNYLKQ
FT                   VISEVKQKTGKDIFTAGLKVYTNINTDAQKQLYDIYNSDTYIAYPNNELQIASTIMDAT
FT                   NGKVIAQLGGRHQNENISFGTNQSVLTDRDWGSTMKPISAYAPAIDSGVYNSTGQSLND
FT                   SVYYWPGTSTQLYDWDRQYMGWMSMQTAIQQSRNVPAVRALEAAGLDEAKSFLEKLGIY
FT                   YPEMNYSNAISSNNSSSDAKYGASSEKMAAAYSAFANGGTYYKPQYVNKIEFSDGTNDT
FT                   YAASGSRAMKETTAYMMTDMLKTVLTFGTGTKAAIPGVAQAGKTGTSNYTEDELAKIEA
FT                   TTGIYNSAVGTMAPDENFVGYTSKYTMAIWTGYKNRLTPLYGSQLDIATEVYRAMMSYL
FT                   TGGYSADWTMPEGLYRSGSYLYINGTTTTGTYSSSVYKNIYQNSGQSSQSSSSTSSEKQ
FT                   KEDKNTANDANSSSPQVETPNNGNATTPNNSNQTVPGTGHGNGNGNNNTVPNGN"
FT   gene            complement(320085..320684)
FT                   /gene="recU"
FT                   /locus_tag="SAK_0371"
FT   CDS_pept        complement(320085..320684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SAK_0371"
FT                   /product="recombination protein U"
FT                   /note="identified by match to protein family HMM PF03838;
FT                   match to protein family HMM TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45918"
FT                   /db_xref="GOA:Q3K380"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K380"
FT                   /protein_id="ABA45918.1"
FT                   /translation="MVNYPHQLIRKTTVTKSKKKKIDFANRGMSFEAAINATNDYYLSH
FT                   ELAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVYKGYYIDFEAKETRQK
FT                   TAMPMKNFHAHQIEHMANVLQQKGICFVLLHFSTLKETYLLPANELISFYQIDKGNKSM
FT                   PIDYIRKNGFFVKESAFPQVPYLDIIEEKLLGGDYN"
FT   gene            320759..321277
FT                   /locus_tag="SAK_0372"
FT   CDS_pept        320759..321277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58218.1; match to
FT                   protein family HMM PF06908"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45102"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K379"
FT                   /protein_id="ABA45102.1"
FT                   /translation="MKSTILVTGYKNFELGIFQDKDPRITIIKKAIDKDFRRFLENGAD
FT                   WFIFMGNLGFEYWALEVALDLQKEYDFQIATIFTFENHGQNWNEANKAKLALFKQVDFV
FT                   KYTFPSYENPGQFKQYNHFLINNTQGAYLFYDSENETNLKFLLEMMEKKEAYDISFLTF
FT                   DRLNEIYEE"
FT   gene            321398..321730
FT                   /locus_tag="SAK_0373"
FT   CDS_pept        321398..321730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0373"
FT                   /product="DivIVA domain protein"
FT                   /note="identified by match to protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45968"
FT                   /db_xref="GOA:Q3K378"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K378"
FT                   /protein_id="ABA45968.1"
FT                   /translation="MASIIYSPKDIFEQDFKVSMRGYDKKEVDVFLDDVIKDYENYLEQ
FT                   IEKLQMENRRLQQALDKKESEASNVRNSGTAMYNQKPIAQSATNFDILKRISRLEKEVF
FT                   GRQIRE"
FT   gene            322200..323354
FT                   /locus_tag="SAK_0374"
FT   CDS_pept        322200..323354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO80952.1; match to
FT                   protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45745"
FT                   /protein_id="ABA45745.1"
FT                   /translation="MKESFKLIATAAAGLEAIVGREIRNLGIDCQVENGRVRFHGDIKT
FT                   IIETNLWLRAADRIKIIVGEFPARTFEELFQGVYGLDWENYLPLGAKFPIAKAKCVKSK
FT                   LHNEPSVQAISKKAVAKKLQKVFHRPEGVPLQENGAEFKIEVSILKDKATVMIDTTGSS
FT                   LFKRGYRAEKGGAPIKENMAAAIIQLSNWFPDKPLIDPTCGSGTFCIEAAMIGMNIAPG
FT                   FNRDFAFEAWPWVDQSQVQKVRDEAESKANYDIDLDISGFDLDGRMVEIARKNAEEAGL
FT                   GDVIKLKQMRLQDLKTDKINGVIISNPPYGERLLDDKAVDILYNEMGQTFAPLKTWSKF
FT                   ILTSDEGFEKKYGSQADKKRKLYNGTLKVDLYQYYGERVRRQVK"
FT   gene            323367..324830
FT                   /locus_tag="SAK_0375"
FT   CDS_pept        323367..324830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM79992.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44615"
FT                   /protein_id="ABA44615.1"
FT                   /translation="MSEDQKHPFFEPKKETDGLEFKDAKEMTVEEAVRKDSEIKAGITE
FT                   EDSILDKYIKQHRDEVASQKFETKSSDFANLDTASLDDFIKKQREELSAMLAAEELSKK
FT                   LDNSVSQEQDTEANAVSPKEESSQEQENSVTPVPPLNTEAEPTATEPDSTIADSEEYKS
FT                   SSKKRGGIVGTLIALILLLIVAIFGYNYFKNNNSTNSQTATSQSSSSKATTTSSEEDKK
FT                   ASQNLDNFNKSYANFFVDDKKTQLKNSEFDKLSELEKKVDALKGTKYYGKVKVKFDSLK
FT                   RQIDAVKAVNDKFKSPAVVDGKKSEKLEVKDGANFDSLDSKTLNTGNASLDSLLHSIVS
FT                   TGRNQVKQSEEQASSNKVSDTQITEQPNVTNGQSSSSAATINNQAAGTASGNLERNRSR
FT                   VPYNNAAIADTGNPAWIFNPGVLEKIVATSQARGYFSGNNYILEPVNIINGNGYYNMFK
FT                   LDGTYLFSINAKTGYFVGNAPGRADSLDY"
FT   gene            complement(325055..325537)
FT                   /gene="luxS"
FT                   /locus_tag="SAK_0376"
FT   CDS_pept        complement(325055..325537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SAK_0376"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /EC_number="3.13.1.-"
FT                   /note="identified by similarity to SP:P45578; match to
FT                   protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45384"
FT                   /db_xref="GOA:Q3K375"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K375"
FT                   /protein_id="ABA45384.1"
FT                   /translation="MTKEVVVESFELDHTIVKAPYVRLISEEVGPVGDIITNFDIRLIQ
FT                   PNENAIDTAGLHTIEHLLAKLIRQRINGLIDCSPFGCRTGFHMIMWGKQDATEIAKVIK
FT                   SSLEAIAGGVTWEDVPGTTIESCGNYKDHSLHSAQEWAKLILSQGISDNAFERHIV"
FT   gene            325726..327333
FT                   /locus_tag="SAK_0377"
FT   CDS_pept        325726..327333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0377"
FT                   /product="HDIG domain/KH domain protein"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45229"
FT                   /db_xref="GOA:Q3K374"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K374"
FT                   /protein_id="ABA45229.1"
FT                   /translation="MFNIILAMVCALIGLIIGYVAISMKMKSSKEAAELTLLNAEQDAV
FT                   DLRGKAEIEAEHIRKAAERESKAHQKELLLEAKEEARKYREEIEKEFKSDRQELKQMEA
FT                   RLTDRASSLDRKDENLSNKEKMLDSKEQSLTDKSRHINEREQEIATLETKKVEELSRIA
FT                   ELSQEEAKDIILADTEKDLAHDIATRIKEAEREVKDRSNKIAKDLLAQAMQRLAGEYVT
FT                   EQTITTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIIDDTPEVVVLSGFDPIRREIA
FT                   RMTLESLIQDGRIHPARIEELVEKNRLEMDQRIREYGEAAAYEIGAPNLHPDLIKIMGR
FT                   LQFRTSYGQNVLRHSVEVGKLAGILAGELGENVDLARRAGFLHDMGKAIDREVEGSHVE
FT                   IGMEFARKYKEHPIVVNTIASHHGDVEPDSVIAVIVAAADALSSARPGARNESMENYIK
FT                   RLRDLEEIANGFEGVQNAFALQAGREIRIMVQPGKVSDDQVVIMSHKVREKIEQNLDYP
FT                   GNIKVTVIREMRAVDFAK"
FT   gene            327462..328358
FT                   /locus_tag="SAK_0378"
FT   CDS_pept        327462..328358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0378"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46335"
FT                   /protein_id="ABA46335.1"
FT                   /translation="MAKDIIKVDHIFKSIGQKTILEDISFSIASNQCVALIGPNGAGKT
FT                   TLMSTLLGDISISSGSLTIFNLPAHHNRLKYKVAILPQENVLPSKFTVRELIDFQRCLF
FT                   PEVLPMSLILDYLQWSDTHLQQFTETLSGGQKRLLAFVLTLVGKPQLLFLDEPTSGMDT
FT                   STRQRFWELIATLKKEGVTIVYSSHYIEEVEHTADRILVLHKGKLLRDTTPFAMKQEKT
FT                   EKLFTVPLSYQKLLPTYLITECEAKSDSITFVTGEAEAVWKILADNGCPIEAIEMTNRT
FT                   LLNRIFETTKEVKHENL"
FT   gene            328345..329085
FT                   /locus_tag="SAK_0379"
FT   CDS_pept        328345..329085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0379"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to SP:P75774"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45314"
FT                   /protein_id="ABA45314.1"
FT                   /translation="MRIFKALLKMEFLLTKRQLANLIMAIGMPVAFFLFFSGFMGEGLT
FT                   KAIEAIYVRNYMITMAGFSSLSFAFFTFPFSMKDDQLSNRMQLLRHSPVPMWQYYLAKI
FT                   IRILFYYCLAITVVFLTGHILRQVSMPIEQWMQSFLLLLGGATCFIPFGLLVSYFKNTE
FT                   LMSMVANICYMSLAVLGGMWMPITMFPKWLQALSKLTPTYHLTQVILSPFANSFAGFSL
FT                   IILIGYGIIMLVIAYLLSQKRHSI"
FT   gene            329082..330167
FT                   /locus_tag="SAK_0380"
FT   CDS_pept        329082..330167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0380"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44984"
FT                   /protein_id="ABA44984.1"
FT                   /translation="MKNKKNNYDLMYFIPLVFLIYPIGGILYYHYPFWTLFFTLAFVGA
FT                   YLYSVIIRGESKYHMIAWSTMLTYIFYMTIFINSGFIWYIYFLSNLLVYRFRDKLKSFR
FT                   FISFACTLATVVFLCFFKASDFGDRIMFLIVPIFCIGYMWIAIENRNSEEQREKIAEQN
FT                   QYINILSAENERNRIGRDLHDSLGHTFAMMTLKTELALKLLEKRNYDKVQKELSELNHI
FT                   SHQSMSEVRQIVSNLKYRTVVEEIDELYRLFQLSNIKLTVVNKLETSQLSPVTQSTITM
FT                   ILKELSNNIVKHAEADSVELSLVRQGATINIEMIDNGCGFTNLDGDELHSIQERLTIVE
FT                   GTLTILSRSKPTHIQVVLKEV"
FT   gene            330169..330759
FT                   /locus_tag="SAK_0381"
FT   CDS_pept        330169..330759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0381"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45871"
FT                   /protein_id="ABA45871.1"
FT                   /translation="MKLLVAEDQSMLRDAMCQLLLMEESVSTIDQAGNGGEAIAILSNK
FT                   AIDVAILDVEMPILSGLDVLEWVRKYQNVKVIIVTTFKRSGYFQRAIRSNVDAYVLKDR
FT                   SVADLMKTIQKVLSGGKEYSPELMENVISNPLSEQEIKILSLIAQGKTSKEIACTLFLS
FT                   NGTVRNYTSNIFDKLGVNNRLEALKIAREKDWL"
FT   gene            330809..331513
FT                   /locus_tag="SAK_0382"
FT   CDS_pept        330809..331513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS08951.1; match to
FT                   protein family HMM PF06736"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45459"
FT                   /protein_id="ABA45459.1"
FT                   /translation="MQKFKERFDTLSDAILAIAMTILVLEIKTPATMGDIGDFTRNIGL
FT                   FIVSFVVVFNFWYERAQNSLDAQKTNDEIIALDIIEHLGICLIPLFTKFMISFENHNFA
FT                   VMAYGLLTLLVGLTSDIIRIRLASYDLVTIPSELKERVIKVMTTFAIRSVVVRFIIIIL
FT                   AYFLPEVGIFAYLVIPLFMFWRRSRAGKYYAKKGIEAPSYIKLFIQIGERAPEDFTNSS
FT                   SGIGGVKRLYKK"
FT   gene            331680..332309
FT                   /gene="gmk"
FT                   /locus_tag="SAK_0383"
FT   CDS_pept        331680..332309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SAK_0383"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44845"
FT                   /db_xref="GOA:Q3K368"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K368"
FT                   /protein_id="ABA44845.1"
FT                   /translation="MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFDYSVSMTTRPQR
FT                   PGEVDGVDYFFRTREEFEALIKEGQMLEYAEYVGNYYGTPLSYVNETLDKGIDVFLEIE
FT                   VQGALQVKSKVPDGVFIFLTPPDLEELEERLVGRGTDSPEVIAQRIERAKEEIALMREY
FT                   DYAVVNDQVSLAAERVKRVIEAEHYRVDRVIGRYTNMVKETDKKLS"
FT   gene            332332..332646
FT                   /gene="rpoZ"
FT                   /locus_tag="SAK_0384"
FT   CDS_pept        332332..332646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="SAK_0384"
FT                   /product="DNA-directed RNA polymerase omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45354"
FT                   /db_xref="GOA:Q3K367"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K367"
FT                   /protein_id="ABA45354.1"
FT                   /translation="MMLKPSIDTLLDKVPSKYSLVILQAKRAHELEAGEKATQDFKSVK
FT                   STLRALEEIESGNVVIHPDPSAKRASVRARIEAERLAKEEEERKIKEQIAKEKEDGEKI
FT                   "
FT   gene            332720..335110
FT                   /gene="priA"
FT                   /locus_tag="SAK_0385"
FT   CDS_pept        332720..335110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SAK_0385"
FT                   /product="primosomal protein N'"
FT                   /note="identified by similarity to SP:P94461; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851; match to
FT                   protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46140"
FT                   /protein_id="ABA46140.1"
FT                   /translation="MARKLAQVIVDIPLMQTDKPFSYAIPKDLEDLVQVGVRVHVPFGR
FT                   GNRLLQGFVVGFRDDDELETKDIAEVLDFEPVLNQEQLDLADQMRHTVFSYKISILKSM
FT                   LPSLLNSQYDKLLLATDTLPSEDREDLFGHKTEIVFSSLSSQDAKKAGRLIQKGFIEVQ
FT                   YLAKDKKTIKTEKIYKINRTLLEKSQIAARAKKRLELKEFLLENPQPGRLTALNKQFSS
FT                   PVVNFFREEGIIEVIEKEASRSDNYFKGILKTDFLDLNQEQAKVVKIVVDQIGKEQNKP
FT                   FLLEGITGSGKTEVYLHIIDNVLKLGKTAIVLVPEISLTPQMTNRFISRFGKQVAIMHS
FT                   GLSEGEKFDEWRKIKSGQAKVVVGARSAIFAPLENIGAIIIDEEHESTYKQESNPRYHA
FT                   RDVALLRAEYYKAVLLMGSATPSIESRARASRDVYKFLELKHRANPKARIPQVEIIDFR
FT                   NFIGQQEVSNFTSYLLDKIRDRLDKKEQVVLMLNRRGYSSFIMCRDCGYVDQCPNCDIS
FT                   LTLHMATKTMNCHYCGFEKPIPRTCPNCNSKSISYYGTGTQKAYEELLKVIPDAKILRM
FT                   DVDTTRQKGGHESILKRFGNHEADILLGTQMIAKGLDFPNVTLVGVLNADTSLNLPDFR
FT                   SSERTFQLLTQVAGRAGRAEKEGEVVIQTYNPNHYAIQLAQKQDFEAFYQYEMNIRRQL
FT                   GYPPYYFTVGLTLSHKDEEWLIRKSYEVLSLLKQGFSDKVKLLGPTPKPIARTHNLYHY
FT                   QIIIKYRFEDNLELVLNRLLDMTQDKENRDLRLAIDHEPQNMM"
FT   gene            335157..336092
FT                   /gene="fmt"
FT                   /locus_tag="SAK_0386"
FT   CDS_pept        335157..336092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SAK_0386"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45890"
FT                   /db_xref="GOA:Q3K365"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K365"
FT                   /protein_id="ABA45890.1"
FT                   /translation="MTKLLFMGTPDFSATVLKGILADGKYDVLAVVTQPDRAVGRKKEI
FT                   KMTPVKEVALENNIPVYQPEKLSGSPELEQLMTLGADGIVTAAFGQFLPTKLLESVGFA
FT                   INVHASLLPKYRGGAPIHYAIINGEKEAGVTIMEMVAKMDAGDMVSKASVEITDEDNVG
FT                   TMFDRLAVVGRDLLLDTLPGYLSGDIKPIPQNEEEVSFSPNISPDEERIDWNKSSRDIF
FT                   NHVRGMYPWPVAHTLLEGNRFKLYEVTMSEGKGSPGQVIAKTKNSLTVATGDGAIELKS
FT                   VQPAGKPRMDIKDFLNGVGRNLEIGDKFGE"
FT   gene            336082..337404
FT                   /gene="sun"
FT                   /locus_tag="SAK_0387"
FT   CDS_pept        336082..337404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="SAK_0387"
FT                   /product="sun protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45244"
FT                   /protein_id="ABA45244.1"
FT                   /translation="MANDWKKSARGLALMTLEEVFDKGAYSNIALNKSLKKSRLSDKDR
FT                   ALVTEIVYGTVARKITLEWYLSHFIVDRDKLELWVYHLLLLSLYQLLYLDNIPDHAIVN
FT                   DAVTIAKNRGNKKGAEKLINAVLRRVSSETLPEIASIKRQNKRYSVAYSMPVWLVKKLI
FT                   DQYGETRALAIMESLFERNKASLRVTDLSQKQTIKETLNVRDSHIAETALVADSGNFAS
FT                   TSFFQDGLITIQDESSQLVAPTLKVSGNDQVLDACSAPGGKTSHIASYLTTGAVTALDL
FT                   YDHKLELVMENAKRLGLSDKIKTKKLDASKAHEYFLEDTFDKILVDAPCSGIGLIRRKP
FT                   DIKYNKANQDFEALQEIQLSILSSVCQTLRKGGIITYSTCTIFEEENFQVIEKFLENHP
FT                   NFEQVELSHTQEDIVKRGCISISPEQYHTDGFFIGQVKRIL"
FT   gene            337442..338179
FT                   /gene="stp1"
FT                   /locus_tag="SAK_0388"
FT   CDS_pept        337442..338179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stp1"
FT                   /locus_tag="SAK_0388"
FT                   /product="serine/threonine protein phosphatase Stp1"
FT                   /note="identified by similarity to GB:AAL58473.1; match to
FT                   protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45278"
FT                   /protein_id="ABA45278.1"
FT                   /translation="MEISLLTDIGQRRSNNQDFINQFENKAGVPLIILADGMGGHRAGN
FT                   IASEMTVTDLGSDWAETDFSELSEIRDWMLVSIETENRKIYELGQSDDYKGMGTTIEAV
FT                   AIVGDNIIFAHVGDSRIGIVRQGEYHLLTSDHSLVNELVKAGQLTEEEAASHPQKNIIT
FT                   QSIGQANPVEPDLGVHLLEEGDYLVVNSDGLTNMLSNADIATVLTQEKTLDDKNQDLIT
FT                   LANHRGGLDNITVALVYVESEAV"
FT   gene            338179..340134
FT                   /gene="stk1"
FT                   /locus_tag="SAK_0389"
FT   CDS_pept        338179..340134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stk1"
FT                   /locus_tag="SAK_0389"
FT                   /product="serine/threonine protein kinase Stk1"
FT                   /note="identified by similarity to GB:AAL58474.1; match to
FT                   protein family HMM PF00069; match to protein family HMM
FT                   PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46135"
FT                   /protein_id="ABA46135.1"
FT                   /translation="MIQIGKLFAGRYRILKSIGRGGMADVYLARDLILDNEEVAIKVLR
FT                   TNYQTDQIAVARFQREARAMAELTHPNIVAIRDIGEEDGQQFLVMEYVDGFDLKKYIQD
FT                   NAPLSNNEVVRIMNEVLSAMSLAHQKGIVHRDLKPQNILLTKKGTVKVTDFGIAVAFAE
FT                   TSLTQTNSMLGSVHYLSPEQARGSKATVQSDIYAMGIMLFEMLTGHIPYDGDSAVTIAL
FT                   QHFQKPLPSILAENKSVPQALENIVIKATAKKLTDRYKTTYEMGRDLSTALSSTRHREP
FT                   KLVFNDTESTKTLPKVTSTVSSLTTEQLLRNQKQAKTTEKITPDSASNDKTKSKKKASH
FT                   RLLGTIMKLFFALCVVGIIVFAYKILVSPTTIRVPDVSNKTVAQAKMTLENSGLKVGAI
FT                   RNIESDSVSEGLVVKTDPAAGRSRREGAKVNLYIATPNKSFTLGNYKEHNYKDILKDLQ
FT                   GKGVKKSLIKVKRKINNDYTTGTILAQSLPEGTSFNPDGNKKLTLTVAVNDPMIMPDVT
FT                   GMTVGEVIETLTDLGLDADNLVFYQMQNGVYQTVVTPPSSSKIASQDPYYGGEVGLRRG
FT                   DKVKLYLLGSKTTNNSSSTPIDSSASSSTGTTTSDSVSSSTDASTSDSSSTSTSSSTLP
FT                   SDSTTNTGTANNPLTQ"
FT   gene            340295..340990
FT                   /locus_tag="SAK_0390"
FT   CDS_pept        340295..340990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63589.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46087"
FT                   /protein_id="ABA46087.1"
FT                   /translation="MKKFQFFLLVEAVVLVMGLMKILSDDWTSFIFILALILLALRFYN
FT                   NDSRHNFLLTTSLLLLFLIFMLNPYIIAAVVFAVLYVLINHFSQVKKKNRYALIQFKNH
FT                   QLDVKTTRNQWLGTDQHESDFYAFEDINIIRISGTDTIDLTNVIVSGQDNVIIIQKVFG
FT                   DTKVLVPLDVAVKADISSVYGSVQYFDFEEYDLRNESIKLSQEEEYYLLKRVKLVVNTI
FT                   AGKVEVSRK"
FT   gene            340987..342006
FT                   /locus_tag="SAK_0391"
FT   CDS_pept        340987..342006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0391"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45700"
FT                   /protein_id="ABA45700.1"
FT                   /translation="MKKHHYFLAFFYGSVIIFAICFVIIDSLGVNLVHLYQTSRLWLIE
FT                   QLIFSIFFLSLAVTILLLLTWFLLDDNSKRQINHNLRRILNNQSINVTDDGTEISTNIQ
FT                   RLSKKMNLMTASLQSKENSRILKSQEIVKQERKRIARDLHDTVSQDLFAASMVLSGIAQ
FT                   NVSQLDVDQVGSQLLAVEEMLQHAQNDLRILLLHLRPVELENKTLSEGFRMILKELTDK
FT                   SDIEVVYHESILTLPKKIEDNIFRIGQEFISNTLKHSQASRLEVYLNQTENELQLKMID
FT                   NGIGFDMDSVYDLSYGLKNIEDRVEDLAGNLQLLSQPGKGVAMDIRLPLVNQSEDKNG"
FT   gene            341999..342640
FT                   /locus_tag="SAK_0392"
FT   CDS_pept        341999..342640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0392"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45697"
FT                   /protein_id="ABA45697.1"
FT                   /translation="MDKIKIVLVDDHEMVRLGLKSFLNLQADVEVIGEASNGLEGIKKA
FT                   LELRPDVVVMDLVMPEMDGVEATLALLKDWPEAAILVLTSYLDNEKIYPVIEAGAKGYM
FT                   LKTSSAAEILNAIRKVSRGEQAIENEVDKKIKAHDKCPALHEGLTARERDILNLLAKGY
FT                   DNQRIADELFISLKTVKTHVSNILGKLNVADRTQAVVYAFQHHLVPQDDE"
FT   gene            342682..344082
FT                   /locus_tag="SAK_0393"
FT   CDS_pept        342682..344082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0393"
FT                   /product="Cof-like hydrolase/peptidyl-prolyl cis-trans
FT                   isomerase domain protein"
FT                   /note="identified by match to protein family HMM PF00160;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45069"
FT                   /protein_id="ABA45069.1"
FT                   /translation="MDAKTKYKAKKIKAVFFDIDDTLRVKDTGYMPPSILKVFKALKDK
FT                   GIVVGIASGRARYGVPKEVQDLNADYCVKLNGAYVKDKDKNIIFHRPIPAEYVEQYKKW
FT                   ADTVGIKYGLAGRHEAVLSDRDDLVNDAIDIVYSDLEVNPDFNKEHDIYQMWTFEDKGD
FT                   SLHLPEPLAEHLRLIRWHDHSSDVVLKGTSKALGVSKVVEHLGLKPENILVFGDELNDL
FT                   ELFDYAGLAVAMGVSHPEAQKKADFITKKVEEDGILYALEELGLIEKELTFPQVDIENT
FT                   EGPVAVIKTNHGDMTVKLFPDHAPKTVANFIGLAKQGYYDGIIFHRIIPDFMIQGGDPT
FT                   GTGMGGESIYGESFEDEFSEELYNVRGALSMANAGPNTNGSQFFIVQNTKIPYAKKELE
FT                   RGGWPTPIAELYAGQGGTPHLDRRHSVFGQLVDQSSFEVLDEIAAVETGSQDKPLEDVV
FT                   ILTIEVKE"
FT   gene            344066..344440
FT                   /locus_tag="SAK_0394"
FT   CDS_pept        344066..344440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0394"
FT                   /product="general stress protein, putative"
FT                   /note="identified by similarity to SP:P80870; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46329"
FT                   /protein_id="ABA46329.1"
FT                   /translation="MRLKNKMKIGDKLKGTVTGIRPYGAFVSLEDGRTGLIHISEIKTG
FT                   YIDNIYDVLSVGDEVYVQVIDVDEFTQKASLSLRTLEEERHHIQHRHRFSNNRLKIGFK
FT                   PLEENLPSWVEEGLAYLNNK"
FT   gene            complement(344487..345263)
FT                   /locus_tag="SAK_0395"
FT   CDS_pept        complement(344487..345263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0395"
FT                   /product="pyruvate formate-lyase-activating enzyme,
FT                   putative"
FT                   /note="identified by similarity to SP:Q46267; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR02494"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44943"
FT                   /protein_id="ABA44943.1"
FT                   /translation="MTNEKGIVFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCANPESQK
FT                   MVPETMRDAITNESVIVGEEKSVDDIIEEVLKDIDFYEESGGGITLSGGEIFAQFEFAK
FT                   AILKRAKSLGIHTAIETTAYTRHEQFIDLIQYVDFIYTDLKHYNSLKHQEKTMVKNASI
FT                   IKNIHYAFANGKTIVLRIPVIPNFNDSLEDAEEFACLFDRLDIRQVQLLPFHQFGQNKY
FT                   QLLNRQYEMEEIAALHPEDLLDYQAIFSKYNIHCYF"
FT   gene            345384..346139
FT                   /locus_tag="SAK_0396"
FT   CDS_pept        345384..346139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0396"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44535"
FT                   /protein_id="ABA44535.1"
FT                   /translation="MNRLENIISLVSQYQKIDVNTLSELLQVSKVTIRKDLDKLEGKGL
FT                   LHREHGYAVLNSGDDLNVRLSFNHKTKKEIAALAANMVSDNDTILIESGSTCALLAENI
FT                   CQTKRNVTILTNSCFIANYLREYDSCQIVLLGGEYQSSSQVTVGPLLKKMISLFHVSLA
FT                   FVGTDGFDPKLGFMGRDLMRSEVAQEMANAADEVIILTDSSKFNQTALVEQLPLSTVSQ
FT                   VITDKHPNSEIANLFQEAEITIQSLLQVP"
FT   gene            346258..347241
FT                   /locus_tag="SAK_0397"
FT   CDS_pept        346258..347241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0397"
FT                   /product="transcriptional regulator, SorC family"
FT                   /note="identified by match to protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45690"
FT                   /protein_id="ABA45690.1"
FT                   /translation="MKLERQKLLAKVAYLYYMEGKSQSEIANELGIYRTTISRMLAKAR
FT                   EEGLVRIEISDFNPEIFQLESYFKSKYHLKDIEIVSSRKDSDTSEIEKDLAHVAAAMIR
FT                   KKIKENDKVGIAWGRTLSKVVEAMRPHPVSQVSFVPLAGGPSHINARYHVNTLVYEMSR
FT                   RFQGSCTFINATLVQENANLAKGILTSKYFEGLMDNWEKLDVAIVGVGGKPKSNEQQWL
FT                   DLLNQDDFQCLDEEAAVGEITCRFFNHSGDPVNQHLAKRTIGITLEQLQKVPNRIAVAH
FT                   GNYKAAALLAVLKKGYINHLVTDFSTALNILRLDKDTFVDTIYQKS"
FT   gene            347445..347768
FT                   /locus_tag="SAK_0398"
FT   CDS_pept        347445..347768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0398"
FT                   /product="PTS system, IIA component, lactose/cellobiose
FT                   family"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44422"
FT                   /protein_id="ABA44422.1"
FT                   /translation="MEIIVADQIIMGLILNAGDAKQHIYQALKLAKEGNFAESKIEIEL
FT                   ADSALLEAHNLQTQFLAQEAGGTRTDISALFIHSQDHLMTSITEINLIKEIIDLRQELH
FT                   IQK"
FT   gene            347785..348105
FT                   /locus_tag="SAK_0399"
FT   CDS_pept        347785..348105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0399"
FT                   /product="PTS system, IIB component, lactose/cellobiose
FT                   family"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46304"
FT                   /protein_id="ABA46304.1"
FT                   /translation="MIKIGLFCAAGFSTGMLVNNMKIAADKEGIEAHIEAYSQGKIADY
FT                   AKDLDVALLGPQVSYTLDKSKSICDEYGVPIAVIPMADYGMLDGVKVLKLALSLLETRK
FT                   EA"
FT   gene            348107..349408
FT                   /locus_tag="SAK_0400"
FT   CDS_pept        348107..349408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0400"
FT                   /product="PTS system, IIC component, lactose/cellobiose
FT                   family"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46125"
FT                   /protein_id="ABA46125.1"
FT                   /translation="MSKFDSQKIITPIMKFVNMRGIIALKDGMLAILPLTVVGSLFLIL
FT                   GQLPFKGLNQAIANVFGPEWTEPFMQVYSGTFAIMGLISCFAIAYAYAKNSSVEPLPAG
FT                   VLSLSSFFILMKSSYIPVKGEAIADAISKVWFGGQGIIGAIIIGLVVGAIYTWFIQHHI
FT                   VIKMPEQVPQAIAKQFEAMIPAFVIFLLSMIVYLIAKVTTGGTFIEMIYDIIQVPLQGL
FT                   TGSLYGAIGIAFFISFLWWFGVHGQSVVNGIVTALLLSNLDANKSLLAANRLTLDNGAH
FT                   IVTQQFLDSFLILSGSGITFGLVIAMLFAAKSKQYKALGKVAAFPAIFNVNEPIVFGFP
FT                   IVMNPVMFLPFILVPVLAALIVYGAIAVGFMQPFSGVTLPWSTPAIISGFMVGGWQGAL
FT                   VQIVILAISTAVYFPFFKIQDNITYKNECEMERG"
FT   gene            349589..352045
FT                   /locus_tag="SAK_0401"
FT   CDS_pept        349589..352045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0401"
FT                   /product="formate acetyltransferase 2"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01774"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45174"
FT                   /protein_id="ABA45174.1"
FT                   /translation="MTKQLLTQKYTNDVQQNSQKHFGYLTERMYSYRDKVLDKKPFIDA
FT                   ERAILVTEAYQKHQEKPNVLKRAYMLQNILEKMTIYIDDETMIVGNQASSDKDAPIFPE
FT                   YTLEFVVNELDLFEKRDGDVFYITEETKEQIRNIAPFWENNNLRARAGVMLPEEVQVYM
FT                   ETGFFGMEGKMNSGDAHLAVNYQKLLEEGLIGFEKKARKAKADLDLTKPESIDKYHFYD
FT                   SILITIEAVKTYAERFAILAKKQAKTANAKRRQELLDIASICERVPYYPAETFAEAVQS
FT                   VWFIQCILQIESNGHSLSYGRFDQYMYPYVKSDLEAGRETEDSIVERLTNLWIKTITIN
FT                   KVRSQAHTFSSAGSPLYQNVTIGGQTRHKEDAVNPLSFLVLKSVAQTHLPQPNLTVRYH
FT                   ANLDKSFMNEAIEVMKLGFGMPAFNNDEIIIPSFIKKGVSEEDAYDYSAIGCVETAVPG
FT                   KWGYRCTGMSYINFPKVLLITMNDGIDPASGKRFAPSYGHFTQMTSYKELKEAWDKTLR
FT                   YLTRMSVIVENAIDISLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIAN
FT                   LSDSLAALKKLVFEEKRLTTLEVWQALQSDYAGPRGEEIRQMLINEAPKYGNDDDYADS
FT                   LVRECYDVYVEEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRHAGTP
FT                   LAEGCSPSHNMDKKGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKQKLIALL
FT                   RTFFNRLHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIA
FT                   RTEHAL"
FT   gene            352055..352723
FT                   /locus_tag="SAK_0402"
FT   CDS_pept        352055..352723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0402"
FT                   /product="transaldolase, putative"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46041"
FT                   /protein_id="ABA46041.1"
FT                   /translation="MEFLLDTLNLEAIKKWHHILPLAGVTSNPTIAKKEGDIHFFQRIR
FT                   DVREIIGREASLHVQVVAKDYQGILDDAAKIRQETDDDIYIKVPVTPDGLAAIKTLKAE
FT                   GYNITATAIYTSMQGLLAISAGADYLAPYFNRMENLDIDATQVIKELAQAIERTGSSSK
FT                   ILAASFKNASQVTKALSQGAQSITAGPDIFESVFAMPSIAKAVNDFADDWKASQHSEHI
FT                   "
FT   gene            352791..353879
FT                   /gene="gldA"
FT                   /locus_tag="SAK_0403"
FT   CDS_pept        352791..353879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="SAK_0403"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by similarity to SP:P32665; match to
FT                   protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44884"
FT                   /protein_id="ABA44884.1"
FT                   /translation="MKVFASPSRYIQGKDALFQSIEHIKSLGQTPLILCDDVVYNIVGE
FT                   RFLSYLQDDLLPHRVSFNGEASDNEINRVVAVAKEKNSDLIIGLGGGKTIDSAKAIADK
FT                   VNLPVVIAPTVASTDAPTSALSVIYTDEGAFEKYIFYSKNPDLVLVDTQVIAQAPKRLL
FT                   ASGIADGLATWVEARAVLQKNGIAMAGGRQTLAGVAIAQACERTLFNDSLQALAACDAK
FT                   VVTKALENVIEANTLLSGLGFESAGLAAAHAIHNGFTALSGDIHHLTHGEKVAYGTLTQ
FT                   LFLENRPKEEIDRYINLYQAIGMPTTLAELHLGDATYEELLKVGQQATIEGETIHEMPF
FT                   KISAEDVAAALLTVDRYVSNHQ"
FT   gene            complement(354031..354957)
FT                   /locus_tag="SAK_0404"
FT   CDS_pept        complement(354031..354957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0404"
FT                   /product="cysteine synthase/cystathionine beta-synthase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45097"
FT                   /protein_id="ABA45097.1"
FT                   /translation="MSKIYNSITDLIGNTPIIQLHHIVPEGAAEVYVKLESFNPGSSVK
FT                   DRIALAMIEDAEQKGILKAGDTIVEPTSGNTGIGLAWVGKAKGYNVIIVMPETMSIERR
FT                   KIIQAYGAQLVLTPGSEGMKGAIAKAKEISAEQNAWLPLQFNNQANPEIHEKTTGREII
FT                   ETFGEKGLDAFIAGVGTGGTITGVSRALKKVNPDVAIYAVEADESAILSGEQPGPHKIQ
FT                   GISAGFIPETLATDSYDHIIRVTSDDAIETGRIIGGLEGFLAGISASAAIYAAIEVAKQ
FT                   LGKGKKVLALLPDNGERYLSTSLYDFE"
FT   gene            complement(355048..355692)
FT                   /locus_tag="SAK_0405"
FT   CDS_pept        complement(355048..355692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0405"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /note="identified by similarity to GB:AAN58242.1; match to
FT                   protein family HMM PF01205; match to protein family HMM
FT                   TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44714"
FT                   /protein_id="ABA44714.1"
FT                   /translation="MNYKTIKSDGIVEEEIKKSRFICHLKRVESEEEGRNYITQIKKAH
FT                   YKANHSCSAMVIGEKGDIKRSSDDGEPSGTAGIPMLTVLEKQGLTNVVAVVTRYFGGIK
FT                   LGAGGLIRAYSGSVANTIKEIGVVEVKEQIGIRIQLTYPQYQTFDNFLKEHHLQEFETE
FT                   FLEAVTCKIYVDPKEFEHTITNLTEFYQGKALLTEEGSQIVEIPFKAETDK"
FT   gene            355748..357037
FT                   /locus_tag="SAK_0406"
FT   CDS_pept        355748..357037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0406"
FT                   /product="competence protein ComFA, putative"
FT                   /note="identified by similarity to SP:P39145; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45650"
FT                   /protein_id="ABA45650.1"
FT                   /translation="MENYLGRLWTKAQLSEQLRKIAISLPSFIKKGSDYICTRCSSSVA
FT                   KNCQLPTGNYYCRECIVFGRVTSNENLYYFPQKTFSKTNSLKWKGELTPYQNEVSEELL
FT                   KGISSKENLLVHAVTGAGKTEMIYHSVAKVIDTGGSVCIASPRIDVCLELYKRLSNDFR
FT                   CAITLMHGESPSYQRSPLTIATTHQLLKFYHAFDLLIVDEVDAFPYVDNPILYQGVKQA
FT                   LKENGTSIFLTATSTTELERKVARKELKKLHLARRFHANPLVIPEMVWVSGIQKSLQTQ
FT                   KLPPKLYQLINKQRQTRYPLLLFFPHISEGQVFTEILRQAFPMEKIGFVSSKSTSRLKL
FT                   VQDFRDNKLSILVSTTILERGVTFPSVDVFVIQANHHLFTKSSLVQISGRVGRALERPE
FT                   GLLYFLHDGKSKSMHQAIKEIKNMNHIGGF"
FT   gene            357037..357702
FT                   /locus_tag="SAK_0407"
FT   CDS_pept        357037..357702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0407"
FT                   /product="competence protein ComFC, putative"
FT                   /note="identified by similarity to SP:P39147"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45065"
FT                   /protein_id="ABA45065.1"
FT                   /translation="MTCLLCHEIDLSQLTFVELMLLKPKQNVICQTCKGSFEALSREMG
FT                   CQTCCKQIPQKQCQDCIYWGKKGIEVNHFSLYRYNEAMKKYFSLFKFQGDYLLKDVFTK
FT                   EIKAALKKYKGYTIVPVPLSHEGYQNRQFNQVIAFLQSANIPYKNILSKKDGGKQSANN
FT                   KEERLKQVQQFTLKNEAELGDNLLIVDDIYTTGATIAQIRKLLEEKGIKNIKSFSLAR"
FT   gene            357779..358333
FT                   /gene="yfiA"
FT                   /locus_tag="SAK_0408"
FT   CDS_pept        357779..358333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="SAK_0408"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45604"
FT                   /protein_id="ABA45604.1"
FT                   /translation="MIKYSIRGENIEVTEAIREYVETKLSKVEKYFNEAQELDTRVNLK
FT                   VYREKTAKVEVTILIDSITLRAEDVSQDMYGSIDLVVDKIERQIRKNKTKIAKKYREKI
FT                   PASQVFTTEFEAEPDEEAVSQRIVRTKNVNLKPMDVEEALLQMELLGHDFFIYTDAEDN
FT                   TTNVLYKREDGELGLIEAKGN"
FT   gene            358663..360169
FT                   /gene="rrsF"
FT                   /locus_tag="SAK_0409"
FT   rRNA            358663..360169
FT                   /gene="rrsF"
FT                   /locus_tag="SAK_0409"
FT                   /product="16S ribosomal RNA"
FT   gene            360259..360331
FT                   /locus_tag="SAK_0410"
FT   tRNA            360259..360331
FT                   /locus_tag="SAK_0410"
FT                   /product="tRNA-Ala"
FT   gene            360486..363388
FT                   /gene="rrlF"
FT                   /locus_tag="SAK_0411"
FT   rRNA            360486..363388
FT                   /gene="rrlF"
FT                   /locus_tag="SAK_0411"
FT                   /product="23S ribosomal RNA"
FT   gene            363463..363578
FT                   /gene="rrfF"
FT                   /locus_tag="SAK_0412"
FT   rRNA            363463..363578
FT                   /gene="rrfF"
FT                   /locus_tag="SAK_0412"
FT                   /product="5S ribosomal RNA"
FT   gene            363584..363657
FT                   /locus_tag="SAK_0413"
FT   tRNA            363584..363657
FT                   /locus_tag="SAK_0413"
FT                   /product="tRNA-Asn"
FT   gene            complement(363873..365225)
FT                   /locus_tag="SAK_0414"
FT   CDS_pept        complement(363873..365225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0414"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44712"
FT                   /protein_id="ABA44712.1"
FT                   /translation="MKVVKFGGSSLASSQQLYKVLNIIKSDYTRRFVVVSAPGKRYEED
FT                   LKMTDALIQYYQNYINGKDIVKDQTWIINRYQEIISDLSLGSTIAEEITRSIEQLASLP
FT                   IENNQFLYDCFLAAGEDNNAKLVATFFNQNDIPARYVHPNEAGIIVTKEPCNARIIPGS
FT                   YDKIENLCLYNEVLVIPGFFGVTEDNQICTFSRGGSDITGSLIAAGIKADLYENFTDVD
FT                   GIFAAHPGVVKNPHAIPELTYKEMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPQ
FT                   QPGTKIVLKHTRSNIAVTGIASDSRFASINVSKYLMNREVGFGRKVLQILEDLNISFEH
FT                   MPTGIDDLSIVLREKELTPIKEQEILNYLTRKLEVDYVDIQHNLSTIVIVGENMKSQIG
FT                   VTATATQALSREKINITMISQGSSEVSIMFVINSKDEKRAIKALYETFFQK"
FT   gene            365319..365969
FT                   /locus_tag="SAK_0415"
FT   CDS_pept        365319..365969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0415"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45324"
FT                   /protein_id="ABA45324.1"
FT                   /translation="MCKYKAIIFDMDGVLFDTELFYYKRRERFLKQHGITIDHLPMNFF
FT                   IGGNMKQVWKSVLGDQYDTWDIDKLQQDYSRYKEDNPLPYKDLIFQDCKRVIEKLHHKG
FT                   YLLGLASSSTRHDIMLALESFNLDTYFKVILSGEEFSESKPNPAIYNRAAELLDIPKQQ
FT                   ILIVEDSEKGITAGIAAGIDVWAIEDKYFGMNQSQANVLVSDLSQFFVKLDNY"
FT   gene            366106..366897
FT                   /locus_tag="SAK_0416"
FT   CDS_pept        366106..366897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0416"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46212"
FT                   /protein_id="ABA46212.1"
FT                   /translation="MKFENIIYGIDGNVATIMLNRPDISNGFNIPMCQEIIDAIRLVSE
FT                   NKDVMFLVIEAQGPIFSIGGDLKVMKAAVESDDISSLTKIAELVNQISYDLLQLEKPVV
FT                   MCVDGAVAGAAANIALAADFVIASKKSKFIQAFVGVGLAPDAGGLLLLSKSIGITRAVQ
FT                   LALTGESLSAEKAEALGIVYKLCESDKIGKIKDQLLKRLSRHSINSYQAIKSLAWEAAF
FT                   KDWEQYKKLELQLQESLAFKQDFKEGVRAHADRRRPNFLGK"
FT   gene            366993..367427
FT                   /locus_tag="SAK_0417"
FT   CDS_pept        366993..367427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0417"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44667"
FT                   /protein_id="ABA44667.1"
FT                   /translation="MEYDQINSYLVDIFNRIMIIEEMSLKTSQFSDVSLKEMHTIEIIG
FT                   KHSEVTPSDVARELMLTLGTVTTSLNKLEKKGYIERKRSSIDRRVVHLSLTKRGRLLDR
FT                   LHSKFHKSMVSHIIEDLGEEDIKMLTSALGNLHKFLEDLV"
FT   gene            367427..368398
FT                   /gene="fabH"
FT                   /locus_tag="SAK_0418"
FT   CDS_pept        367427..368398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SAK_0418"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to GB:AAK91994.1; match to
FT                   protein family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45442"
FT                   /db_xref="GOA:Q3K338"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K338"
FT                   /protein_id="ABA45442.1"
FT                   /translation="MVFAKISQLAHYAPSQIIKNEDLSLIMDTSDDWISSRTGIKQRHI
FT                   SKNETTADLANKVAEQLIEKSGYSASQIDFIIVATMTPDSMMPSTAARVQAHIGASNAF
FT                   AFDLSAACSGFVFALSTAEKLISSGSYQKGLVIGAETVSKVLDWTDRGTAVLFGDGAGG
FT                   VLLEASKEKHFLAESLNTDGSRQGLQSSQVGLNSPFSDEVLDDKFLKMDGRAIFDFAIK
FT                   EVSKSINHLIETSYLEKEDIDYLFLHQANRRILDKMSRKIDIARDKFPENMMDYGNTSA
FT                   ASIPILLSESYENGLLKLDGNQTILLSGFGGGLTWGSLIVKI"
FT   gene            368456..368680
FT                   /gene="acpP"
FT                   /locus_tag="SAK_0419"
FT   CDS_pept        368456..368680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SAK_0419"
FT                   /product="acyl carrier protein"
FT                   /note="identified by similarity to SP:P20804; match to
FT                   protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44876"
FT                   /protein_id="ABA44876.1"
FT                   /translation="MAVFEKVQEIIVEELGKDAEEVTLNTTFDDLDADSLDVFQVISEI
FT                   EDAFDIQIETEEGLNTVGDLVAYVEEKVK"
FT   gene            368835..369794
FT                   /gene="fabK"
FT                   /locus_tag="SAK_0420"
FT   CDS_pept        368835..369794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="SAK_0420"
FT                   /product="enoyl-(acyl-carrier-protein) reductase II"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by similarity to GB:AAF98273.1; match to
FT                   protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46051"
FT                   /protein_id="ABA46051.1"
FT                   /translation="MKTRITELLNIKYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSMTDKPFGVNIMLLSPFVDDIVDLVIEEGVKVVTTGAGNPGKYME
FT                   RFHEAGITVIPVVPSVALAKRMEKLGADAIITEGMEAGGHIGKLTTMTLVRQVVDAVTI
FT                   PVIAAGGIADGRGAAAGFMLGADAVQVGTRFVVAKESNAHPNYKAKILKAKDIDTAVSA
FT                   QVVGHPVRALKNKLVTTYSQAEKDYLAGRISINEIEELGAGALRNAVVDGDVINGSVMA
FT                   GQIAGLIKSEETCQEILEDIYSGARQVILSEASRWSDL"
FT   gene            369814..370740
FT                   /gene="fabD"
FT                   /locus_tag="SAK_0421"
FT   CDS_pept        369814..370740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SAK_0421"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by similarity to SP:P25715; match to
FT                   protein family HMM PF00698; match to protein family HMM
FT                   TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45740"
FT                   /protein_id="ABA45740.1"
FT                   /translation="MNKVAFLFAGQGAQKLGMARDLYETFPIVKETFDKASHVLGYDLR
FT                   ELIDKDLDKLNQTKYTQPAILTTSTAIYRLILKEIELRPDMVAGLSLGEYSALVASGAI
FT                   RFEDAVVLVARRGQLMEAAAPAGSGKMVAVLNADRQIIEDACKKASQFGIVSPANYNTP
FT                   KQIVIGGESIAVNAAVEELKQQGVKRLIPLNVSGPFHTALLKPASQKLSDVLDKVHFSV
FT                   SEIPVIGNTEAQIMKKDDIKSLLARQVMEPVRFDESIETMKKMGMTQVVEIGPGKVLSG
FT                   FLKKIDSSLSVHSVEDKIGFNNLKELN"
FT   gene            370749..371483
FT                   /gene="fabG"
FT                   /locus_tag="SAK_0422"
FT   CDS_pept        370749..371483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SAK_0422"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45906"
FT                   /protein_id="ABA45906.1"
FT                   /translation="MQLKDKNIFITGSSRGIGLAIAHQFAQLGANIVLNGRSEISEDLI
FT                   AEFADYGVKVIAISGDVSSFEDANRMIKEAIASLGSVDVLVNNAGITNDKLMLKMTVED
FT                   FESVLKINLTGAFNMTQSVLKPMTKARQGAIINISSVVGLTGNVGQANYAASKAGLIGF
FT                   TKSVAREVAARGIRVNAIAPGFIESDMTDVIPEKMQEAILAQIPMKRIGKGKEVAQVAS
FT                   FLAEQEYLTGQVIAIDGGMTMQ"
FT   gene            371499..372731
FT                   /gene="fabF"
FT                   /locus_tag="SAK_0423"
FT   CDS_pept        371499..372731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SAK_0423"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P73283; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45043"
FT                   /protein_id="ABA45043.1"
FT                   /translation="MTLQRVVVTGYGVTSPIGNTPEEFWNSLKEGNVGIGPITKFDSSD
FT                   FMVKNAAEIHDFPFDKYFVKKDLNRFDMYSLYALYASSEAIQHANLNLDEIDADRFGVI
FT                   VASGIGGIQEIEEQVIRLHEKGPKRVKPMTLPKALPNMAAGNVAMRLGAHGVCKSINTA
FT                   CASSNDAIGDAFRNIKFGIQDIMVVGGAEAAITKFAIAGFQSLTALSTTEDPSRASIPF
FT                   DKDRNGFIMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGLGATK
FT                   AIQLALVEANIKPEEVNYVNAHGTSTPANEKGESQAIVAALGTDVPVSSTKSFTGHLLG
FT                   AAGAVEAIATIEAIRHSYVPMTAGTTELSEDITANVIFGQGQDADIRYAISNTFGFGGH
FT                   NAVLAFKRWED"
FT   gene            372733..373233
FT                   /gene="accB"
FT                   /locus_tag="SAK_0424"
FT   CDS_pept        372733..373233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SAK_0424"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="identified by similarity to SP:Q06881; match to
FT                   protein family HMM PF00364; match to protein family HMM
FT                   TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45531"
FT                   /protein_id="ABA45531.1"
FT                   /translation="MDIQEIKDLMTQFDESSLREFSFKTSDGELSFSKNEGKAPLVPTM
FT                   SPMSHQPEATPTIATPVSNEAGEQTKQATEVVSEIPESTVTVAEGDVVESPLVGVAYLA
FT                   SGPDKPNFVSVGDSVKKGQTLMIIEAMKVMNEVPAPHDGVVTEILVANEEVIEFGKGLV
FT                   RIK"
FT   gene            373230..373652
FT                   /gene="fabZ"
FT                   /locus_tag="SAK_0425"
FT   CDS_pept        373230..373652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SAK_0425"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM PF07977; match to protein
FT                   family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45360"
FT                   /db_xref="GOA:Q3K331"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K331"
FT                   /protein_id="ABA45360.1"
FT                   /translation="MIDIKEIREALPHRYPMLLVDRVLEVSEDEIVAIKNVSINEPFFN
FT                   GHFPEYPVMPGVLIMEALAQTAGVLELSKEENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TAKFVKRRGTIAVVEAIAEVDGKLAASGTLTFAIGN"
FT   gene            373690..375060
FT                   /gene="accC"
FT                   /locus_tag="SAK_0426"
FT   CDS_pept        373690..375060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SAK_0426"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="also 6.3.4.14 for individual subunit; identified by
FT                   match to protein family HMM PF00289; match to protein
FT                   family HMM PF02785; match to protein family HMM PF02786;
FT                   match to protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45509"
FT                   /protein_id="ABA45509.1"
FT                   /translation="MFKKILIANRGEIAVRIIRAAREMGISTVAIYSEADKESLHTILA
FT                   DEAICVGPAKSAESYLNVNAILSAAIVTGAEAVHPGFGFLSENSKFATMCEEMNLKFIG
FT                   PSGEVMDKMGDKINARTEMIKADVPVIPGSDGQVTSVEEAVSIAEEIGYPLMLKASAGG
FT                   GGKGIRKVKSADELKPAFESASQEALAAFGNGAMYIEKVIYPARHIEVQILGDSFGKIV
FT                   HLGERDCSLQRNNQKVLEESPSVAIGNTLRQQIGEAAVRAAEAVSYENAGTIEFLLDEN
FT                   SGQFYFMEMNTRVQVEHPVTEFVTGVDIVKEQIRIAAGIPLSVSQNDIKLTGHAIECRI
FT                   NAENPQFNFAPCPGTINGLHLPAGGMGLRVDSAVYTGYTIPPYYDSMIAKVIVHGENRF
FT                   DALMKMQRALYELEIDGIVTNTEFQMDLISDKKVLAGDYDTSFLMEDFLPRYYGNNQ"
FT   gene            375069..375944
FT                   /gene="accD"
FT                   /locus_tag="SAK_0427"
FT   CDS_pept        375069..375944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SAK_0427"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44624"
FT                   /protein_id="ABA44624.1"
FT                   /translation="MALFSKKDKYIRISPNKALGSSDKRSLPEVPDELFAKCPSCKHMI
FT                   YQKDLGLAKICPACSYNFRISAQERLLLTVDEDSFEELFTGIETKDPLNFPNYREKLAA
FT                   TRQKTNLDEAVVTGLAKIKGQTTALAIMDSHFIMASMGTVVGEKLTRLFELATEKKLPI
FT                   VIFTASGGARMQEGIMSLMQMAKVSAAVKRHSNQGLFYLTILTDPTTGGVTASFAMEGD
FT                   IILAEPQALVGFAGRRVIETTVREDLPEGFQKAEFLLEHGFVDAIINRTELRDCIAQLI
FT                   AFHGNEVGHE"
FT   gene            375937..376710
FT                   /gene="accA"
FT                   /locus_tag="SAK_0428"
FT   CDS_pept        375937..376710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SAK_0428"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45637"
FT                   /protein_id="ABA45637.1"
FT                   /translation="MNNDVTRILKDARDQGRLTALDYAELIFDNFMELHGDRQFADDKS
FT                   IIGGLGYLAGRPVTIVGIQKGKNLQDNLDRHFGQPHPEGYRKALRLMKQAEKFGRPVIT
FT                   FINTAGAYPGVGAEERGQGEAIARNLLEMSDLKVPIIAIIIGEGGSGGALALAVADKVW
FT                   MLEHTVYSILSPEGFASILWKDGTRTTEAAQLMKMTAGELYHMEVVDKVIPEHGYFSSE
FT                   IVDMIKTSLISELEVLSQLSLEDLLEQRYQRFRKY"
FT   gene            377180..377812
FT                   /locus_tag="SAK_0429"
FT   CDS_pept        377180..377812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN59530.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44770"
FT                   /protein_id="ABA44770.1"
FT                   /translation="MYQELNDYLEFQSMKYIMPEKAGPLKDDMQTFKAKGQLARNSFTE
FT                   LSRALEQRMDGFKMQRVSNWANQAQVGRPHFWVYYRKDTDQLDDVAVALRVYGVKDSFG
FT                   VSLEVSFVERQKSDKTLEKQARVLSIPIASPLYFMVQRQGETHREEGNEENRQRLMQEI
FT                   KSGKVRKVLVKYDVLLTENQSLENILQRLLEGFEKVLPYYQVCQTIS"
FT   gene            complement(377858..379135)
FT                   /gene="serS"
FT                   /locus_tag="SAK_0430"
FT   CDS_pept        complement(377858..379135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SAK_0430"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by similarity to SP:P95689; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF02403; match to protein family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45625"
FT                   /db_xref="GOA:Q3K326"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K326"
FT                   /protein_id="ABA45625.1"
FT                   /translation="MLDLKRIRTDFDVVAKKLATRGVDQETLTTLKELDIKRRELLIKA
FT                   EEAKAQRNVASAAIAQAKRNKENADEQIAAMQTLSADIKAIDAELADVDANLQSMVTVL
FT                   PNTPADDVPLGADEDENVEVRRWGTPREFDFETKAHWDLGESLGILDWERGAKVTGSRF
FT                   LFYKGLGARLERAIYSFMLDEHAKEGYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELAD
FT                   SPFVLIPTAEVPLTNYYRDEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKPEESYQELEKMTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDLEVWI
FT                   PAQNTYREISSCSNTEDFQARRAQIRYRDEVDGKVRLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEVLRPYMGNIDIIKPN"
FT   gene            379501..380493
FT                   /locus_tag="SAK_0431"
FT   CDS_pept        379501..380493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0431"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44445"
FT                   /protein_id="ABA44445.1"
FT                   /translation="MFMIVITHVLGKGGLRSSVEGHADSYFIVTWIIQVLVYGAVNCYA
FT                   LISGYVGINSRYRYSKLLSIWAQVFFYTFTITALFAITGHEVTLLNWRDAFFPIVSGQY
FT                   WYITAYFGLLVFMPVINNGLNALTDKQLKQLVLLMFIIFSILPAVLNNRVPEFSLSKGF
FT                   EMTWLLILYIIGAYLKRIDLNIFKTSYLLIIYLLSLVATYAMKFSVGDIWYWYVSPTLT
FT                   LGAVSLFILFARASIKPSGFLKKIIVVLAPSTLGVYLCHLHPLIVKYFVRDFAETFVYE
FT                   SIYLYPFLILGAGILIYLLAFIVERIRLRIFKAIHFSNFLRWFDDKFPY"
FT   gene            complement(380531..380833)
FT                   /locus_tag="SAK_0432"
FT   CDS_pept        complement(380531..380833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45506"
FT                   /protein_id="ABA45506.1"
FT                   /translation="MGNKVGKFLVGDQALEFYNDKNVNDYIQIPWTSINQIGANVSRKK
FT                   ISRHFEVFTDQGKFLFASKDSGTILKHARRHIGDDKVVKLPTLIQTILKIFKFKK"
FT   gene            complement(381012..381923)
FT                   /locus_tag="SAK_0433"
FT   CDS_pept        complement(381012..381923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0433"
FT                   /product="PTS system, IID component,
FT                   mannose/fructose/sorbose family"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46216"
FT                   /protein_id="ABA46216.1"
FT                   /translation="MTEQIKLSKSDRQKVWWRSQFLQGSWNYERMQNMGWAYALIPALK
FT                   KLYTTKEDRAAALERHMEFFNTHPYVAAPIIGVTLALEEEKASGTPVEDKAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGALGASLASAGNILGPIIFFVGWNLIRMSFLWYTQELGY
FT                   KSGKEITKDMSGGILQDITKGASILGMFILAVLVKRWVAINFTVDLPKKTLSEGAYINF
FT                   PKDHVSGQQLHDILGQVQSGLSLDKMQPQTLQGQLDSLIPGLAGLLLTFFCMWLLKKKV
FT                   SPITIIIGLFIVGILARLAGVM"
FT   gene            complement(381938..382750)
FT                   /locus_tag="SAK_0434"
FT   CDS_pept        complement(381938..382750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0434"
FT                   /product="PTS system, IIC component,
FT                   mannose/fructose/sorbose family"
FT                   /note="identified by similarity to SP:P08187; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45300"
FT                   /protein_id="ABA45300.1"
FT                   /translation="MADISIISMILVVIVAFFAGLEGILDQFQIHQPLVACTLIGLVTG
FT                   HLEAGIILGGSLQMIALAWANIGAAVAPDAALASVAAAIILVKSGDFTQKGINFAFSTA
FT                   VPLAIAGLFLTMIVRTISTALVHAGDKAASEGNFAAIERFHFIALLLQGLRIAFPAALL
FT                   LAIPSSSVQSILEAMPDWLNGGMQVGGAMVVAVGYAMVINMMATREVWPFFALGFALAA
FT                   LNQLTLIAMGTIGVAIALIYISLSKMGGSKGTSNAGSNDPIGDILEDY"
FT   gene            complement(382783..383793)
FT                   /locus_tag="SAK_0435"
FT   CDS_pept        complement(382783..383793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0435"
FT                   /product="PTS system, IIAB component,
FT                   mannose/fructose/sorbose family"
FT                   /note="identified by similarity to SP:P08186; match to
FT                   protein family HMM PF03610; match to protein family HMM
FT                   PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46052"
FT                   /protein_id="ABA46052.1"
FT                   /translation="MGIGIIIASHGKFAEGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YGHFNNAIAQFDADDEVLVLADLWSGSPFNQASRVMGENPERKMAIITGLNLPMLIQAY
FT                   TERMMDANAGVEQVAANIIKESKEGIKALPEELNPVVEATPVAGVPADVPAEVKQSGSI
FT                   PEGTVIGDGKLKINLARIDTRLLHGQVATAWTPASKANRIIVASDEVSKDELRKQLIKQ
FT                   AAPGGVKANVVPISKLIEVAKDPRFGNTRALILFETVQDALRAIEGGVEIPELNVGSMA
FT                   HSTGKTMVNNVLSMDKDDVAAFEKLRDLGVSFDVRKVPNDAKKNLFDLINKANVK"
FT   gene            complement(384095..384907)
FT                   /locus_tag="SAK_0436"
FT   CDS_pept        complement(384095..384907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0436"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44701"
FT                   /protein_id="ABA44701.1"
FT                   /translation="MTKKIIAVDLDGTLLHNNNTISDYTADTLRKVQAQGHKVIITTGR
FT                   PYRMALAHYLRLDLKTPMINFNGALTHIPEKKWAFERSATIDKKLLLETLNLSDAIQAD
FT                   FIASEYRKNFYITMDNRDKINPQLFGVNEITDKMALDVTKITRNPNALLMQTRHKDKYE
FT                   LAKELRQHFNHELEVDSWGGPLNILEFSPKGVNKAYALKHLLKSLNFSQENLIAFGDEH
FT                   NDTEMLAFAHTGYAMKNANPTLLPYADQQIQWTNEEDGVAKTLEKLLL"
FT   gene            384996..385580
FT                   /locus_tag="SAK_0437"
FT   CDS_pept        384996..385580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0437"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45829"
FT                   /protein_id="ABA45829.1"
FT                   /translation="MKKLIWSHLFAIVSILGIWYYHVKIDHLMVILLASVLSLEMGFIA
FT                   YYSRNIFIRLLASLGLLFFYPQSLGIFLSLVSLEWSTKDIWQSNHFMQYMAYLLAILFI
FT                   ISSALLSLKLLVNAYDISKRYQLATVIPVMLFSSFAFCLEKSGSLGLEGIILNPSAFFN
FT                   GIQTNMANLDFKALSCLFLVQLLLWGILMED"
FT   gene            385670..386281
FT                   /locus_tag="SAK_0438"
FT   CDS_pept        385670..386281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0438"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07099"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44399"
FT                   /protein_id="ABA44399.1"
FT                   /translation="MKVKLFAIHLFFIVISFGIKYYHLQGPNLIWNMTLALIALDFAYL
FT                   TSLFKKKILIGLFALAWFFFYPNTFYMLTDIIHMHFVGDVLYNKTNLILYILYVSSILF
FT                   GFLSGIESFSVIMRKFRISNIFLRWGIIGIVSFVSSFGIHIGRYARLNSWDILTKPQVV
FT                   INELLAVPSRDSFHFILGFTFLQVLCLIFMDYSAGKKLEK"
FT   gene            386573..387805
FT                   /locus_tag="SAK_0439"
FT   CDS_pept        386573..387805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0439"
FT                   /product="purine transporter, AzgA family"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46215"
FT                   /protein_id="ABA46215.1"
FT                   /translation="MAFYANLPYAQAPGMGLNAFFTYTVVFALGYTWQEALAMVFICGL
FT                   ISLIITLTKVRKMIIESIPTTLKSAITAGIGTFLAYVGIKNAGFLKFSIDPGTYDVVGK
FT                   GAAKGLATITANSSATPGLVSFDNPAILLSLIGLSITIFFIVKGIRGGIILSILTTTLL
FT                   GILMGVVKLDAINWEATNLSASFRDLKQVFGVALGEKGLISLFSNPSRLPSVLMAILAF
FT                   SLTDIFDTIGTLIGTGEKVGILATTGDNHESKSLDKALYSDLIGTTFGAICGTSNVTTY
FT                   VESAAGIGAGGRTGLTALVVAGLFAISSFFSPLVSIVPSQATAPILVIVGIMMLSNLKD
FT                   IKWDDMSEAIPAFFTSLFMGFTYSITYGIAAGFLTYTLAKVIKGQAKDIHVVLWILDIL
FT                   FILNFISLAIL"
FT   gene            387888..388397
FT                   /locus_tag="SAK_0440"
FT   CDS_pept        387888..388397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0440"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by similarity to GB:AAO80758.1; match to
FT                   protein family HMM PF02367; match to protein family HMM
FT                   TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45377"
FT                   /protein_id="ABA45377.1"
FT                   /translation="MLWGCQNQQTVGRQRYFWYNISMFYTQNEEELIALGQKLGTVLKS
FT                   GDIVLLTGNLGAGKTTLTKGIAKGLDIKQMIKSPTYTIVREYEGRVPLYHLDVYRIGDD
FT                   PDSIDLDDFLFGQGVTVIEWGELLSDNLINNYLEIVITRSNQGRQVQLEAYGHRAREII
FT                   EAIQDV"
FT   gene            388390..388911
FT                   /locus_tag="SAK_0441"
FT   CDS_pept        388390..388911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0441"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44510"
FT                   /protein_id="ABA44510.1"
FT                   /translation="MSKQFAVDFIEASREEASAILEFLNTVTEETDFILHTVSNQLSLS
FT                   EMETFIENTLMTKNCICLIAKLKNKVIGLITIISQSDIEIEHVGDLFIAVQKDYWGYGI
FT                   GHILMEEAIEWASDNDITRRLELSVQGRNERAIHLYQKFGFEIDGLQTRGIKRENGEFL
FT                   DIYRMSKLID"
FT   gene            388920..390227
FT                   /locus_tag="SAK_0442"
FT   CDS_pept        388920..390227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0442"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to SP:Q02115; match to
FT                   protein family HMM PF03816; match to protein family HMM
FT                   TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45648"
FT                   /protein_id="ABA45648.1"
FT                   /translation="MKIWKKITLMFSAIILTTVIALGVYVASAYNFSTNELSKTFKDFK
FT                   LAKSKSHAIEETKPFSILLMGVDTGSEHRKSKWSGNSDSMILVTINPKTNKTTMTSLER
FT                   DVLIKLSGPKNNGQTGVEAKLNAAYASGGAEMALMTVQDLLDINVDYFMQINMQGLVDL
FT                   VNAVGGITVTNKFDFPISIAANEPEYKAVVEPGTHKINGEQALVYSRMRYDDPEGDYGR
FT                   QKRQREVIQKVLKKILALNSISSYKKILSAVSNNMQTNIEISSKTIPNLLAYKDSLEHI
FT                   KSYQLKGEDATLSDGGSYQILTKKHLLAVQNRIKKELDKKRSKTLKTSAILYEDYYGTT
FT                   ASNDSSTYSSTQENNYNTTPYSEAPPSYSGNTTYSSETNQTTHQNYYNSSTPASNYSSN
FT                   TNTGQADSSGSVNNHNGAATPNPNTGTQPVPGQTNP"
FT   gene            complement(390291..390587)
FT                   /locus_tag="SAK_0443"
FT   CDS_pept        complement(390291..390587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58165.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44801"
FT                   /protein_id="ABA44801.1"
FT                   /translation="MKIGRLIALGLVSLGALELYKNRKTIKDSYQNTKNETDSAKLKLE
FT                   RIKNDLAIISQEKEKIRLISQELNHKFQVFNKDIQPRLEEINQRMAKYQEKDE"
FT   gene            complement(390584..391003)
FT                   /locus_tag="SAK_0444"
FT   CDS_pept        complement(390584..391003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0444"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44915"
FT                   /protein_id="ABA44915.1"
FT                   /translation="MDNCIFCKIISGEIPSSKVYEDDEVLAFLDITQTTTGHTLLIPKK
FT                   HVRNVLEMDEKTAQITFERLPKVARAVQAATKAKGMNIINNNEEIAGQTVFHAHVHLVP
FT                   RFDESDGIKIHYTTHEPDFEALAKLAKEIRKEIQL"
FT   gene            391339..391842
FT                   /locus_tag="SAK_0445"
FT   CDS_pept        391339..391842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45067"
FT                   /protein_id="ABA45067.1"
FT                   /translation="MKLNKIILSTAALTALFLGYNSVTADTYNNYQPHRSNNMDLTEEY
FT                   NYNNQIELQERIKKLNIPFKEKLALLRKVKSRQDSYVLDTLRKEVENKNSEYSELEQEY
FT                   QRISALIDAKFPQGKSSLAEKLHKELIWDLDGVKYDEGISKRTALKKLEGKINEYTKKY
FT                   SYLF"
FT   gene            392151..392876
FT                   /gene="ecsA"
FT                   /locus_tag="SAK_0446"
FT   CDS_pept        392151..392876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecsA"
FT                   /locus_tag="SAK_0446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P55339; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46207"
FT                   /protein_id="ABA46207.1"
FT                   /translation="MLKIENVTGGYVNIPVLKNISFEVNDGELVGLIGLNGAGKSTTIN
FT                   EIIGILRPYQGDITIDGISLEADQELYRKKIGFIPETPSLYEELTLREHLETVAMAYDI
FT                   ATDEVMARAQKLLEMFRLTDKLDWFPMHFSKGMKQKVMIICAFVVSPSLFIVDEPFLGL
FT                   DPLAISDLINLLAEEKAKGKSILMSTHVLDSAEKMCDRFVILHKGEIRAVGTLEELRAI
FT                   FGDSNANLNDIYIALTKEV"
FT   gene            392878..393912
FT                   /locus_tag="SAK_0447"
FT   CDS_pept        392878..393912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0447"
FT                   /product="ABC transporter, permease protein EcsB, putative"
FT                   /note="identified by match to protein family HMM PF05975"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44579"
FT                   /protein_id="ABA44579.1"
FT                   /translation="MKKLFNKRRSLFLTQNSKYLRYVFNDHFVLVLMFLSGFLLYQYSQ
FT                   LLKDFPKTHWPIIVIVSIIILMLLAMGGIASYLEPADKQFLLIKEEAIKEIINSAKKRT
FT                   YIFWLVIQTLFLVLISPILIKLGLSVFMITLLIFGLGIIKWLVITYKVKVFYNNQNLNW
FT                   DAAINHEQERKQSILKFFSLFTNVKGISTSVKRRSFLDGILKLISKTPSRLWTNLFVRA
FT                   FLRSSDYLGLTIRLVTLNILSVIFVNETYLALALAFVFNYLLLFQLLALGHHFDYQYMN
FT                   QLYPVRLNAKASQLKGFLRVLSYAVTVIDSILIRELKPVILLIVLMLIVTEYYIPYKIK
FT                   KMID"
FT   gene            393970..394770
FT                   /locus_tag="SAK_0448"
FT   CDS_pept        393970..394770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34472.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45453"
FT                   /protein_id="ABA45453.1"
FT                   /translation="MTISNQELTLTPLRGKSGKAYIGTYPNGERVFVKYNTTPILPALA
FT                   KEQIAPQLLWARRTSNGDMMSAQEWLDGRTLTKEDMGSKQIIHILLRLHKSRPLVNQLL
FT                   QLGYKIENPYDLLMDWEKQTPIQIRENTYLQSIVTELKRSLPEFRTEVATIVHGDIKHS
FT                   NWVITTSGLIYLVDWDSVRLTDRMYDVAYILSHYIPQKHWKDWLSYYGYKDNEKVWSKI
FT                   IWYGQFSYLSQIIKCFDKRDMEHVNQEIYELRKFRELIKKHNAS"
FT   gene            394760..395395
FT                   /gene="trmB"
FT                   /locus_tag="SAK_0449"
FT   CDS_pept        394760..395395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="SAK_0449"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45693"
FT                   /db_xref="GOA:Q3K307"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K307"
FT                   /protein_id="ABA45693.1"
FT                   /translation="MRVRKRKGAEEHLENNPHYVISNPEEAKGRWHEIFGNNNPIHIEV
FT                   GSGKGAFITGMAEQNPDINYIGIDIQLSVLSYALDKVLDSGAKNIKLLLVDGSSLSNYF
FT                   DTGEVDLMYLNFSDPWPKKKHEKRRLTYKTFLDTYKDILPEQGEIHFKTDNRGLFEYSL
FT                   ASFSQYGMTLKQVWLDLHASDYQQNIMTEYERKFSNKGQVIYRVEARF"
FT   gene            395439..395526
FT                   /locus_tag="SAK_0450"
FT   tRNA            395439..395526
FT                   /locus_tag="SAK_0450"
FT                   /product="tRNA-Ser"
FT   gene            395978..396361
FT                   /locus_tag="SAK_0451"
FT   CDS_pept        395978..396361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P59820; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44549"
FT                   /db_xref="GOA:Q3K306"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K306"
FT                   /protein_id="ABA44549.1"
FT                   /translation="MGGDYVLSILIDKPGGITVEDTAQLTDVVSPLLDTIQPDPFPEQY
FT                   MLEVSSPGLERPLKTAEALSNAVGSYINVSLYKSIDKVKIFEGDLLSFDGETLTIDYMD
FT                   KTRHKTVDIPYQTVAKARLAVKL"
FT   gene            396397..397548
FT                   /gene="nusA"
FT                   /locus_tag="SAK_0452"
FT   CDS_pept        396397..397548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SAK_0452"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by similarity to SP:P32727; match to
FT                   protein family HMM PF00013; match to protein family HMM
FT                   TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45901"
FT                   /protein_id="ABA45901.1"
FT                   /translation="MSKEMLEAFRILEEEKHINKEDIIDAVTESLKSAYKRRYGQSESC
FT                   VIEFNEKKADFTVYTVREVVDEVFDSRLEISLKDALAISSAYELGDKIRFEESVTEFGR
FT                   VAAQSAKQTIMEKMRRQMREVTFNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSH
FT                   QDQIPGESFKSHDMIDVYVYKVENNPKGVNVFVSRSHPEFIKRIMEREIPEVFDGTVEI
FT                   MSVSREAGDRTKVAVRSHNSNVDAIGTIVGRGGSNIKKVISNFHPKRVDAKTGLEIPVE
FT                   ENIDVIQWVEDPAEFIYNAIAPAEVDMVLFDDEDTKRATVVVPDSKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEYEKMEAQELQTEEVAQESEVISDKAE"
FT   gene            397570..397866
FT                   /gene="ylxR"
FT                   /locus_tag="SAK_0453"
FT   CDS_pept        397570..397866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylxR"
FT                   /locus_tag="SAK_0453"
FT                   /product="cytosolic protein YlxR"
FT                   /note="identified by similarity to PDB:1G2R; match to
FT                   protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44746"
FT                   /protein_id="ABA44746.1"
FT                   /translation="MAKTKKIPLRKSVVSGEVIDKRDLLRIVKNKEGQVFIDPTGKQNG
FT                   RGAYIKLDNDEAILAKKKRVFDRSFSMEVSDEFYDELLAYVDHKVKRRELGLE"
FT   gene            397859..398161
FT                   /locus_tag="SAK_0454"
FT   CDS_pept        397859..398161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0454"
FT                   /product="ribosomal protein L7Ae family protein"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46168"
FT                   /protein_id="ABA46168.1"
FT                   /translation="MNNSEKVLNLIGLAQRAGRLITGEELVIKAIQNQQVSLIFLANDA
FT                   GPNLTKKVTDKSNYYKTEVSTVFSTLELSDALGKPRKVVAVADAGFSKKMRTLMA"
FT   gene            398181..400964
FT                   /gene="infB"
FT                   /locus_tag="SAK_0455"
FT   CDS_pept        398181..400964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SAK_0455"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by similarity to SP:P17889; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM PF04760; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45080"
FT                   /db_xref="GOA:Q3K302"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K302"
FT                   /protein_id="ABA45080.1"
FT                   /translation="MSKKRLHEIAKEIGKTSKEVVEQAQSLGLPVKSHASSVEENDATR
FT                   IVESFSSSKTKAPTNSVQTNQGVKTESKTVETKQGLSDDKPSTQPVAKPKPQSRNFKAE
FT                   REARAKAEAEKRQHNGDHRKNNRHNDTRSDDRRHQGQKRSNGNRNDNRQGQQNNRNKND
FT                   GRYADHKQKPQTRPQQPAGNRIDFKARAAALKAEQNAEYSRHSEQRFREEQEAKRQAAK
FT                   EQELAKAAALKAQEEAQKAKEKLASKPVAKVKEIVNKVAATPSQTADSRRKKQTRSDKS
FT                   RQFSNENEDGQKQTKNKKNWNNQNQVRNQRNSNWNHNKKNKKGKTNGAPKPVTERKFHE
FT                   LPKEFEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMVDYGIE
FT                   AHAKVEVDEADIERFFADEDYLNPDNLTERPPVVTIMGHVDHGKTTLLDTLRNSRVATG
FT                   EAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGVMPQ
FT                   TVEAINHSKAAGVPIIVAINKIDKPGANPERVISELAEHGVISTAWGGESEFVEISAKF
FT                   GKNIQELLETVLLVAEMEELKADADVRAIGTVIEARLDKGKGAVATLLVQQGTLNVQDP
FT                   IVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYADEKAARAAGE
FT                   ERAKRALLKQRQNTQRVSLENLFDTLKAGEVKSVNVIIKADVQGSVEALAASLLKIDVE
FT                   GVKVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADADDVEIRQHSIIYK
FT                   VIEEVEEAMKGKLDPEYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIR
FT                   DGVVIFDGKLASLKHYKDDVKEVGNAQEGGLMIENYNDLKEDDTIEAYIMEEIKRK"
FT   gene            401073..401423
FT                   /gene="rbfA"
FT                   /locus_tag="SAK_0456"
FT   CDS_pept        401073..401423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SAK_0456"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by similarity to SP:P32731; match to
FT                   protein family HMM PF02033; match to protein family HMM
FT                   TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45732"
FT                   /db_xref="GOA:Q3K301"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K301"
FT                   /protein_id="ABA45732.1"
FT                   /translation="MANHRIDRVGMEIKREVNEILRLRVNDPRVQDVTITDVQMLGDLS
FT                   MAKVFYTIHSTLASDNQKAQIGLEKATGTIKRELGKNLTMYKIPDLQFVKDESIEYGNK
FT                   IDEMLRNLDKKD"
FT   gene            complement(401507..402511)
FT                   /locus_tag="SAK_0457"
FT   CDS_pept        complement(401507..402511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0457"
FT                   /product="GDXG lipolytic enzyme family protein"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44847"
FT                   /protein_id="ABA44847.1"
FT                   /translation="MKPSFKKLLLLFSIITILSIACTPHAKASGRSWKSWFIEQYFWLK
FT                   RDKSYYKVQDESSFQKYLNASREQSDKGYYLDPNSVNGGLVQERLFDMQVYSWNDNGKA
FT                   NQKTIFYLAGGSYLNNPTPYHISMLKTLSTSLDAKIILPIYPKTPRYTYDYAIPRLVNL
FT                   YRHFHEKNANLTLMGDSAGGGLALGLAHALSHQSGQEAIPQPKNIILLSPWLDVTMKHP
FT                   EIPKYEDTDPILSAWGLARVGEIWANGSNNTNHTYVSPKNAPATKLAPITLFTGTREIF
FT                   FPDIRDYAAQLQAANHPVNYIAQEGMNHVYPIYPIEEAKTAQYQMIDIINKTP"
FT   gene            402675..403091
FT                   /gene="copY"
FT                   /locus_tag="SAK_0458"
FT   CDS_pept        402675..403091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="SAK_0458"
FT                   /product="transcriptional repressor CopY"
FT                   /note="identified by similarity to GB:AAG10085.1; match to
FT                   protein family HMM PF03965"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45277"
FT                   /protein_id="ABA45277.1"
FT                   /translation="MTISSAEWEIMRVVWAQQNTTSNEILAVLLEKYDWTPSTVKTLLR
FT                   RLLDKGYVSREKMGKGFSYSPLIDEDLAMMSEVDSVFQKVCQTKHVAIVRHLLESIPMT
FT                   EKDRLNLQSSLEAKKGKTLERVACNCIPGQCQCH"
FT   gene            403104..405338
FT                   /gene="copA"
FT                   /locus_tag="SAK_0459"
FT   CDS_pept        403104..405338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="SAK_0459"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by similarity to SP:P37279; similarity to
FT                   GB:AAG10086.1; match to protein family HMM PF00122; match
FT                   to protein family HMM PF00403; match to protein family HMM
FT                   PF00702; match to protein family HMM TIGR00003; match to
FT                   protein family HMM TIGR01494; match to protein family HMM
FT                   TIGR01511; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44394"
FT                   /protein_id="ABA44394.1"
FT                   /translation="MANRKETFLIDGMTCASCALTIEKAVNKLDHVDSAVVNLATEKMT
FT                   VTFDDTTLSPNVIEECVSESGYEASLFKEETSKSQSERHQLAIEKMWHRFWMSAVATIP
FT                   LLYISMGPMINLWLPSFLMPDKGPLNYGMIQLLLTLPVMYFGRIFYQNGFKALFKRHPN
FT                   MDSLVAIATTAAFIYSLYGLYEILQGDIHYAHQLYFESVAVILTLITLGKYFEILSKGR
FT                   TSASIEKLLTLSAKEARVIKDGEDYMVPLDKVKIGETILVKPGEKIPLDGHVVAGESSI
FT                   DESMLTGESIPVEKKVGSKVYGASINGQGSLTIFVEKEAGGSLLSQIINLVEAAQTSKA
FT                   PIANLADKVSGVFVPFVIVIAILSGLSWYLILGQSFAFSLKIMIAVLVIACPCALGLAT
FT                   PTAIMVASGKAAENGILFKGGEVLEKAHHIDTIVFDKTGTLTKGKPEVVAIKTYGGDKE
FT                   EFLGQVASVEKLSNHPLSQTIVNKAKEKELPLREVMAFKNILGYGLSATINGKTMLVGN
FT                   ANLMTKNDVNLDLAKADIEIAQEEAQTVVYVSENGVLSGLITLTDQLKTDSQETVKQLQ
FT                   RLGFNLVLLTGDNKASADAIAQKLGITTVVSEVLPDQKANVILELKEKGGQIAMVGDGI
FT                   NDAPALASSDVGISMSSGTDIAIESADIVLMKPELTDLLKAMTISKQTIQIIKENLFWA
FT                   FFYNVLAIPVAMGVLHLFGGPLLNPMLAGLAMAFSSVSVVLNALRLKVLK"
FT   gene            405379..405585
FT                   /locus_tag="SAK_0460"
FT   CDS_pept        405379..405585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0460"
FT                   /product="copper transporter, copper-binding protein,
FT                   putative"
FT                   /note="identified by similarity to GB:AAG10087.1; match to
FT                   protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45028"
FT                   /protein_id="ABA45028.1"
FT                   /translation="MKHTYRVSGMKCDGCAKTVSDKLSSVIGVDEVNVDLTKNQVVVSG
FT                   KTFKCLLKRSLKDTKYSLEEEIN"
FT   gene            405695..406309
FT                   /locus_tag="SAK_0461"
FT   CDS_pept        405695..406309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0461"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46146"
FT                   /protein_id="ABA46146.1"
FT                   /translation="MSIDIWNILSLVGTVAFASSGAIVAIEEEFDILGLFILGFVTAFG
FT                   GGAIRNVLIGLPIETLWSQGIAFYAAAAAILFIMIFPNLLSGKGRDAEVVSDAIGLAAF
FT                   SVQGALYATQSHQPLSAVIVAAVLTGAGGGIVRDVLAGRKPGVLRSEIYAGWSILVGII
FT                   LYFKIAKTTTDYYLLVLVVTSLRMLGYKKQWHLPVVRPRKK"
FT   gene            406324..407136
FT                   /locus_tag="SAK_0462"
FT   CDS_pept        406324..407136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0462"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44985"
FT                   /protein_id="ABA44985.1"
FT                   /translation="MIKLIAIDMDGTLLNDEKKIPKENIQAIKEATQAGIKIVLCTGRP
FT                   MSGILPYFNELGLTKEEYIIMNNGCSTYSTKDWQLIDSATLTHDELIFLEEVVKEFPNV
FT                   CLTLTAENTFYAVGEEVPEIVAYDADLVFTKAKSTSLDALRNQEEIVFQAMYMGLDADV
FT                   TAFQEAVEEALISKFSGVRSQDYIYEIMPQGVTKARGLKSLIAKLGLDINQVMAIGDAP
FT                   NDIELLDLVPNSVAMGNASDEIKSRCKYITVDNNKAGVAKAIYDYALR"
FT   gene            407249..409891
FT                   /gene="polA"
FT                   /locus_tag="SAK_0463"
FT   CDS_pept        407249..409891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="SAK_0463"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P52026; match to
FT                   protein family HMM PF00476; match to protein family HMM
FT                   PF01367; match to protein family HMM PF02739; match to
FT                   protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44626"
FT                   /protein_id="ABA44626.1"
FT                   /translation="MTNKNKLLLIDGSSVAFRAFFALYNQIDRFKNNSGLHTNAIYGFH
FT                   LMLNHILGRVQPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPYIRQQLDVL
FT                   GIKHYELEHYEADDIIGTLAKQAEASNEHFDITVVSGDKDLIQLTDTNTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGITPSQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLSEYGSLEGI
FT                   YENIEAMKQSKMKENLINDKEQAFLSKTLATINIASPITIGLEDILYSGPQDIKALSQF
FT                   YDEMDFKQFKAALGEETSQEDFEVDFTEVEQLKTEMFSDNDFYYFEMLGDNYHVEDLIG
FT                   IAWGNSDTIYATSNVSLLQEALFKKALSKPIKTYDFKRSKVLLNRFNIDLPEPAFDTRL
FT                   AKYLLSTTEDNLVSTIARLYTNLPLDTDDAVYGKGAKRAIPEKTRFLEHLAKKVKVLVD
FT                   SEANIMQQLKANEQEELLFEMEQPLANVLAKMEIRGIKVKKNTLNEMAIENQKVIETLT
FT                   QEIYELAGQEFNINSPKQLGKLLFETLGLPVEMTKKTKTGYSTAVDVLERLAPISPLVT
FT                   KILEYRQITKLQSTYIIGLQDYILEDGKIHTRYVQDLTQTGRLSSSDPNLQNIPVRLEQ
FT                   GRLIRKAFVPSEDNAVLLSSDYSQIELRVLAHISKDEHLIAAFKEGADIHTSTAMRVFG
FT                   IEKPENVTPNDRRNAKAVNFGIVYGISDFGLSHNLGIPRKLAKQYIDTYFERYPGIKNY
FT                   METVVREAKDKGYVETLFHRRRSLPDINSRNFNIRQFAERTAINSPIQGSAADILKIAM
FT                   INLDRVLDKGGYKSKMLLQVHDEIVLEVPNEEIGAIRELVTKTMESAISLSVPLIADEN
FT                   AGETWYEAK"
FT   gene            409921..410361
FT                   /locus_tag="SAK_0464"
FT   CDS_pept        409921..410361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0464"
FT                   /product="CoA binding domain protein"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45282"
FT                   /protein_id="ABA45282.1"
FT                   /translation="MVYHFQNPSDFMLKNYLTKAKTIAVVGLSDRQETAAYQVSKIMQE
FT                   AGYQIIPVNPKNAGQKILGQMTYASLKDVTEHIDIVNIFRRSEYLPDIAREFLEVDADI
FT                   FWAQLGLESQEAETILKQAGHKQIVMNKCLKVECQKLHSETN"
FT   gene            410443..410922
FT                   /locus_tag="SAK_0465"
FT   CDS_pept        410443..410922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0465"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45908"
FT                   /protein_id="ABA45908.1"
FT                   /translation="MDSHSHGHRPLDAYENVLEHLREKRIRITETRKAIISYMVNSREH
FT                   PSAEKIYNDLLPEYPNMSLATVYNNLKVLVDEGFVTELKLCNYSTTYYDFMGHQHLNIA
FT                   CEDCGKIVDFVDVDLLDISREAHQQTGFEVTRVQLVAYGICPECQRKRKDKYKKD"
FT   gene            411075..412640
FT                   /locus_tag="SAK_0466"
FT   CDS_pept        411075..412640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0466"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF04650;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45145"
FT                   /protein_id="ABA45145.1"
FT                   /translation="MKISQYNKWSIRRLKVGAASVMIASGSIVALGQSHIVSADEMSQP
FT                   KTTITAPTANTSTNVESSTDKALSKVTTMETSSEMPKMQNMAKVEKTSDKPMMVATSVR
FT                   KMMATPTPVAMTKTTSVDEVKKSTDTAFKQTVDVPAHYVNAAKGNGPFLAGVNQTIPYE
FT                   AFGGDGMLTRLILKSSEGAKWSDNGVDKNSPLLPLKGLTKGKYFYQVSLNGNTTGKEGQ
FT                   ALLDQIKANDKHSYQATIRVYGAKDGKVDLKNMISQKMVTINIPHITTDMEVKNSLKMA
FT                   FKEKVDVPAKYVSAAKAKGPFLAGVNETIPYEAFGGDGMLTRLILKASEGAKWSDNSVD
FT                   KNSPLLPLKDLTKGKYFYQVSLNGNTAGKKGQALLDQIKANGSHTYQATITIYGTKDGK
FT                   VDMNTILGQKTVMIHINVAKKDMNSTSMMMKKDKMTMPMKKEMTSSKINTGMMMSNNKM
FT                   SANMQMSSQAKSNDKAGKKMSMMSKNLPNTGETKQQNVGVLGMLSLAFATGLTALGLKK
FT                   SKQR"
FT   gene            412753..413439
FT                   /locus_tag="SAK_0467"
FT   CDS_pept        412753..413439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0467"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45514"
FT                   /protein_id="ABA45514.1"
FT                   /translation="MTQKLLLVDDEFEIIDINRRYLEQAGYEVSVAADGIEALKEVDEN
FT                   RFDLIISDIMMPKMDGYDFISEVLVREPNQPFLFITAKVSEPDKIYSLSMGADDFISKP
FT                   FSPRELVLRVKNILRRIYGNHQQSEVLTIGDLVIDQKQRLVMVDCNTISLTNKSFDLLW
FT                   ILANHLNRVFSKTELYERVWGEEFLDDTNTLNVHIHALRNDLAKFSTDNTPTIKTVWGL
FT                   GYKLEE"
FT   gene            413441..414478
FT                   /locus_tag="SAK_0468"
FT   CDS_pept        413441..414478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0468"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44472"
FT                   /protein_id="ABA44472.1"
FT                   /translation="MKLKYYIVIGYLISMLITVAGVFFGLNHMLIETRGVYYILSVTII
FT                   ACIVGGIVNLFLLSSVFTSLKKLKQKMKDISQRCFDTKAQICSPQEFKDLETAFNQMSS
FT                   ELESTFKSLNESEREKTMMIAQLSHDIKTPITSIQSTVEGILDGIISEEEVNYYLNTIS
FT                   RQTNRLNHLVEELSFITLETMSDTAEPHKEETIYLDKLLIDILSEFQLVFEKENRQVMI
FT                   DVAPDVSKLSSQYDKLSRILLNLISNAVKYSDPGSPLTIKAYSNRQDIVIDIIDQGYGI
FT                   KDEDLASIFNRLYRVESSRNMKTGGHGLGLYIARQLAHQLNGDILVESQYQKGSKFSLV
FT                   LKLQK"
FT   gene            complement(414492..415232)
FT                   /locus_tag="SAK_0469"
FT   CDS_pept        complement(414492..415232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0469"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45776"
FT                   /protein_id="ABA45776.1"
FT                   /translation="MTNSEIKNEAKTILSNLQGKNQLFLLPILLSIITLYISFYYQYNN
FT                   MTLLDFFVPLPVYFFYTLFIISVSFVMLDVVKNQKLNVRFSDNTYVFSSHIFWKLLSVL
FT                   VLKGLILSFFYLLSTFGLLIIISSFRLLLSGNLILAPVLIVVSSLITTKAVIKLVQQYY
FT                   SYSISTLVFYTQLESGNYEGPSKVLVASRELMNGNKLRLFLLDLSFIGWQFLTIFSFGL
FT                   VYIYLLPYQTTARLIFYRNITKNS"
FT   gene            415419..416561
FT                   /gene="tgt"
FT                   /locus_tag="SAK_0470"
FT   CDS_pept        415419..416561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SAK_0470"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44685"
FT                   /db_xref="GOA:Q3K2Y7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2Y7"
FT                   /protein_id="ABA44685.1"
FT                   /translation="MTDHPIKYRLIKQEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKEMGSGIILSNTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLNAHRRPHDQGLFGIVQGAGFEDLRRQSARDLVSMDFPGYSIGGLA
FT                   VGETHDEMNAVLDFTVPMLPNDKPRYLMGVGAPDSLIDAVIRGVDMFDCVLPTRIARNG
FT                   TCMTSQGRLVVKNAKFAEDFTPLDPNCDCYTCKNYTRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKDVRQAIMDDNLLEFRQDFMERYGYGMNNRNF"
FT   gene            416668..416979
FT                   /locus_tag="SAK_0471"
FT   CDS_pept        416668..416979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0471"
FT                   /product="CHY zinc finger family protein"
FT                   /note="identified by match to protein family HMM PF05495"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44900"
FT                   /protein_id="ABA44900.1"
FT                   /translation="MMQEYFGIGLDSSSRCYHYHTKLDIVALKCAVCQKYYACYKCHDA
FT                   LEEHCFAATKSDETFPVLCGSCRQMLTLKEYKTGFCPYCRMLFNPNCQRHDSIYFSKE"
FT   gene            416986..417525
FT                   /locus_tag="SAK_0472"
FT   CDS_pept        416986..417525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0472"
FT                   /product="BioY family protein"
FT                   /note="identified by similarity to GB:AAM99365.1; match to
FT                   protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44356"
FT                   /protein_id="ABA44356.1"
FT                   /translation="MFHTKSLIQMAMMATLLVVLGFIPALPLGFIPVPIVLQNLGVMMA
FT                   GVILGGRKGSLSILLFFLVGLVIPVFSGLRSTIPVLTGPTAGYVIAWLFVPLLISYGVK
FT                   LVNKKNFIAIFLIVWLAGVLFVDVAGAVWLASYTNIPLDKSLLQNLVFIPGDTIKAIIA
FT                   AVVAVKYKDSFFLTEK"
FT   gene            417664..418440
FT                   /locus_tag="SAK_0473"
FT   CDS_pept        417664..418440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0473"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45768"
FT                   /protein_id="ABA45768.1"
FT                   /translation="MKLTTLGCWGGYPYKDGGTTSFLLTGENNFHLLIDAGSRSINELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLYHYRLLYPKDKWEPKVLPVYGHNEDDYEFSKL
FT                   TLPNVAQGIAYHTNGVEQVGPFNITFIKTVHPVVCYAMRITERETGQVLVFTGDSGYFA
FT                   DLVPFTKGADLFLADVYLYEGNENHIAHLTSKEAGEIAYNAKVKKLVLTHVPQFPGEGI
FT                   NPENHLEELRLQSEKYAGGISVDLAQPHKSWDLGKL"
FT   gene            418440..418946
FT                   /locus_tag="SAK_0474"
FT   CDS_pept        418440..418946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0474"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46081"
FT                   /protein_id="ABA46081.1"
FT                   /translation="MQKFTQEEKEWFMTEALKEAKSSLEKEEIPIGCVIVKDGHIIGRG
FT                   HNAREEFNKAILHAEIMAINNANEKVGNWRLLDTTLFVTVEPCVMCSGAIGLARIPHVI
FT                   YGAKNTKFGAAGSLYDILSDSRLNHRVEVETGILEDQCAKIMQDFFRKGRQRKKEAKLS
FT                   EKTKI"
FT   gene            419218..420567
FT                   /gene="pgi"
FT                   /locus_tag="SAK_0475"
FT   CDS_pept        419218..420567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="SAK_0475"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by similarity to SP:P81181; match to
FT                   protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44794"
FT                   /db_xref="GOA:Q3K2Y2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2Y2"
FT                   /protein_id="ABA44794.1"
FT                   /translation="MTHITFDYSKVLGQFVGEHELDYLQPQVSAADAFLRQGTGPGSDF
FT                   LGWMDLPENYDKEEFSRIQKAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNNHFANLQ
FT                   TAEERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYF
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVVRVEKPRKNVT
FT                   IPELTEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPTQDAYTLGYTIY
FT                   FFELAIGLSGYLNSVNPFDQPGVEAYKRNMFALLGKPGFEELSAELNARL"
FT   gene            420889..421416
FT                   /locus_tag="SAK_0476"
FT   CDS_pept        420889..421416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0476"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45466"
FT                   /protein_id="ABA45466.1"
FT                   /translation="MEKKLLRKEVLITLKSQPQAYKSEVDCKLLEAFIKTKAYQNSCVI
FT                   ATYLSFDYEYNTQLLIKQALCDGKRVLVPKTYPKGKMIFVDYQKDNLRATPFGLLEPVN
FT                   DRAVEKASIDLIHVPGLIFNNKGFRIGYGAGYFDRYLSDFEGDTISTIYRCQRQDFVEE
FT                   KHDVAVKEVLCL"
FT   gene            421413..422084
FT                   /locus_tag="SAK_0477"
FT   CDS_pept        421413..422084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0477"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44599"
FT                   /protein_id="ABA44599.1"
FT                   /translation="MKKFAKEYPTTVLLVSLTTLVFLLMQLTYGSQAESSQVIFQFGGI
FT                   QGDYLKAYPTNLWRLISPIFVHIGWEHFLLNGLALYFVGQMGESIWGSLRFLILYILSG
FT                   LMGNIFTLFFTPHVVAAGASTSLFGVFSAIAITGYFGKNPYLKQVGKSYQVMILLNLFF
FT                   NIFTPGVSLAGHVGGLVGGVLVAIFLTKQNGSLLFKTWQSILALMIFIIVSISLIGLSL
FT                   V"
FT   gene            422216..423259
FT                   /locus_tag="SAK_0478"
FT   CDS_pept        422216..423259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0478"
FT                   /product="bmp family protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45220"
FT                   /protein_id="ABA45220.1"
FT                   /translation="MNRKIIGLTLLSLSVLTLTACGNRSDKSANKSDIKVAMVTNQGGV
FT                   DDKSFNQSAWEGLQKWGKKKGLTKGNGFDYFQSSNESDHANNLDTAASSGYNLIFGIGF
FT                   GLHDTIEKVSENNKDVKYVIVDDIIKGKENVASVTFADNEAAYLAGVAAAKTTKTKTVG
FT                   FIGGMEGVVVKRFEAGFKAGVKSIDPAIKVAVSYAGSFTDAAKGKTIAATQYATGVDVI
FT                   YQAAGGTGAGIFSEAKTENETRKESNKVWVIGVDRDQSQEGNYVSKDGKKANFVLASTI
FT                   KEVGKSLQSVAELTEKKQYPGGKVTVFGLKDSGVDIKEHQLSSEGSVAVKKAKEDIVSG
FT                   KIQVPMK"
FT   gene            complement(423350..424249)
FT                   /gene="galU"
FT                   /locus_tag="SAK_0479"
FT   CDS_pept        complement(423350..424249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="SAK_0479"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46292"
FT                   /protein_id="ABA46292.1"
FT                   /translation="MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAL
FT                   KSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKNELLKLVDETTGIRLHFIRQSH
FT                   PRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVME
FT                   VPHEDVSAYGVIAPQGEGVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILET
FT                   QKPGAGNEIQLTDAIDTLNKTQRVFARKFTGDRYDVGDKFGFMKTSIDYALQHPQVKDD
FT                   LKKYIIDLGKSLEKTSKK"
FT   gene            complement(424286..425302)
FT                   /gene="gpsA"
FT                   /locus_tag="SAK_0480"
FT   CDS_pept        complement(424286..425302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="SAK_0480"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by similarity to SP:P46919; match to
FT                   protein family HMM PF01210; match to protein family HMM
FT                   PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45081"
FT                   /db_xref="GOA:Q3K2X7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2X7"
FT                   /protein_id="ABA45081.1"
FT                   /translation="MTKQKIAVLGPGSWGTALAQVLNDNGHEVRLWGNVVEQIEEINTN
FT                   HTNQRYFKDITLDSKIKAYTNLEEAINNVDSILFVVPTKVTRLVAKQVANLLKHKVVIM
FT                   HASKGLEPGTHERLSTILEEEISEQYRSDIVVVSGPSHAEEAIVRDITLITAASKDIEA
FT                   AKYVQKLFSNHYFRLYTNTDVVGVETAGALKNIIAVGAGALHGLGYGDNAKAAIITRGL
FT                   AEITRLGVQLGADPLTFSGLSGVGDLIVTGTSVHSRNWRAGDALGRGEKLEDIEKNMGM
FT                   VIEGISTTKVAYEIAQNLNVYMPITEAIYKSIYEGANIKDSILDMMSNEFRSENEWH"
FT   gene            425472..425801
FT                   /gene="rnpA"
FT                   /locus_tag="SAK_0481"
FT   CDS_pept        425472..425801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SAK_0481"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="identified by similarity to SP:P25814; match to
FT                   protein family HMM PF00825; match to protein family HMM
FT                   TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45680"
FT                   /db_xref="GOA:Q3K2X6"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2X6"
FT                   /protein_id="ABA45680.1"
FT                   /translation="MKKTYRVKSDKDFQMIFSRGKNVANRKFVIYYLEKEQKHFRVGIS
FT                   VSKKLGNAVVRNAIKRKIRHVLLSQKTALQDYDFVVIARKGVEELDYQALEKNLIHVLK
FT                   IAGLI"
FT   gene            425814..426629
FT                   /locus_tag="SAK_0482"
FT   CDS_pept        425814..426629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0482"
FT                   /product="membrane protein oxaA, putative"
FT                   /note="identified by match to protein family HMM PF02096"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44932"
FT                   /protein_id="ABA44932.1"
FT                   /translation="MKKKLKTFSLILLTGSLLVACGRGEVSSHSATLWEQIVYAFAKSI
FT                   QWLSFNHSIGLGIILFTLIIRAIMMPLYNMQMKSSQKMQEIQPRLKELQKKYPGKDPDS
FT                   RLKLNDEMQSMYKAEGVNPYASVLPLLIQLPVLWALFQALTRVSFLKVGTFLSLELSQP
FT                   DPYYILPVLAALFTFLSTWLTNKAAVEKNIALTLMTYVMPLIILVTSFNFASGVVLYWT
FT                   VSNAFQVFQILLLNNPYKIIKVREEAVRVAHEKEQRVKRAKRKASKKRK"
FT   gene            426637..427458
FT                   /locus_tag="SAK_0483"
FT   CDS_pept        426637..427458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0483"
FT                   /product="R3H domain protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46100"
FT                   /protein_id="ABA46100.1"
FT                   /translation="MVLFTGATVEEAIEKGLQELNISRLRAHIKVVSREKKGFLGFGKK
FT                   PAKVEIEGITDEVTDINESVALKNIKNVPSSVDVVEEYIEEVDETLEKEDVSQPELPKI
FT                   DDKNVVITSEAIEKIDLLPNIEVAAAQVTKYVENIIYEMDLDATIETTTSKRQINLQIE
FT                   TPEAGRIIGYHGKVLKSLQLLAQNYLHDRFSKSFSVSINVHDYVEHRTETLIDFSKKIA
FT                   RRVLETNEPYHMDPMSNSERKTVHKTIATIEGVESYSEGNDPNRFVVVTKK"
FT   gene            427806..429312
FT                   /gene="rrsG"
FT                   /locus_tag="SAK_0484"
FT   rRNA            427806..429312
FT                   /gene="rrsG"
FT                   /locus_tag="SAK_0484"
FT                   /product="16S ribosomal RNA"
FT   gene            429402..429474
FT                   /locus_tag="SAK_0485"
FT   tRNA            429402..429474
FT                   /locus_tag="SAK_0485"
FT                   /product="tRNA-Ala"
FT   gene            429629..432531
FT                   /gene="rrlG"
FT                   /locus_tag="SAK_0486"
FT   rRNA            429629..432531
FT                   /gene="rrlG"
FT                   /locus_tag="SAK_0486"
FT                   /product="23S ribosomal RNA"
FT   gene            432606..432721
FT                   /gene="rrfG"
FT                   /locus_tag="SAK_0487"
FT   rRNA            432606..432721
FT                   /gene="rrfG"
FT                   /locus_tag="SAK_0487"
FT                   /product="5S ribosomal RNA"
FT   gene            432725..432797
FT                   /locus_tag="SAK_0488"
FT   tRNA            432725..432797
FT                   /locus_tag="SAK_0488"
FT                   /product="tRNA-Val"
FT   gene            432803..432873
FT                   /locus_tag="SAK_0489"
FT   tRNA            432803..432873
FT                   /locus_tag="SAK_0489"
FT                   /product="tRNA-Gly"
FT   gene            432910..432986
FT                   /locus_tag="SAK_0490"
FT   tRNA            432910..432986
FT                   /locus_tag="SAK_0490"
FT                   /product="tRNA-Ile"
FT   gene            432994..433065
FT                   /locus_tag="SAK_0491"
FT   tRNA            432994..433065
FT                   /locus_tag="SAK_0491"
FT                   /product="tRNA-Glu"
FT   gene            complement(433180..433713)
FT                   /locus_tag="SAK_0492"
FT   CDS_pept        complement(433180..433713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04167"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44873"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2X3"
FT                   /protein_id="ABA44873.1"
FT                   /translation="MRLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHT
FT                   LVTENDGRRWVTREPAIVYFHKKYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDY
FT                   DLDVKVFADGEKRLLDVDEYEQHKAQMNYPTDIDYILKENVKILVEWINENKGPFSSSY
FT                   INIWYKRYLELKKR"
FT   gene            complement(433797..434573)
FT                   /gene="recX"
FT                   /locus_tag="SAK_0493"
FT   CDS_pept        complement(433797..434573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="SAK_0493"
FT                   /product="regulatory protein RecX"
FT                   /note="identified by match to protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46300"
FT                   /db_xref="GOA:Q3K2X2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2X2"
FT                   /protein_id="ABA46300.1"
FT                   /translation="MKITKIEKKKRLYTLELDNTENLYITEDTIVHFMLSKGMIVNAEK
FT                   LENIKKFAQLSYGKNLGLYYISFKQRTEKELIKYLQQHDIDSKIIPQIIDNLKSENWIN
FT                   DKNYVQSFIQQNLNTGDKGPYVIKQKLLQKGIKSKIIESELQAINFQDLASKISQKLYK
FT                   KYQNKLPLKALKDKLMQSLTTKGFDYQIAHTVIQNLEIEKDQELEEDLIYKELDKQYQK
FT                   FSKKYDQYELKQRIINALMRKGYQYEDIKSALREYL"
FT   gene            434672..436027
FT                   /gene="rumA"
FT                   /locus_tag="SAK_0494"
FT   CDS_pept        434672..436027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="SAK_0494"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45127"
FT                   /protein_id="ABA45127.1"
FT                   /translation="MNVVLKQRIPLKIKRMGINGEGIGFYKKTLIFVPGALKGEEVFCQ
FT                   ISSVRRNFAEAKLLKINKKSKNRVDPACSIYKECGGCQIMHLQYDKQLEFKTDVIRQAL
FT                   MKFKPEGYENYEIRKTIGMPEPEHYRAKLQFQVRSFGGNVKAGLYAQGTHRLIDIKDCL
FT                   VQDSLTQEMINRVAELLGKYKLPIYNERKIAGVRTVMIRRAQASGEVQLIFITSKRLDF
FT                   DDVVIELVREFPELKTVAVNINASKTSDIYGQITEVIWGQESINEEVLDYGFSLSPRAF
FT                   YQLNPKQTQILYSEAVKALDVKDDDDLIDAYCGVGTIGLAFAGKVKSVRGMDIIPEAIQ
FT                   DAKENALHMGFTNTHYEAGKAEDIIPRWYSEGFRANALIVDPPRTGLDDKLLNTILKMP
FT                   PEKMVYVSCNTSTLARDLVTLTKVYHVHYIQSVDMFPHTARTEAVVKLQRKV"
FT   gene            436296..437060
FT                   /locus_tag="SAK_0495"
FT   CDS_pept        436296..437060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS09038.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45673"
FT                   /protein_id="ABA45673.1"
FT                   /translation="MIINSFDNSRKAIINPEDINSPIKGFPKTVITCFARETFNRILEE
FT                   LPHREIARTSVANLEIPIYELEFKGQKIGFFNAYVGASACVAILEDIIVFGMENLIVFG
FT                   TCGVLDSSIEETSIIIPRSAIRDEGTSFHYSEASSEIAVNTKFHEEFKSFLDRQAVSYT
FT                   EGKVWTTDGIYRETVDKMLEHKRNGAICVDMECSAIAALSKFRNINHFQFFYSADNLDA
FT                   EVWEARSLGNSEDLEKKDKIAYIAMEFAIETF"
FT   gene            437094..437522
FT                   /locus_tag="SAK_0496"
FT   CDS_pept        437094..437522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0496"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44539"
FT                   /protein_id="ABA44539.1"
FT                   /translation="MWNVKTFDNLTTHELFQIYKLRVSVFVVEQDCPYQEVDDKDLICL
FT                   HGMNWVDGQLAAYYRLIPEDDKVHLGRVIVNPDFRKKGLGNQLVEHAIKFSEANYPNKP
FT                   IYAQAQAYLQDFYQSFGFQPVSEIYLEDNIPHLDMVLS"
FT   gene            437701..441403
FT                   /pseudo
FT                   /gene="scpA"
FT                   /locus_tag="SAK_0497"
FT                   /note="C5a peptidase ScpA, authentic frameshift; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            441613..442521
FT                   /locus_tag="SAK_0498"
FT   CDS_pept        441613..442521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0498"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45142"
FT                   /protein_id="ABA45142.1"
FT                   /translation="MKTIKDWQINICLATYNGQKYLRQQLDSIIQQGYTDWICLIRDDG
FT                   STDDTVAIIKEYVNRDSRFIFINSNDDRKLGSHRSFYELVNYKKADFYVFSDQDDVWKE
FT                   NRLERYLEEAEKFNQESPLLVYSNWTSVDEKLTVLKEHNPATVIQEQIAFNQINGMVIM
FT                   MNHELAKLWEYRQIGAHDSYVGTLAYAVGNVAYISDSTVLWRRQVGAESLNNYGRQYGV
FT                   ATFWQMINTSFDRASLIFAQVSDKMSLERKLFFSRFIELKNANLIRRIYLLSKLKLRRK
FT                   SLKETVAMTILLLTGYGKPKA"
FT   gene            443076..444086
FT                   /gene="nrdF"
FT                   /locus_tag="SAK_0499"
FT   CDS_pept        443076..444086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="SAK_0499"
FT                   /product="ribonucleoside-diphosphate reductase 2, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to SP:P37146; match to
FT                   protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46117"
FT                   /protein_id="ABA46117.1"
FT                   /translation="MQSYYDRSQSPLDYALSEKAFPMRSVNWNKLNDDKDLEVWNRVTQ
FT                   NFWLPEKIPVSNDLNSWRTLDADWQQLITRTFTGLTLLDSVQATVGDIAQIKHSQTDHE
FT                   QVIYANFAFMVAIHARSYGTIFSTLCTSQQIEEAHEWVVDTESLQARSRILIPFYTGDD
FT                   PLKSKVAAAMMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNYYSGYKYQQ
FT                   KVAKLSVEKQAEMKTFVFDLLYQLIDLEKAYLYELYDGFDLAEDAIRFSIYNAGKFLQN
FT                   LGYDSPFTEEETRISPEVFAQLSARADENHDFFSGNGSSYIMGITEETLDEDWEF"
FT   gene            444087..444500
FT                   /gene="nrdI"
FT                   /locus_tag="SAK_0500"
FT   CDS_pept        444087..444500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="SAK_0500"
FT                   /product="nrdI protein"
FT                   /note="identified by similarity to SP:Q47415; match to
FT                   protein family HMM PF07972; match to protein family HMM
FT                   TIGR00333"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45195"
FT                   /protein_id="ABA45195.1"
FT                   /translation="MDSTVKVVYFSSKSNNTHRFVQKLGCSNQRIPSDGSSILVTEDYI
FT                   LIVPTYAGGGDDTKGAVPKQVVQFLNVRQNREHCQGVISSGNTNFGDTYAIAGPIIARK
FT                   LNVPLLHQFELLGTQEDVTRVKELLCQFTRKDK"
FT   gene            444502..446670
FT                   /locus_tag="SAK_0501"
FT   CDS_pept        444502..446670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0501"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to SP:P39452; match to
FT                   protein family HMM PF00317; match to protein family HMM
FT                   PF02867; match to protein family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46343"
FT                   /protein_id="ABA46343.1"
FT                   /translation="MTQSDAYLSLNAKTRFRDRTGNYHFASDKEAVEQYMIEHVEPNTM
FT                   AFTSLIEKLDYLVSNNYYESDLLKQYNLEFICQIFEHAYAKKFTFLNFMGALKFYNAYA
FT                   LKTEDNRYYLEHYEDRVVMNALFLAAGDEKAAYDLVDDMLANRFQPATPTFLNAGKKRR
FT                   GEYISCYLLRIEDNMESISRAISTSLQLSKRGGGVALCLTNLREFGAPIKGIKNQATGI
FT                   VPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLSLGL
FT                   VIPDITFELAKANKDMALFSPYDIERVYGKPMSDISITEEYETLLANADIRKTFISARK
FT                   LFQTIAELHFESGYPYILFEDTVNAKNPHKKEGRIVMSNLCSEIAQVNTASQFSEDLTF
FT                   TKVGHDVCCNLGSINIARAMDQAADFEKLIANSIRALDRVSRTSDLDSAPSIKKGNAAN
FT                   HAVGLGAMNLHGFLATNHIYYDSQEAIDFTDCFFYAMAYYAFKASNHLAKEKGTFEGFS
FT                   ESSYADGSYFYQYTEQNFEPKTQRVKNLLAEYGLTLPSQEDWRKLVQSIKEIGLANAHL
FT                   LAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGALGRVYVPAYKIDADNYVYYKKGAYEV
FT                   GPEAIINIAAAAQKHVDQAISLTLFMTDQATTRDLNKAYIQAFKQKCASIYYVRVRQDI
FT                   LEGSESYDDDMLDDFTSSDLEDCQSCMI"
FT   gene            446733..449900
FT                   /locus_tag="SAK_0502"
FT   CDS_pept        446733..449900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97553.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44408"
FT                   /protein_id="ABA44408.1"
FT                   /translation="MTKKHLKTLALALTTVSVVTYSQEVYGLEREESVKQEQTQSASED
FT                   DWFEEDNERKTNVSKENSTVDETVSDLFSDGNNNSSSSKTESVVSDHKQVPKAKPGVTQ
FT                   EASNSSNDASKVEVPKQDTASKKETIETSTWEAKDFVTRGDTLVGFSKSGINKLSQTSH
FT                   LVLPSHAADGTQLTQVASFAFTPDKKTAIAEYTSRLGENGKPSRLDIDQKEIIDEGEIF
FT                   NAYQLTKLTIPNGYKSIGQDAFVDNKNIAEVNLPESLETISDYAFAHMSLKQVKLPDNL
FT                   KVIGELAFFDNQIGGKLYLPRHLIKLAERAFKSNRIQTVEFLGSKLKVIGEASFQDNNL
FT                   SNVMLPDGLEKIESEAFTGNPGDEHYNNQVVLRTRTGQNPHQLATENTYVNPDKSLWRA
FT                   TPDMDYTKWLEEDFTYQKNSVTGFSNKGLQKVRRNKNLEIPKQHNGITITEIGDNAFRN
FT                   VDFQSKTLRKYDLEEVKLPSTIRKIGAFAFQSNNLKSFEASEDLEEIKEGAFMNNRIGT
FT                   LDLKYKLIKIGDAAFHINHIYAIVLPESVQEIGRSAFRQNGAHHLMFIGNKVKTIGEMA
FT                   FLSNKLESVNLSEQKQLKTIEVQAFSDNALSEVVLPPDLQTIREEAFKRNHLKEVKGSS
FT                   TLSQIAFNAFDQNDGDKRFGKKVVVRTHNNSHMLADGERFIIDPDKLSSTMVDLEKVLK
FT                   IIEGLDYSTLRQTTQTQFREMTTAGKALLSKSNLRQGEKQKFLQEAQFFLGRVDLDKAI
FT                   AKAEKALVTKKATKNGHLLERSINKAVLAYNNSAIKKANVKRLEKELDLLTDLVEGKGP
FT                   LAQATMVQGVYLLKTPLPLPEYYIGLNVYFDKSGKLIYALDMSDTIGEGQKDAYGNPVL
FT                   NVDEDNEGYHALAVATLADYEGLYIKDILNSSLDKIKAIRQIPLAKYHRLGIFQAIRNA
FT                   AAEADRLIPKTPKGYLNTVPNYRKKQVEKNSKPVDYKTPIFDKVLPNEKVDGDRVSKGH
FT                   NIKAETNNSVAVTPTRSEQQLHKSQSDVNLPQTSSKNNFIYEILGYVSLCLLFLVTAGK
FT                   KGKRARK"
FT   gene            449913..450302
FT                   /locus_tag="SAK_0503"
FT   CDS_pept        449913..450302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0503"
FT                   /product="pyridoxamine 5'-phosphate oxidase family"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45150"
FT                   /protein_id="ABA45150.1"
FT                   /translation="MITQEMKEIINSQLAMVATVDAKGQPNIGPKRSMRLWDDKTFIYN
FT                   ENTDGQTRINIEDNGKIEIAFVDRERLLGYRFVGTAEIQTEGAYYEAAKKWAEGRMGVP
FT                   KAVGIIHVERIFNLQSGANAGKEIT"
FT   gene            450375..450911
FT                   /locus_tag="SAK_0504"
FT   CDS_pept        450375..450911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0504"
FT                   /product="IS861, transposase orfA"
FT                   /note="identified by similarity to GB:AAN00393.1; match to
FT                   protein family HMM PF02178"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44649"
FT                   /protein_id="ABA44649.1"
FT                   /translation="MKLSYEDKLEIYELRKIGMSWSQISQRYDVRISNLKYMIKLMDRY
FT                   GVEIVEKGRNEYYPPELKQEMIDKVLIHGCSQLSVSLDYALSNCSILTNWLSQFKKNGY
FT                   TIVEKTRGRPSKMGRKRKKTWEEMTELERLQEENERLRTENAFLKKLRDLRLRDEALQS
FT                   ERQKQLEKWSQEDSD"
FT   gene            450887..451720
FT                   /locus_tag="SAK_0505"
FT   CDS_pept        450887..451720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0505"
FT                   /product="IS861, transposase orfB"
FT                   /note="identified by similarity to GB:AAN00394.1; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45427"
FT                   /protein_id="ABA45427.1"
FT                   /translation="MVTGGFRLDLLLEITKIARATYYYQLKKLNKPNKDKAIKSDIQSI
FT                   YDEHRGNYGYRRIYLELRNRGFVINHKRVQGLMKSMGLTARIRRKRKYASYKGEVGKKA
FT                   DNLIQRQFEGSKPYEKCYTDVTEFALPEGKLYLSPVLDGYNSEIIDFTLSRSPDLKQVQ
FT                   TMLERAFPAASYSETILHSDQGWQYQHKSYHQFLEDKGIRPSMSRKGNSPDNGMMESFF
FT                   GILKSEMFYGLEKSYKSLDDLEQAITDYIFYYNNKRIKAKLKGLSPVQYRTKSFT"
FT   gene            complement(451781..452239)
FT                   /locus_tag="SAK_0506"
FT   CDS_pept        complement(451781..452239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT03293.1; match to
FT                   protein family HMM PF06445"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46042"
FT                   /protein_id="ABA46042.1"
FT                   /translation="MILAGVTLENVKSNQECPKLWEKLHKQYNPSKLKEKGIQQAIGIC
FT                   KTQPDFRFDYSATYRVETSVQAPKGLEIIRIPSATYAVISVKGPMPSSLQETWRKIIQG
FT                   FFQENNLKPANSPNLEIYSSQHPQDTDYQMEIWLAIADITNKSKTNLI"
FT   gene            complement(452511..452633)
FT                   /locus_tag="SAK_0507"
FT   CDS_pept        complement(452511..452633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44620"
FT                   /protein_id="ABA44620.1"
FT                   /translation="MLRDYLEDMLKKEGKEVYPFSRLASHSANRWYLYETPWRY"
FT   gene            complement(452633..452794)
FT                   /locus_tag="SAK_0508"
FT   CDS_pept        complement(452633..452794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46281"
FT                   /protein_id="ABA46281.1"
FT                   /translation="MLTIQEMKDTTFELQENFRRLNYPIKQVAKDLQLNISEVESLLSL
FT                   DVTYPGDV"
FT   gene            complement(452881..453198)
FT                   /locus_tag="SAK_0509"
FT   CDS_pept        complement(452881..453198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0509"
FT                   /product="4-carboxymuconolactone decarboxylase, putative"
FT                   /note="identified by similarity to SP:P20370; match to
FT                   protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45167"
FT                   /protein_id="ABA45167.1"
FT                   /translation="MKEKQTAGRRQLEEFAPEFARYNDDILFGEVWAKEDHLTDKTRSI
FT                   ITISALISGGNLEQLEHHLQFAKQNGVTKEEIADIITHLAFYVGWPKAWSAFNKAKEIW
FT                   I"
FT   gene            complement(453222..453617)
FT                   /locus_tag="SAK_0510"
FT   CDS_pept        complement(453222..453617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0510"
FT                   /product="cupin domain protein"
FT                   /note="identified by similarity to GB:CAD65066.1; match to
FT                   protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44474"
FT                   /protein_id="ABA44474.1"
FT                   /translation="MQETTKSIFPKGEKNPYGEFFIGQSYLAALAKSPDGNVSVGNVTF
FT                   EAGCRNNWHVHLDGYQILLVTEGSGWYQEEGKEAVSLKPGDVIVTDKGVRHWHGAKKDS
FT                   EFAHIAITAGKSEFYEAVSDEEYSRLG"
FT   gene            complement(453701..454016)
FT                   /locus_tag="SAK_0511"
FT   misc_feature    complement(453701..454016)
FT                   /locus_tag="SAK_0511"
FT                   /note="similar to transcriptional regulator, MerR family;
FT                   identified by similarity to GB:BAB83973.1; match to protein
FT                   family HMM PF00376"
FT   gene            complement(454032..455068)
FT                   /pseudo
FT                   /locus_tag="SAK_0512"
FT                   /note="oxidoreductase, zinc-binding dehydrogenase family,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to GB:CAD65084.1"
FT   gene            complement(455178..456020)
FT                   /locus_tag="SAK_0513"
FT   CDS_pept        complement(455178..456020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0513"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45838"
FT                   /protein_id="ABA45838.1"
FT                   /translation="MTDTMILNDNHKIPTLGLGTWMIDNDRVAQVVKDAIELGYRHINT
FT                   AQAYNNEKGVGVGIKESGITRESLFVTTKIAAEHKDYESATKSIDQSLEALGLDCIDLM
FT                   IIHSPQPWKEWRETDKHFDQGNLEAWRALEDAQKSGKVKSIGVSNFLEKDLKNGHVKPA
FT                   VNQILAHIGNTPFDLIDYCQSKGIQVEAYSPIAHGQALKSDGIQKMAEKYGVSVAQLCI
FT                   QYLLQLNLIVLPKASSKEHLQSNLDFDFVISDEDMSILKSLMFDDYGEFSNFPVFSEK"
FT   gene            complement(456105..456968)
FT                   /locus_tag="SAK_0514"
FT   CDS_pept        complement(456105..456968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0514"
FT                   /product="cation efflux transporter, cation diffusion
FT                   facilitator (CDF) family"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44896"
FT                   /protein_id="ABA44896.1"
FT                   /translation="MTSNKKVAIAFILNISFSVLEFIFGSLFFSGAILADAVHDFGDAI
FT                   AIGISATLEKKSKKDEDTIFSLGYKRFSLLGALITSLILISGSILVMIENIPKLWHPTP
FT                   VNYHGMFILAVIAIIINGLASFILHSGQSKHEEILSLHFLEDILGWLAIIVISLILNWK
FT                   PLYILDPLLSVAISTFILSKALPKLLSTLKLFLDGVPDSIDYAALHDELKGLSQVRSIN
FT                   QLNIWSMDGIDNRAIIHCCLNQLISEKDCKRAIRTICQHYKINDVTVEIDYSLREHQNH
FT                   CKPLKN"
FT   gene            457100..457624
FT                   /locus_tag="SAK_0515"
FT   CDS_pept        457100..457624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0515"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45054"
FT                   /protein_id="ABA45054.1"
FT                   /translation="MVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRST
FT                   FYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDP
FT                   YFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVED
FT                   LLKYYLTMVER"
FT   gene            complement(457819..459012)
FT                   /locus_tag="SAK_0516"
FT   CDS_pept        complement(457819..459012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0516"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46044"
FT                   /protein_id="ABA46044.1"
FT                   /translation="MIDFLLLKSLHSLLGLTITVCDQNFSVIREYKSEKTISLFYNHYL
FT                   ILSNFSKTQHDFLFHYGSLGELFLVHHIQQYYIIIGPWRSNVIDPLLLKKKLTETQINA
FT                   SEQNYFIDRLSQLPFFSLSQIRELLIVTNYCLTGVVKDKLSEPLHYYTKGWSNSFDLDK
FT                   IKQFSKQNMSSYKYQYHFENNILKAVKSGSEFLLKETVEQFSNSIVPIISGDELRSEKN
FT                   YSIMIYDRLSQATIQAGLDIETAYRARDRFIKENESTISLNEVLKLRDTAILFYTQQVH
FT                   SLKKHLETPHSQTIVAVIRYLENNLNRFIKTEEIAKECHMSESKLRKLFKQEKHITIQQ
FT                   YFLNLKIEAAKQLLDENKKVEEVSNLLGFSTSSNFSRTFKKIVGISPLEYKQKPKTI"
FT   gene            459256..462318
FT                   /locus_tag="SAK_0517"
FT   CDS_pept        459256..462318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0517"
FT                   /product="C protein alpha-antigen"
FT                   /note="identified by similarity to SP:Q02192; match to
FT                   protein family HMM PF00746; match to protein family HMM
FT                   PF04650; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR01168; match to protein family HMM
FT                   TIGR02331"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45154"
FT                   /db_xref="GOA:Q02192"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR012706"
FT                   /db_xref="InterPro:IPR014933"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="InterPro:IPR035327"
FT                   /db_xref="InterPro:IPR038335"
FT                   /db_xref="InterPro:IPR038544"
FT                   /db_xref="PDB:1YWM"
FT                   /db_xref="PDB:2O0I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02192"
FT                   /protein_id="ABA45154.1"
FT                   /translation="MFRRSKNNSYDTSQTKQRFSIKKFKFGAASVLIGLSFLGGVTQGN
FT                   LNIFEESIVAASTIPGSAATLNTSITKNIQNGNAYIDLYDVKLGKIDPLQLIVLEQGFT
FT                   AKYVFRQGTKYYGDVSQLQSTGRASLTYNIFGEDGLPHVKTDGQIDIVSVALTIYDSTT
FT                   LRDKIEEVRTNANDPKWTEESRTEVLTGLDTIKTDIDNNPKTQTDIDSKIVEVNELEKL
FT                   LVLSVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGD
FT                   HKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVK
FT                   IPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDP
FT                   TGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGT
FT                   KDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVG
FT                   DRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPV
FT                   SDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPK
FT                   PVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKV
FT                   TVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPD
FT                   GSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGG
FT                   ETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDT
FT                   VEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRP
FT                   DTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGKAQQVNGKGNKLPA
FT                   TGENATPFFNVAALTIISSVGLLSVSKKKED"
FT   gene            462673..463375
FT                   /pseudo
FT                   /locus_tag="SAK_0518"
FT                   /note="site-specific recombinase, phage integrase family,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts which are not the result of
FT                   sequencing error; identified by similarity to
FT                   GB:AAN57965.1"
FT   gene            complement(463511..463581)
FT                   /locus_tag="SAK_0519"
FT   tRNA            complement(463511..463581)
FT                   /locus_tag="SAK_0519"
FT                   /product="tRNA-Thr"
FT   gene            complement(463652..463957)
FT                   /locus_tag="SAK_0520"
FT   CDS_pept        complement(463652..463957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL98149.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45954"
FT                   /protein_id="ABA45954.1"
FT                   /translation="MFPNLLSLISYHEQQIASRRLSHHLGLEQSIVLYAMAKEETISNE
FT                   RCPHPKLINVLEGKLEIILGDQKHILEKDSLISLSPQEIHHLRAIENSKFLQIELD"
FT   gene            complement(463959..464297)
FT                   /locus_tag="SAK_0521"
FT   CDS_pept        complement(463959..464297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58977.1; match to
FT                   protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45040"
FT                   /protein_id="ABA45040.1"
FT                   /translation="MSYIEKIEANKVLDLKQIVPIEEEQMLSKTLVQRKDLGMTVFSLD
FT                   KGQEIGRHSSPGDAMVNILSGLAQITIDQDKFDVAAGECIVMPANIPHSLYAKEAFQML
FT                   LVVVKPEV"
FT   gene            complement(464318..465082)
FT                   /locus_tag="SAK_0522"
FT   CDS_pept        complement(464318..465082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB94108.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45723"
FT                   /protein_id="ABA45723.1"
FT                   /translation="MILLSHKEIGHQFLARLGKKRLRPGGVQATNWLIKKGHFSADSRV
FT                   LEVACNQCTSSIDIAKAFSCHITALDLDSKVIEKAKENVKKAQLEEFIEVIQGNALKLP
FT                   FPDNSFDIVINEAMLTMLSNSAKEKAIKEYLRVLKPGGRLLTHDVSYQDEDTAKLIDQL
FT                   RHTINVNVAPLKIDDWQNLFLQNGFSSSEYQFGKMSLMSPLGMIKDEGLFNTIKIISRG
FT                   LKKENRSQFLKMKHFFTKTGKNLCYIAVASTK"
FT   gene            465273..467333
FT                   /locus_tag="SAK_0523"
FT   CDS_pept        465273..467333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0523"
FT                   /product="PTS system IIA domain protein"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44374"
FT                   /protein_id="ABA44374.1"
FT                   /translation="MNKRTFLLLQQLAQSRLATLEQLATQFKTSTRTIRKDIDMINDCL
FT                   IKAGADLIYFGNEGEVCSDKAKNHLNDIPKMISLTDYRLSREERLILESYFLLVSLTPI
FT                   TIKGLSRKMYLSRNTVVNDLPSLRSFLTQNELILKSDKQGLIIEGSESQKRLLLMHHYI
FT                   SLSDNDFLREYLFPSEDDPSLLISVVRKAEKQNQVVFRDYSFQYVQTYLNVLCSRSANN
FT                   LMIETEGMFHFSAFSLIISQSILEDLSQKVRFPLSLKEVEFLAFLIGNLTFVKKSSPID
FT                   DSFKIQFLTRQFIKQISGDIAYDLTQDISLLENLSKHMETIFYNQPLQAPDSSLLTDII
FT                   ESNKSIVTAIKKHLSIFHILKSKVFEPNDIYYIAIHICGAVERQRLEIAHFKVLLACHA
FT                   GIGTSMLLKQRLKEHFNFDIIDVVTIHEAEEEQHRADFIITTVPLQKTNNETIVVSASL
FT                   TETDIIRINTLMRKISKEGNVEENPETSQALFKDLLPILKKIGCEQKDLVMIRQVINRH
FT                   CQKSMSPFEESMAHQVIQLSDLLTPNYIDLQGKASSWEESIRQSARLLREESLIEESYV
FT                   EAMIANVLSYGPYILVAKGVAVAHAGIDDGVNGLGMSLYRLDKGVNFGNPELDPIRYII
FT                   CLCVTDYGKHVTAFNTLLNLFQDSSMREKLDRVDTAKDCYCLIKKYEEKEN"
FT   gene            467448..467897
FT                   /locus_tag="SAK_0524"
FT   CDS_pept        467448..467897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0524"
FT                   /product="PTS system, galactitol-specific IIA component,
FT                   putative"
FT                   /note="identified by similarity to SP:P37187; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46251"
FT                   /protein_id="ABA46251.1"
FT                   /translation="MIEKLIYNDLISLNHRYRDQTNLLEVLSQYLLQKGYVKTEFSKAI
FT                   LQREKDYPTGLQLENMAVAIPHTYSEYVLKPFIYINKLKEPISFIQMGTEDEIVMARYV
FT                   IVLGISNPKDQAGLLAELMTLFSNPKIVQQLEMAQTKEALKNIFN"
FT   gene            467916..468194
FT                   /locus_tag="SAK_0525"
FT   CDS_pept        467916..468194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0525"
FT                   /product="PTS system, galactitol-specific IIB component,
FT                   putative"
FT                   /note="identified by similarity to SP:P37188; match to
FT                   protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45202"
FT                   /protein_id="ABA45202.1"
FT                   /translation="MKKLIVACGSGVATSQTVASKVDRLLKEAGISCDIEAVDMKSLEQ
FT                   HLKTADAYISIVKAKKDYGVPVFNGVAFLTGMGQKQELEKIISFVKG"
FT   gene            468206..469543
FT                   /locus_tag="SAK_0526"
FT   CDS_pept        468206..469543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0526"
FT                   /product="PTS system, galactitol-specific IIC component,
FT                   putative"
FT                   /note="identified by similarity to SP:P37189; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45288"
FT                   /protein_id="ABA45288.1"
FT                   /translation="MDVLQTVINYILDLGAAVFVPFLMLIIGLCMKMKFRDAFTSALIL
FT                   GIAFTGMGILVNYIMTSMGAAANDLTKHTGLSLPAVDIGWPGAASISWAWPYAFLVFPL
FT                   QLAINFVMLLLNQTKTLNVDLWNVWNKIFTAVIVTYFTNNVIFGFIAAAIIIILELKLG
FT                   DVFAPEVERLTGVPGVTVPHFICLIAVILHPIDELLKKIPVLNKDFDADTLKEKIGVFG
FT                   ENSVMGAIIGFVLGIASGNGIKFALTLAVQAATALTLFPMVSKLFSQALSPISEAVSDF
FT                   MREKFEDREVYIGLDWPILGGRNELWVAVIFTIPFLLIGSIILPGNIVLPFAGIINLSF
FT                   VVGALLLTNGNVIRMIIHGLISTPLFLYGATYFTPYMTRLAKETGTLKQKGLISWATFE
FT                   GPDIRYLLATVFQGKVLSVILLIIWLALYVWLLKERKKYNTNLIVE"
FT   gene            469566..470396
FT                   /gene="rhaD"
FT                   /locus_tag="SAK_0527"
FT   CDS_pept        469566..470396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaD"
FT                   /locus_tag="SAK_0527"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /EC_number="4.1.2.19"
FT                   /note="identified by similarity to SP:P32169; match to
FT                   protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46101"
FT                   /protein_id="ABA46101.1"
FT                   /translation="MTYPDYINELLEVTYDMWQHGWDEYNGGNVSYRLTKEEIGTLRHD
FT                   LEDTLFTYNDSQEEVDVLSVPDNMQEEYLLITASGSHFRTLKNQPEIDTGIIRITSTGY
FT                   QVIAGFNSGKKPTSEIFMHILAHSARVSQNPNHRVVIHNHATNIVIYSLLEEITSRRLT
FT                   IDLWSVLTESIVVFPDGIAVLPWEVPGTYQIGLDTAHELKKHRLVVWAKHGVLSTGVSY
FT                   QDCFGLIETADKAANIALKLRSTSGKSIQDNNILTTDDLEKVCQKLQVKGRYLL"
FT   gene            470531..470995
FT                   /locus_tag="SAK_0528"
FT   CDS_pept        470531..470995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0528"
FT                   /product="PTS system, galactitol-specific IIA component,
FT                   putative"
FT                   /note="identified by similarity to SP:P37187; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44975"
FT                   /protein_id="ABA44975.1"
FT                   /translation="MLEDKVIVFQKSHLDSSEEALDYVSHLLLQSGAVKESYPNAIQER
FT                   EKAFPTGLMFSDYGVAIPHTDIEHVNYSQMAIVSLKNPVVFQQMGNGEDVEVNIIFMLA
FT                   LKEAHQQVDLLSQLIELFQNKVLLKTLLALGNERSAIDQALGLLKAQGIE"
FT   gene            471008..472339
FT                   /locus_tag="SAK_0529"
FT   CDS_pept        471008..472339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0529"
FT                   /product="PTS system, galactitol-specific IIC component"
FT                   /note="identified by similarity to SP:P37189; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44979"
FT                   /protein_id="ABA44979.1"
FT                   /translation="MLDILQKFVNLGAIVVLPILIFIFGILLGTKPRKAFISGVTVGIG
FT                   FVGLNMVVDLLGNSLGPAAQAMVKRFGLHLTTIDVGWPAASAISYGTLLGSLAIPIGVG
FT                   INLLLLFLGMTKTLMVDMWNFWHAAFVASLVYAVTHNFALGLYATVVYMVMIYLLGDII
FT                   APMIKTFYGFPNITFPHGTSAPGVIFAIPLNWLFDRIPGFNKIDAKPETIQKRFGVFGD
FT                   TTVMGLIIGIVMGLLANYNVTNTLQLGIKTAAVMVLMPRMVALLMEGLTPISESANTFV
FT                   QKRFPGREVNIGMDSALSVGHPAVLSSSLILIPITILLSVILPGNTTIPFGDLATIPFA
FT                   VCLMAAVFGGNIIRTVVGGTIYMAVIMYITSWVAPLVTLSAKAANFDLSGHSRITALVE
FT                   GGLWPTWLFVFAAKTLPWLILTLILIISLSVMYYLNKVKKEGEI"
FT   gene            472341..472625
FT                   /locus_tag="SAK_0530"
FT   CDS_pept        472341..472625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0530"
FT                   /product="PTS system, galactitol-specific IIB component,
FT                   putative"
FT                   /note="identified by similarity to SP:P37188"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44605"
FT                   /protein_id="ABA44605.1"
FT                   /translation="MKKLLIMCGSGIATSTVVVGKVKTWLEENHYQDQVRIYQSKIAEE
FT                   INHIDDYDIVISTTVVPDNVQDKVIMGLPLLTGMGVDAVWSELEAQIKD"
FT   gene            complement(472910..473740)
FT                   /locus_tag="SAK_0531"
FT   CDS_pept        complement(472910..473740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0531"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45203"
FT                   /protein_id="ABA45203.1"
FT                   /translation="MNHKELHLFNNLSYIDLYPIQFGKEACAPLHSFGPSLKEHYLFHY
FT                   IVSGRGTFYNTEEETAHKLEAGQGFLIPPHLVCSYEADKADPWTYIWIEFDGLKSDYFL
FT                   KQAGLDHKHLIFSQEKNSFDSPVYTEAINILASHNQRSAKVIAHLYLFIDALISQSINH
FT                   KVIPHNETKDFYIREAINFIERNFQFPITVEEIAKSCNLNRHYFCRLFREQTNSSPQQF
FT                   LIQYRLSKACALLKNRNLNLSDIAEQIGYSNQFNFSAAFKRQYGISPRQWRKTL"
FT   gene            473979..475256
FT                   /locus_tag="SAK_0532"
FT   CDS_pept        473979..475256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0532"
FT                   /product="sugar ABC transporter, sugar-binding protein,
FT                   putative"
FT                   /note="identified by similarity to PIR:AE1460; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45379"
FT                   /protein_id="ABA45379.1"
FT                   /translation="MKKMGYYMGLAAACLALLAGCSNNSNKESKASDNKSGTTEISYAI
FT                   WDSAQEPGIRKIADKFEEKNPKIKVKIQVVSWDAYWTMLEAGATGGSLPDTFWMHSNEI
FT                   YRYGANKMLLSLDDYIKKSKEVKLSNYPKGLTKIYNIKGEQYAIPKDYDTIGLWYNKKM
FT                   FDAAGVSYPDETWDWNKLKEAAKKLTKPDGSQYGFLAPLHNQEGYYNFVYQNGGTIITK
FT                   DKKSGYDDPKTVEALKYYLSFVKENLSPKVTEDKKRAEVMQNGQAAMGYFGSWNLNSFA
FT                   SNDYMKENFDVAVLPKANDGKRSTIFNGLGNAISAKTKHPQAAWKWVEYLSSKEAQDMQ
FT                   AKLGVAISAYKGSDKVWVDSNKTFAIKHFVEMIDYAQIRPYSNATTKWEDKVYEELKPA
FT                   YLGKESLEKAVKKITKTMNRALEREK"
FT   gene            475340..476230
FT                   /locus_tag="SAK_0533"
FT   CDS_pept        475340..476230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0533"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /note="identified by similarity to PIR:T46751; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44597"
FT                   /protein_id="ABA44597.1"
FT                   /translation="MKNKKKWNEYLWGWALVAPTIIGLMVLNIIPIFQTLKMSFFKSGD
FT                   FGQNDIFVGLDNYKRLIEDEQVWQATWNTFKYTLLVVPLTVILALVLATLLNSKIKGKH
FT                   VYRTIFFLPMVAAPAAVTMVWKWLYNTDFGLINFLLRKIGLNGLNWIEDPNIALYSIAL
FT                   IGIWSTVGYSMILILAGLQEIPKDFYESATIDGASAVKQFFSITLPLISPTLFFVVVTS
FT                   IIQAMQVFDAIYLMESVTSPAYNKTVSLVYLFYNNSFKYADQGYGSTIVMLLLVIILII
FT                   TLIQMKVQKKWVYYS"
FT   gene            476244..477077
FT                   /locus_tag="SAK_0534"
FT   CDS_pept        476244..477077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0534"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46068"
FT                   /protein_id="ABA46068.1"
FT                   /translation="MYKTKKKFPYLWAHVFLIFVALGMIIPFIWMVLTSFKTITESTQL
FT                   NPFHFFPSKWQVSNYTEVIRTNNFPILYFNTIMMMLWRIVSSVLFSAMAAYAFARLKFP
FT                   GRNLLFGLVLFQMMVPPQLFVIPQYLMVNQLNMRNTIFALVFPGLVSAFGTFLLRQFFI
FT                   GLPDELEEAAKLDGCNIGQTFFKIMLPLAKPGLIALGIFTALFAFKDLLWPLIINSESD
FT                   AATLSSALSKIQGAYAVNYPQLMAASVLAIWPMVVLYIIFQKQFIQGISTSGGKL"
FT   gene            477087..479288
FT                   /locus_tag="SAK_0535"
FT   CDS_pept        477087..479288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0535"
FT                   /product="alpha-galactosidase, putative"
FT                   /note="identified by similarity to SP:P27756; match to
FT                   protein family HMM PF02065"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44757"
FT                   /protein_id="ABA44757.1"
FT                   /translation="MPINFREKEKEFHLYNDSLSYVICVLPNGHIGNLYYGKRLSENMS
FT                   YAYLLENKYRPLTAYVYEDDDCFSLQHTRQEYASYGSGDMILPAFEISHEDGSHLSHFV
FT                   FYDYAISKGKPQLSGLPNTYVESDEEATSLELYLKDHNSETELCLTYTIYESRAVITRN
FT                   AKFTQRGEKELCLKRALSLCLDLPDKDYEWLHLDGAWGRERYLQSSLLHQGSQSIYSLK
FT                   GASSAEHNPFIALKRPDANEHEGEVMGFSLVYSGNFLAQVDVTPFHQTRVSMGIHPLGF
FT                   EWYLKSGESFQTPEVVMVYSHLGLNGMSQIYHDLFSQRLARGEWRDRERPILLNNWEAM
FT                   TFNFNENSILSLAEVAAKLGVELFVMDDGWFGQRNNEKAGLGDWRVNQKKLPNGLLGIS
FT                   QRIHQLGMLFGLWIEPEMVNKDSDLYREHPDWILHHPKHSQSQGRHQYTLDLSREEVYQ
FT                   NIYQQLHDLLANHGIDYIKWDMNRYMTEAYSYHATKEHQGAIFHRYILNLYRLYETLTS
FT                   EFPHILFESCSSGGARFDPGMLYYAPQTWTSDDTDAYERLKIQYGTSLVYPLITMGNHV
FT                   SEVPNQQLLRTTPLSTRANVAYFGSFGYEIDLMLLEEEELELIKKEIDFYKNYRRVFQF
FT                   GNFTRLINPFETDDAAWQVISEDGHHVFVGLYLGLLKLNGPSYHRLHLKGLEAEASYRL
FT                   NNQVYLGSALMNAGLVINEKDFTEGYKDFASAIYHLEKM"
FT   gene            479378..480550
FT                   /pseudo
FT                   /gene="galK"
FT                   /locus_tag="SAK_0536"
FT                   /note="galactokinase, authentic point mutation; this gene
FT                   contains a premature stop which is not the result of
FT                   sequencing error; identified by similarity to SP:P96993"
FT   gene            480563..482044
FT                   /gene="galT"
FT                   /locus_tag="SAK_0537"
FT   CDS_pept        480563..482044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="SAK_0537"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /note="identified by match to protein family HMM PF01087;
FT                   match to protein family HMM PF02744; match to protein
FT                   family HMM TIGR01239"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45842"
FT                   /protein_id="ABA45842.1"
FT                   /translation="MKTLLDKFVDQLIEIGTFEELDRIYLNNRIMALVGEEGLDQQTDA
FT                   ESLIDIKDKLVDIAVKNGACQELLSKKDMLGAQLMDFITPLPSQVNAAFWKTYKENPKQ
FT                   AIADFYQLSKANDYIKVKANAKNIYYQVTTDYGNLEITINLSKPEKDPKAIAEAKLSKE
FT                   CHYPKCQLCLENEGYQGRIDYPARTNHRVIRYEINKEIWGFQYSPYAYFNEHCIFFYGK
FT                   HQPMKISSKTFERLLDIVDRFPGYFAGSNADLPIVGGSILTHEHYQGGRHTFPMEVAEI
FT                   EEDLTFKGFKKVRAGIVKWPISVIRLRSENQQQLIALATKILENWQNYSDESVHILSES
FT                   SGIPHHTITPIARKKGNSFELDLALRDNQTSTEFPDGMYHPHPDVQHIKKENIGLIEVM
FT                   GLAILPPRLKEELGLVERYLLGEVNEVVSYHQKWADNLKLVSEITSGNVEQIVKDAVGK
FT                   VFSRVLEDAGVFKRTPEGKAAFRRFVESVGVIKGE"
FT   gene            482046..483041
FT                   /gene="galE"
FT                   /locus_tag="SAK_0538"
FT   CDS_pept        482046..483041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="SAK_0538"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44754"
FT                   /protein_id="ABA44754.1"
FT                   /translation="MAILVLGGAGYIGSHMVDYLLTKTDETVVVVDNLVTGHREAIHLE
FT                   AIFYKGDLADKTFMRQVFVENPSIDTVIHFAAYSLVAESMEQPLKYFNNNTAGMINLLE
FT                   VMTEFAIKFIVFSSTAATYGIPNDIPIKEITPQRPINPYGESKLMMETIMKWADAAYGV
FT                   KFVPLRYFNVAGAKPDGSIGEDHKPETHLLPIILQVAQGKREKVMIYGDDYQTSDGTNI
FT                   RDYVHPFDIAAAHLLAVDYLRKGNPSTAFNLGSSIGFSNFQILEVARRVTGKDIPVEVT
FT                   KRRIGDPDILIADSSKARDILGWQPEFDDIEKIISSAWAWHSSHPDGYKS"
FT   gene            483167..484036
FT                   /locus_tag="SAK_0539"
FT   CDS_pept        483167..484036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0539"
FT                   /product="aldose 1-epimerase, interruption-N"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45358"
FT                   /protein_id="ABA45358.1"
FT                   /translation="MTIIKKNFGEKLAFLYELKNKNGMKVTLTNFGARIVDIFIPIDEH
FT                   LRNISLSATSVEDYYQKDIYVGATVAPVAGRISGAKTHIKGKCYHFTENEPNRTLHSGV
FT                   DTSVEQYWSTEIEDKENKIIFSLFLPDGKNGFPGNVTVIATYQLTEENELKVNYQAQSD
FT                   CDTIFNPTNHVYFNLTGDFQKSVASHQLKISSQEFVPLGKDHLPTGEILTVEGTDFDFR
FT                   EFALFSKGLNRFSFQTRLVNGFDHPWLLEVGNNAVEVVSPDNKISLIDFLRNKIWYNRL
FT                   PAKQNMVQ"
FT   gene            484041..484424
FT                   /locus_tag="SAK_0540"
FT   CDS_pept        484041..484424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0540"
FT                   /product="IS1381, transposase orfA"
FT                   /note="identified by similarity to GB:AAT10382.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44475"
FT                   /protein_id="ABA44475.1"
FT                   /translation="MNYEASKQLTDVRFKRLVGVQRTTFEEMLAVLKTAYQRKHAKGGR
FT                   TPKLSLEDLLMATLQYMREYRTYEQIAADFGIHESNLIRRSQWVESTLIQSGFTISKTH
FT                   LSAEDTVIVDATEVKINRPKKIN"
FT   gene            484457..484846
FT                   /locus_tag="SAK_0541"
FT   CDS_pept        484457..484846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0541"
FT                   /product="IS1381, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44898"
FT                   /protein_id="ABA44898.1"
FT                   /translation="MKAQAIVTSQGRIVSLDIAVNYCHDMKLFKMSRRNIGQAAKILAD
FT                   SGYQGIMKMYSQAQTPRKSSKLKPLTLEDKTYNHTLSKERIKVENIFAKVKTFKIFSTT
FT                   YRNRRKRFGLRMNLIAGMINRELGF"
FT   gene            484866..485060
FT                   /locus_tag="SAK_0542"
FT   CDS_pept        484866..485060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0542"
FT                   /product="aldose 1-epimerase, interruption-C"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46219"
FT                   /protein_id="ABA46219.1"
FT                   /translation="MKTNQPAVVIYTYNHGPTALAACHGAFSLECQSLPNACNLENLGS
FT                   ILLEKGKVFDSHFSYRFVF"
FT   gene            485251..485505
FT                   /locus_tag="SAK_0543"
FT   CDS_pept        485251..485505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN59402.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44657"
FT                   /protein_id="ABA44657.1"
FT                   /translation="MSYEQEFLKDFEEWLQSQISINQMAMDSAKKVLEEDRDERAADAY
FT                   IRYESKLDAYRFLQGKFNNYHNQKSFHDLPDGLFGQRHY"
FT   gene            485614..485925
FT                   /locus_tag="SAK_0544"
FT   CDS_pept        485614..485925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63680.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45752"
FT                   /protein_id="ABA45752.1"
FT                   /translation="MAKRIKPNKKRELLKAKGINWKDVRLSQTLQEVASPKKKAPEAPK
FT                   AVDLLEGLTANKQDVLKEAGLVSLEAFAKVSEADVLALKGIGPAAIKQLVDNGVVFAK"
FT   gene            486193..486771
FT                   /locus_tag="SAK_0545"
FT   CDS_pept        486193..486771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0545"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44745"
FT                   /protein_id="ABA44745.1"
FT                   /translation="MQILEDFDGKALPKLETDRLILRQRTVGDVPAMFDYVCLEEVAYP
FT                   AGLSPIASLEDEYDYFENRYYQNLEKAKLPSGYGITVKGSDRIIGSCDFNHRHEDDVFE
FT                   IGYMLHPDYWGHGYMTEAVAALIEVGFTLLNLHKIEIRCYDYNKQSQRVAEKLGFTLEA
FT                   TIRDRKDNQGNRCVNLIYGLLRSEWEGRK"
FT   gene            486768..487460
FT                   /locus_tag="SAK_0546"
FT   CDS_pept        486768..487460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45683"
FT                   /protein_id="ABA45683.1"
FT                   /translation="MNDFFNWLITLYNDDKVAFVSLCLTLVFGFFSWLAQLKRNKQDDI
FT                   RQAEQDEFNRLAQDELKEFQSFQKKFAEYQQKVSELQFNFESQENFKPYFEFSKTKSST
FT                   YVEEGKLIARICLTNVGRGTATKITTNPIDYDQDGNPMYFRTIPTKQTHAIYDYFSETF
FT                   AIPNDSIFLSTTALEQTENQNHCIEFKIKFCDSSGRTYEQKFEFGYDNFLVRGINLKSV
FT                   TYEPTLIK"
FT   gene            487482..490136
FT                   /gene="valS"
FT                   /locus_tag="SAK_0547"
FT   CDS_pept        487482..490136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SAK_0547"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by similarity to SP:P36420; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44498"
FT                   /db_xref="GOA:Q3K2S4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2S4"
FT                   /protein_id="ABA44498.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQTWLDQDVFKPSGDAEAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGIS
FT                   RYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YNRGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGQNVILPIINKPIPIVADEHADPEFGTGVVKITPAHDP
FT                   NDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIEKMT
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMEN
FT                   VHDWVISRQLWWGHQIPAWYNVNGEMYVGEDAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEE
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDQARENVEKVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVVTRSVLLYTLDQILRLLHPIMPFVT
FT                   EEIFGQYAEGSIVLASYPQVNATFENQTAHKGVESLKDLIRSVRNSRAEVNVAPSKPIT
FT                   ILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAITAPELAMTSIITGAEIFLPLADL
FT                   LNVEEELARLEKELAKWQKELNMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTKYDAT
FT                   IARIEEMKKINND"
FT   gene            complement(490372..491301)
FT                   /locus_tag="SAK_0548"
FT   CDS_pept        complement(490372..491301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB47518.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44788"
FT                   /protein_id="ABA44788.1"
FT                   /translation="MSNEKLINKNHSQLDFVNIPINKDVKLFLDPTKLHSKNLSSVFEN
FT                   AALKLHSFFLEAYRLYTEFGENEVRNILCFSSECNFIHLGYSKSKSRGKGVSEKMLFNF
FT                   FKKISGFTPSERKNLLHPTSIAIFVPKFAEDRTSDFLVSLLKKEIVEYSLEQAKLHQLR
FT                   IEYSKYDFGHYWDDISLSWKTIKHFYIKANDRPILLIPKCLVSKKYKFSTSHFVKTIIF
FT                   PNKKNLEKYQGINGYDKSNRPKPATQKQLIEHEIRSPYLNCPDKWKTYAMEQLLQNHNW
FT                   YNEYFLNMNNFADNHIIPDDELDSLTNN"
FT   gene            491718..492677
FT                   /locus_tag="SAK_0549"
FT   CDS_pept        491718..492677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0549"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44974"
FT                   /protein_id="ABA44974.1"
FT                   /translation="MSKVRYGVVSTAKVAPRFIEGVRLAGNGEVVAVSSRTLESAQAFA
FT                   NKYHLPKAYDKLEDMLADESIDVIYVATINQDHYKVAKAALLAGKHVLVEKPFTLTYDQ
FT                   ANELFALAESCNLFLMEAQKSVFIPMTQVIKKLLASGEIGEVISISSTTAYPNIDHVTW
FT                   FRELELGGGTVHFMAPYALSYLQYLFDATITHASGTATFPKGQSDSQSKLLLQLSNGVL
FT                   VDIFLTTRLNLPHEMIIYGTEGRLIIPHFWKTTHAKLVRNDTSARTIQVDMVSDFEKEA
FT                   YHVSQMILEGQRVSHIMTPQLTLSGVKIIEDLYRSWGK"
FT   gene            492838..493740
FT                   /locus_tag="SAK_0550"
FT   CDS_pept        492838..493740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0550"
FT                   /product="metal ion transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45893"
FT                   /protein_id="ABA45893.1"
FT                   /translation="MFSSDFGFEIINVDDLSLQEEKFLPSELLAYARDENESSFVRDIE
FT                   EHLTLVYQLLDTQGHVDDVRHVPRVIPVTLFLKEDGLFVLANHKNINLVKKALNRVEKV
FT                   DSPKHLLLSLVTAFSKQYFDVLDTISEERDKLINDLRKRPNKSNLARLANLQSGTVHLM
FT                   MGTKQNFEMLTDLQNIEQDKENTRNEKMQLQDAIIEARQLSNMCSLNSQVFQELSSSYN
FT                   NVLSNNLNDNVTTLTIISIGISIIAMVTSFYGMNVKLPFDSVDAVWVLIILITTIITIM
FT                   LSIVMYIYVHKEDNHPKHK"
FT   gene            493900..494964
FT                   /locus_tag="SAK_0551"
FT   CDS_pept        493900..494964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58254.1; match to
FT                   protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44738"
FT                   /protein_id="ABA44738.1"
FT                   /translation="MSIESDFFRKKRFIFSSLEEFGFIKSDQEYIYCQTFMDNDFKAII
FT                   TISLDGKIAGKVIDLALEEEYLPLRAANYNGSFVGEVRSAYMAILGDISDSCCKDLLFT
FT                   KDQSNRLAEKIAKTFEDSVDYPFAKHPQYASYRVSGKWYALLFPSKMGKLENVPAQLSE
FT                   EEVEVLNIKVNPQDMEILLQKEGVYPSYHMSKKTWVSIVLDNTLSDIEIFKLVSDSRKL
FT                   VSPNKKSNSEPEFWIIPANPKFYDIDKEFAEHQLIDWTQKGKIAVGDYVFIYITAPIRA
FT                   LRYVCQVIERDLKTSTYLGAREVKAYMRLKLIRQFEDSTYPVAFLAEHGVKTVRGPRRM
FT                   TKELRQVMAKTILE"
FT   gene            495079..496071
FT                   /gene="asnA"
FT                   /locus_tag="SAK_0552"
FT   CDS_pept        495079..496071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="SAK_0552"
FT                   /product="aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="identified by match to protein family HMM PF03590;
FT                   match to protein family HMM TIGR00669"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45608"
FT                   /db_xref="GOA:Q3K2R9"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2R9"
FT                   /protein_id="ABA45608.1"
FT                   /translation="MKKSFIHQQQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGMQ
FT                   DNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDED
FT                   SLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFDIESILPK
FT                   RITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWT
FT                   TPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEDRLEFEWHKT
FT                   LLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFENIL"
FT   gene            complement(496116..496565)
FT                   /locus_tag="SAK_0553"
FT   CDS_pept        complement(496116..496565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46289"
FT                   /protein_id="ABA46289.1"
FT                   /translation="MIKKLLLSLIAILCLTTLKSNLSSADTMTISQQQYQHMITNSDLI
FT                   AITDKALVSKSQQSEATIFIGRPTCQYCRAFLPKLLKSQATLHSKIYYLDSQKYKGKRL
FT                   KSFFKKHHITTVPNLAHYQRGKMTKYLVQGSQATPQQIQTFLSQK"
FT   gene            496697..497236
FT                   /locus_tag="SAK_0554"
FT   CDS_pept        496697..497236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0554"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45818"
FT                   /protein_id="ABA45818.1"
FT                   /translation="MRVVAGTFGGRPLKTLDGKTTRPTTDKVKGAIFNMIGPFFEGGRV
FT                   LDLFSGSGSLAIEAISRGMDQAVLVEKDRRAQVVIQENIAMTKSPEQFQLLKMEANRAL
FT                   EQLTGQFDLVLLDPPYAKEEIVKQIQIMDSKGLLGDDIMIVCETDKSVDLPEEIASFGI
FT                   WKQKIYGISKVTVYVR"
FT   gene            497535..498020
FT                   /gene="coaD"
FT                   /locus_tag="SAK_0555"
FT   CDS_pept        497535..498020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="SAK_0555"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46072"
FT                   /db_xref="GOA:Q3K2R6"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2R6"
FT                   /protein_id="ABA46072.1"
FT                   /translation="MTKKALFTGSFDPVTNGHLDIIERASYLFDHVYIGLFYNLEKQGY
FT                   FSIECRKKMLEEAIRQFKNVSVLVAQDRLAVDLAREVGAKYFVRGLRNSQDFDYEANLE
FT                   FFNKQLADDIETVYLSTSPSLSPISSSRIRELIHFKASVKPFVPKSVVREVEKMSEE"
FT   gene            498010..499083
FT                   /locus_tag="SAK_0556"
FT   CDS_pept        498010..499083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58262.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45222"
FT                   /protein_id="ABA45222.1"
FT                   /translation="MKNKDPKRKHKSLLGLLKWWIIGFAFLLLVLASLVVRLPYYLEMP
FT                   GGAYDIRSVLKVNKKADKAKGSYNFVAVSVSQATPAQVLYAWLTPFTELSSKEETTGGF
FT                   SNDDYLRINQFYMETSQNESVYQALKLANKQVSLTYKGVYVLNLAKNSTFKDRLHLADT
FT                   VTGVNGKSFKNSSQLIKYVAALHLGDKVKVQYTSQGKKKESVGKVIKLSNGKNGIGIGL
FT                   TDHTEVSSNVPVDFNTEGVGGPSAGLMFTLAIYDQLVKEDLRKGRKIAGTGTIEQNGHV
FT                   GDIGGAGLKVVSAAKKGMDIFFVPNNPIDKNAKKGKTKVQTNYQEAKAAAKRLGTKMKI
FT                   VPVQNVQQAIDYLKKTK"
FT   gene            499158..500492
FT                   /locus_tag="SAK_0557"
FT   CDS_pept        499158..500492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0557"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46337"
FT                   /protein_id="ABA46337.1"
FT                   /translation="MTELIRILHLNDLHSHFENFPKVKRFFHDNQAQPIETISLDLGDN
FT                   IDKSHPLTEASSGKANVQLMNELGIELATIGNNEGVGLSKKDLDQVYKDSDFTVIVGNL
FT                   KDNIIKPSWAKPYIIYETQQGTKLAFLAYTFPYYKTYEPNGWTIEDPIDCLKCHLQINE
FT                   IKEANCRILMSHLGIRFDTRIAQEFSEIDLIIGAHTHHLFEEGELIKGTYLAAAGKYGR
FT                   FVGSIDITFDNHTLKDILISTYDTKQLTGYPSDSDWAKKIESEGKEQLRKVSLISFPAP
FT                   LSLEESCQLVMDAMLFYAGADVAIINSGLIVQPFGKDFSRKNLHESLPHQMRLAKLTVS
FT                   SQELLEIYETIYQQGQFLAQQKIHGMGFRGKYFGEVLHSGFDYKNGKIVYNEKDIDAKE
FT                   EVILVIVDQYYFASYFECLKTKKVDLLFPELLRDVVADYLINMTL"
FT   gene            500561..501139
FT                   /locus_tag="SAK_0558"
FT   CDS_pept        500561..501139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06265"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45349"
FT                   /protein_id="ABA45349.1"
FT                   /translation="MRKEVTPEMLNYNKYPGPQFIHFENIVKSDDIEFQLVINEKSAFD
FT                   VTVFGQRFSEILLKYDFIVGDWGNEQLRLRGFYKDASTIRKNSRISRLEDYIKEYCNFG
FT                   CAYFVLENPNPRDIKFDDERPHKRRKSRSKSQSSKSQTRNNRSQSNANAHFTSKKRKDT
FT                   KRRQERHIKEEQDKEMTSAKQHFVIRKKK"
FT   gene            501190..502296
FT                   /locus_tag="SAK_0559"
FT   CDS_pept        501190..502296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0559"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44695"
FT                   /db_xref="GOA:Q3K2R2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2R2"
FT                   /protein_id="ABA44695.1"
FT                   /translation="MPKKTDTPDYKPSIYSLTRDELIAWAIEHGEKKFRASQIWDWLYK
FT                   KRVQSFDEMTNISKDFIALLNENFVVNPLKQRIVQESADGTVKYLFELPDGMLIETVLM
FT                   RQHYGLSVCVTTQVGCNIGCTFCASGLIKKQRDLNNGEITAQIMLVQKYFDERGQGERV
FT                   SHIVVMGIGEPFDNYTNVLKFLRTVNDDNGLAIGARHITVSTSGLAHKIREFANEGVQV
FT                   NLAVSLHAPNNELRSSIMRINRSFPLEKLFAAIEYYIETTNRRVTFEYIMLNGVNDTPE
FT                   NAQELADLTKKIRKLSYVNLIPYNPVSEHDQYSRSPKERVEAFYDVLKKNGVNCVVRQE
FT                   HGTDIDAACGQLRSNTMKRDRQKAKVGQ"
FT   gene            502296..502811
FT                   /locus_tag="SAK_0560"
FT   CDS_pept        502296..502811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0560"
FT                   /product="VanZ family protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44897"
FT                   /protein_id="ABA44897.1"
FT                   /translation="MLKRLLTEDGELTKISRRFVWMLVIIYCLIIVRMCFGPQIMIEGV
FT                   STPNVQRFGRIVALLVPFNSFRSLDQLTSFKEIFWVIGQNVVNILLLFPLIIGLLSLKP
FT                   SLRKYKSVILLAFLMSLFIECTQVVLDILIDANRVFEIDDLWTNTLGGPFALWTYRNIK
FT                   GWLLTIRK"
FT   gene            503007..504752
FT                   /locus_tag="SAK_0561"
FT   CDS_pept        503007..504752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0561"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44414"
FT                   /protein_id="ABA44414.1"
FT                   /translation="MSIIKNLWWFFKEEKKRYLIGILSLSLVAVLNLIPPKIMGSVIDA
FT                   ITTGKLTRPQLLWNLLGLVLSALAMYGLRYIWRMYILGTSYKLGQVVRYRLFEHFTKMS
FT                   PSFYQKYRTGDLMAHATNDINSLTRLAGGGVMSAVDASITALVTLITMFFTISWQMTLI
FT                   AVIPLPLMALATSKLGRKTHETFKESQAAFSELNNKVQESVSGVKVTKSFGYQEQEIAS
FT                   FQEVNQMTFVKNMRTMTYDVMFDPLVLLFIGASYVLTLAMGAFMISKGQVTVGDLVTFV
FT                   TYLDMLVWPLMAIGFLFNMVQRGSVSYNRINSLLEQESDITDPLNPIKPVVNGTLRYDI
FT                   DFFRYDNEETLADIHFTLEKGQTLGLVGQTGSGKTSLIKLLLREHDVTQGKITLNKHDI
FT                   RDYRLSDLRQLIGYVPQDQFLFATSILENVRFGNPTLSINAVKKATKLAHVYDDIEQMP
FT                   AGFETLIGEKGVSLSGGQKQRIAMSRAMILDPDILILDDSLSAVDAKTEHAIIENLKTN
FT                   RQGKSTIISAHRLSAVVHADLILVMQDGRVIERGQHQELLNKGGWYAETYASQQLEMEE
FT                   AFDEV"
FT   gene            504742..506481
FT                   /locus_tag="SAK_0562"
FT   CDS_pept        504742..506481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0562"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45837"
FT                   /protein_id="ABA45837.1"
FT                   /translation="MKSNQWQVFKRLISYLRPYKWFTVLALSLLLLTTVVKNIIPLIAS
FT                   HFIDHYLTNVNQTAVLILVGYYSMYVLQTLIQYFGNLFFARVSYSIVRDIRRDAFANME
FT                   RLGMSYFDRTPAGSIVSRITNDTEAISDMFSGILSSFISAIFIFTVTLYTMLMLDIKLT
FT                   GLVALLLPVIFILVNVYRKKSVTVIAKTRSLLSDINSKLSESIEGIRIVQAFGQEERLK
FT                   TEFEEINKEHVVYANRSMALDSLFLRPAMSLLKLLAYAVLMAYFGFTGVKGGLTAGLMY
FT                   AFIQYVNRLFDPLIEVTQNFSTLQTSMVSAGRVFDLIDETGFEPSQKNTEAFVREGNIE
FT                   FKNVSFSYDGKKQILDNVSFSVKKGETIAFVGATGSGKSSIINVFMRFYEFQSGQVLLD
FT                   GKDIRDYSQEQLRKNIGLVLQDPFLYHGTIKSNIKMYQDITDQEVQDAAEFVDADQFIQ
FT                   KLPDKYDAAVSERGSSFSTGQRQLLAFARTVASKPKILILDEATANIDSETEQIVQDSL
FT                   AKMRQGRTTIAIAHRLSTIQDANCIYVLDRGKIIESGNHESLLDLKGTYYRMYQLQAGM
FT                   MEV"
FT   gene            506609..507175
FT                   /locus_tag="SAK_0563"
FT   CDS_pept        506609..507175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0563"
FT                   /product="glutamine amidotransferase"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44604"
FT                   /protein_id="ABA44604.1"
FT                   /translation="MLLLVDNYDSFTYNLKQYLSVYKEVFVIKNDDPNLFLLAESAEAI
FT                   VLSPGPGHPKDAGKMVELINQFIGKKPILGICLGHQALAECLGGRLNLANHVMHGKQSW
FT                   VTINDHTSLFKGIDSPTQVMRYHSLVVTDLPENIAVIARSNEDNEIMAFHCPSLKVYAM
FT                   QFHPESIGSIDGMKMIENFLTLIND"
FT   gene            complement(507187..508677)
FT                   /locus_tag="SAK_0564"
FT   CDS_pept        complement(507187..508677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0564"
FT                   /product="ISSag8, transposase"
FT                   /note="The translational stop site for this transposase
FT                   gene is located outside the IS element.; identified by
FT                   match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46182"
FT                   /protein_id="ABA46182.1"
FT                   /translation="MFHKENPDYNRNQVGFYSLDELVPKDHLLRQIDEAIDFSFIYDLV
FT                   KDSYCADNGRPSLDPVMLVKIPMIQCLFGIRSMRQTIKDIEVNVAYRWFLGLTLEDKVP
FT                   HFTTYGKNYNRRFQDKQVIEAIFAYILGLCLNAGLIDPTDIFVDGTHIKAAANNHKYIN
FT                   QEVDAQAKFMSDQLEKEIAKDREKHGKKSLGIAKEKEPISKKISTTDPDSGWFHKGEHK
FT                   QVFAYNAQVACDKYGWALGYSIHAGNVHDSQAFPELFDKIKALTPHYLIADSGYKTPSI
FT                   AHYLLTIGIIPVFSYTRPRSKKGMLRLKDFIYDEYYDVYLCPENHPLSYSTTTRDGYRE
FT                   YKSNPAVCQSCPLLSVCTQSKNHQKVITRHLWKDDLEVCEDIRHQRGMKERYQQRKETI
FT                   ERLFGTAKEYHNLRYTRLRGKSKMEATLGLTLACLNMKKYSKIMAGIVFLVCLKVIISR
FT                   PIVITIVKEKTSWINIPVCLQSETVPKVLSFIYRESLS"
FT   gene            complement(508803..509342)
FT                   /locus_tag="SAK_0565"
FT   CDS_pept        complement(508803..509342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0565"
FT                   /product="BioY family protein"
FT                   /note="identified by similarity to GB:AAN59451.1; match to
FT                   protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45160"
FT                   /protein_id="ABA45160.1"
FT                   /translation="MKTRTTTYIALMVALLIVLGFIPGIPLGFIPVPIVLQNLGVMLAG
FT                   ALLGSRKGFLAVAIFLLLVAIGAPFLPGGRSGLVTLFGPTAGYLLTYPFAAFFIGLGLE
FT                   KVKTTKLWVQFLIIWIFGVLLIDICGSIVLSFQTSLPLTKSLFSNLIFIPGDTLKASIC
FT                   LIIYRKFANRLTHLYN"
FT   gene            complement(509343..510335)
FT                   /gene="bioB"
FT                   /locus_tag="SAK_0566"
FT   CDS_pept        complement(509343..510335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="SAK_0566"
FT                   /product="biotin synthetase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by similarity to SP:P53557; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   PF06968"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46073"
FT                   /db_xref="GOA:Q3K2Q5"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2Q5"
FT                   /protein_id="ABA46073.1"
FT                   /translation="MSFQTNYIHLADEILSGKTSISYEQALEILNSDENWWEIYAAALY
FT                   LKNQVSRNNIRLNVLLSAKQGLCAENCGYCSQSKESTADIDKFGLLPQNVILKQAIVAH
FT                   QNGASVFCIAMSGTKPSKREIEQLCQVIPEIKKSLPLEICLTAGFLDREQLHQLKQAGI
FT                   DRINHNLNTPEENYPNIATTHSFKDRCDTLERIHNEDIDVCSGFICGMGESDEGLITLA
FT                   FRLKELDPYSIPVNFLLAVEGTPLGKYNYLTPIKCLKIMAMLRFVFPFKELRLSAGREV
FT                   HFENFESLVTLLVDSTFLGNYLTEGGRNQHTDIEFLEKLQLNHTKKELI"
FT   gene            510460..510954
FT                   /locus_tag="SAK_0567"
FT   CDS_pept        510460..510954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97281.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44902"
FT                   /protein_id="ABA44902.1"
FT                   /translation="MKKLFKKAIAMCRDLPLNFVIVELSLYQREDGSSDNIKWISKRIL
FT                   EVTVTDQQWIYHLRMLNLPKLKPMSLASSDCPAREEKASLISIEECQKFTSLVRDKNPF
FT                   HQGEAAIVPAALLLEKIMEVRKGKIKEIHLTFLSPVRVNQEFSVQVVDNTVIIFQHQIL
FT                   W"
FT   gene            510964..512079
FT                   /locus_tag="SAK_0568"
FT   CDS_pept        510964..512079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0568"
FT                   /product="acetyl-CoA acetyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45986"
FT                   /protein_id="ABA45986.1"
FT                   /translation="MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESE
FT                   SNIDSIICGNTVGTGGNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGI
FT                   NEKVLVGGIESSSLQPMRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFR
FT                   REMLDKLAFLSHKRALTAKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPL
FT                   LTIGNVCLMHDAAAFLTLQSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKI
FT                   SDYDAIEWNEPFAAIDALFNHYYPEEREKFNIFGGTLAYGHPYACSGIINILHLMQALK
FT                   YKNKPMGLTAIAGAGGVGMAISIEYLGVKNA"
FT   gene            512072..513301
FT                   /locus_tag="SAK_0569"
FT   CDS_pept        512072..513301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97283.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45761"
FT                   /protein_id="ABA45761.1"
FT                   /translation="MLESLKTIVKTNSDKKLFDGDLQVSYGEFYNLVRQDMASQDNRKH
FT                   VISTHSLLNQLVRFVSKLCQKALPIICKPNLTHNEISRLEKEVQYAPQLADFGVLSSGT
FT                   TADAKLLWRSFTSWSDFFSIQNAYFSVTSNSKLFIQGDFSFTGNLNLALSLLLLGGTLV
FT                   VTQKNSVKYWQTLWEKTGVTHLYLLPSYLKLVEQYSKETALDNKTIITSSQYVSDSLLE
FT                   GLYRKHPKVSVKIFYGASELNYVSWYDGRDIRDKPQYVGEIVPNVAVRIKEGRIFVKTP
FT                   YSICGLSSEYCAGDYGELIDGKLYLFGRGGDWCNQSGIKLYLPRLIEKIKTCPYIKDAV
FT                   AFTKESQSHGQESHCCIVLIENQMQQECLKWLSEHFEKKYGFKHYHIVSKIPLMPSGKI
FT                   DYQQLKRQLA"
FT   gene            513414..514046
FT                   /gene="nth"
FT                   /locus_tag="SAK_0570"
FT   CDS_pept        513414..514046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="SAK_0570"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44631"
FT                   /protein_id="ABA44631.1"
FT                   /translation="MLSKAKSRYIIREIIKLFPDAKPSLDFTNVFELLVAVMLSAQTTD
FT                   AAVNKVTPALFERFPNPLVLAQADPKEIEPYISKIGLYRNKARFLNQCAKQLIEHFDGK
FT                   VPRTRQELESLAGVGRKTANVVMSVGFGIPAFAVDTHVTRICKHHQICKQSASPLEIEK
FT                   RVMEVLPPEEWLAAHQSMIYFGRAICHPKNPKCDQYPQLYHFPDNLK"
FT   gene            complement(514047..514436)
FT                   /locus_tag="SAK_0571"
FT   CDS_pept        complement(514047..514436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0571"
FT                   /product="peptidase, A24A (type 4 prepilin peptidase 1)
FT                   subfamily"
FT                   /EC_number="3.4.23.-"
FT                   /note="identified by match to protein family HMM PF01478"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46084"
FT                   /protein_id="ABA46084.1"
FT                   /translation="MSTIYFISLCMSFILSYYDIKYQEYPIFLWILFTISTIILTPITK
FT                   VSIVLCLFGILAEVVDINIGSGDFLYLATIGLSLPLHQMLFIIQIGAWLGIIYCLVMRK
FT                   MKKTIAFLPFLSIAYIIVTSYSLLF"
FT   gene            514597..514806
FT                   /locus_tag="SAK_0572"
FT   CDS_pept        514597..514806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM79788.1; match to
FT                   protein family HMM PF06014"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44828"
FT                   /protein_id="ABA44828.1"
FT                   /translation="MKVLFDVQNLLKKFGIYVYIGKRLYDIEVMKIELQRLYDNGLISR
FT                   DDYLKAELILRREHRLELEKENKK"
FT   gene            514803..515771
FT                   /locus_tag="SAK_0573"
FT   CDS_pept        514803..515771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0573"
FT                   /product="glucokinase, putative"
FT                   /note="identified by similarity to SP:P54495; match to
FT                   protein family HMM PF00480; match to protein family HMM
FT                   TIGR00744"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46158"
FT                   /protein_id="ABA46158.1"
FT                   /translation="MSKKLLGIDLGGTTIKFGILTLEGEVQEKWAIETNTLENGRHIVS
FT                   DIVESLKHRLSLYGLTKDDFLGIGMGSPGAVDRTSKTVTGAFNLNWADTQEVGSVIEKE
FT                   VGIPFFIDNDANVAALGERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGE
FT                   IGHMIVDPENGFTCTCGNKGCLETVASATGVVRVARQLAEQYEGSSAIKAAIDNGDTVT
FT                   SKDIFIAAEDGDKFANSVVERVSRYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRV
FT                   EKYFVTFAFPQVKKSTKIKIAELGNDAGIIGAASLANQQAS"
FT   gene            515783..516163
FT                   /locus_tag="SAK_0574"
FT   CDS_pept        515783..516163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0574"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45004"
FT                   /protein_id="ABA45004.1"
FT                   /translation="MDMSVILIIVILLAFVAWASWNYWRVRRAAKFLDNESFQKEMSRG
FT                   QLIDIREAGAFHRKHILGARNIPASQFKVALSALRKDKPVLLYDASRGQSIPRIVLLLR
FT                   KEGFNQLYVLKDGFNYWTGRVK"
FT   gene            516395..518236
FT                   /gene="typA"
FT                   /locus_tag="SAK_0575"
FT   CDS_pept        516395..518236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="SAK_0575"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46310"
FT                   /protein_id="ABA46310.1"
FT                   /translation="MTNLRTDIRNVAIIAHVDHGKTTLVDELLKQSHTLDERKELEERA
FT                   MDSNDIEKERGITILAKNTAVAYNDVRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQNLIPIVVVNKIDKPSARPSEVVDEVLELFIELGADDDQLDF
FT                   PVVYASAINGTSSMSDDPSDQEKTMVPIFDTIIDHIPAPVDNSEEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERKEIQEAKAGDLIAV
FT                   SGMEDIFVGETVTPTDAIEPLPVLRIDEPTLQMTFLVNNSPFAGREGKWITSRKVEERL
FT                   LAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIIKEIDG
FT                   VQCEPFERVQIDTPEEYQGAIIQSLSERKGDMLDMQMVGNGQTRLIFLIPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPVVQGEIGGRHRGALVSIENGKATTYSIMRIEERGTIFV
FT                   NPGTEVYEGMIVGENSRDNDLGVNITTAKQMTNVRSATKDQTAVIKTPRILTLEESLEF
FT                   LADDEYMEVTPESIRLRKQILNKAARDKANKKKKSAE"
FT   gene            518281..518526
FT                   /locus_tag="SAK_0576"
FT   CDS_pept        518281..518526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63780.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45342"
FT                   /protein_id="ABA45342.1"
FT                   /translation="MFYLIVALLITLYYFFMAPKTVRNTLNAIGLVGLVALLLVLAVMS
FT                   FIKILQLPGELYIGLIMIPLGYTAFKETLNLSEKKK"
FT   gene            518656..520011
FT                   /gene="murD"
FT                   /locus_tag="SAK_0577"
FT   CDS_pept        518656..520011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SAK_0577"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by similarity to SP:Q03522; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45627"
FT                   /db_xref="GOA:Q3K2P4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2P4"
FT                   /protein_id="ABA45627.1"
FT                   /translation="MKTITTFENKKVLVLGLARSGEAAARLLAKLGAIVTVNDGKPFDE
FT                   NPTAQSLLEEGIKVVCGSHPLELLDEDFCYMIKNPGIPYNNPMVKKALEKQIPVLTEVE
FT                   LAYLVSESQLIGITGSNGKTTTTTMIAEVLNAGGQRGLLAGNIGFPASEVVQAANDKDT
FT                   LVMELSSFQLMGVKEFRPHIAVITNLMPTHLDYHGSFEDYVAAKWNIQNQMSSSDFLVL
FT                   NFNQGISKELAKTTKATIVPFSTTEKVDGAYVQDKQLFYKGENIMSVDDIGVPGSHNVE
FT                   NALATIAVAKLAGISNQVIRETLSNFGGVKHRLQSLGKVHGISFYNDSKSTNILATQKA
FT                   LSGFDNTKVILIAGGLDRGNEFDELIPDITGLKHMVVLGESASRVKRAAQKAGVTYSDA
FT                   LDVRDAVHKAYEVAQQGDVILLSPANASWDMYKNFEVRGDEFIDTFESLRGE"
FT   gene            520014..521090
FT                   /gene="murG"
FT                   /locus_tag="SAK_0578"
FT   CDS_pept        520014..521090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SAK_0578"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45335"
FT                   /db_xref="GOA:Q3K2P3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2P3"
FT                   /protein_id="ABA45335.1"
FT                   /translation="MGKKIVFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHE
FT                   QINQSGLDITFHSIATGKLRRYFSWQNMLDVFKVGVGVLQSIAIIAKLRPQALFSKGGF
FT                   VSVPPVVAARLLKVPVFVHESDLSMGLANKIAYKFATIMYTTFEQSKDLIKTKHIGAVT
FT                   KVMDCKKSFENTDLTSIKEAFDPNLKTLLFIGGSAGAKVFNDFITQTPELEEKYNVINI
FT                   SGDSSLNRLKKNLYRVDYVTDLYQPLMNLADVVVTRGGSNTIFELVAMKKLHLIIPLGR
FT                   EASRGDQLENAAYFEEKGYALQLPESELNINTLEKQINLLISNSESYEKNMSQSSEIKS
FT                   QDEFYQLLIDDMAKVTKG"
FT   gene            521094..522230
FT                   /gene="divIB"
FT                   /locus_tag="SAK_0579"
FT   CDS_pept        521094..522230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /locus_tag="SAK_0579"
FT                   /product="cell division protein DivIB"
FT                   /note="identified by similarity to SP:P16655; match to
FT                   protein family HMM PF03799"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46053"
FT                   /protein_id="ABA46053.1"
FT                   /translation="MPKKKSDTPEKEEVVLTEWQKRNLEFLKKRKEDEEEQKRINEKLR
FT                   LDKRSKLNISSPEEPQNTTKIKKLHFPKISRPKIEKKQKKEKIVNSLAKTNRIRTAPIF
FT                   VVAFLVILVSVFLLTPFSKQKTITVSGNQHTPDDILIEKTNIQKNDYFFSLIFKHKAIE
FT                   QRLAAEDVWVKTAQMTYQFPNKFHIQVQENKIIAYAHTKQGYQPVLETGKKADPVNSSE
FT                   LPKHFLTINLDKEDSIKLLIKDLKALDPDLISEIQVISLADSKTTPDLLLLDMHDGNSI
FT                   RIPLSKFKERLPFYKQIKKNLKEPSIVDMEVGVYTTTNTIESTPVKAEDTKNKSTDKTQ
FT                   TQNGQVAENSQGQTNNSNTNQQGQQIATEQAPNPQNVN"
FT   gene            522502..523875
FT                   /gene="ftsA"
FT                   /locus_tag="SAK_0580"
FT   CDS_pept        522502..523875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SAK_0580"
FT                   /product="cell division protein FtsA"
FT                   /note="identified by similarity to SP:P28264; match to
FT                   protein family HMM PF02491; match to protein family HMM
FT                   TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44923"
FT                   /protein_id="ABA44923.1"
FT                   /translation="MARNGFFTGLDIGTSSIKVLVAEFIANEMNVIGVSNVPSSGVKDG
FT                   IIIDIEAAATAIKEAVKQAEEKAGITIDKINVGLPANLLQIEPTQGMIPVPNESKEIKD
FT                   EDVESVVKSALTKSITPEREVISLIPLEFIVDGFQGIRDPRGMMGIRLEMRGLIYTGPT
FT                   TILHNLRKTVERAGIKVEHVVIAPLALAKSVLNEGEREFGATVIDMGGGQTTVASMRNQ
FT                   ELQYTNIYSEGSDYVTKDISKVLRTTVEIAEALKFNFGQANVEEASTSDTVQVNVVGNE
FT                   EPVEITESYLSQIISGRIRQILEHVKQDLGRGRLLDLPGGIILVGGGAIMPGVVEVAQQ
FT                   IFGTRVKLHVPNQVGIRNPMFANVISIVDYVGMMSEVDIIAQHAVTGDEMLRHKPVDFD
FT                   YKEKTNTMSTMPYSEPLTSSMEDSNLEPIRARENAQEPTEPKANIGERIRGIFGSMFD"
FT   gene            523897..525177
FT                   /gene="ftsZ"
FT                   /locus_tag="SAK_0581"
FT   CDS_pept        523897..525177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SAK_0581"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by similarity to SP:P17865; match to
FT                   protein family HMM PF00091; match to protein family HMM
FT                   PF03953; match to protein family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44430"
FT                   /protein_id="ABA44430.1"
FT                   /translation="MVFSFDTASVQGAVIKVIGVGGGGGNAINRMIDEGVAGVEFIAAN
FT                   TDIQALSSSKAETVIQLGPKLTRGLGAGGQPEVGRKAAEESEEVLTEALTGADMVFITA
FT                   GMGGGSGTGAAPVIARIAKSLGALTVAVITRPFGFEGNKRSNFAIEGIQELREQVDTLL
FT                   IISNNNLLEIVDKKTPLLEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTVMANK
FT                   GNALMGIGIGSGEERITEAARKAIYSPLLETTIDGAEDVIVNVTGGMDMTLTEAEEASE
FT                   IVSQAAGKGVNIWLGTSIDMDMKDEIRVTVVATGVRKDKTNQVSGFTTSAPTNQAPSER
FT                   QSTSNSNFDRRGNFDMTESREMPTQQNQPHAQNQQQSSAFGNWDLRRDNISRPTEGELD
FT                   SKLSMSTFSENDDMDDELETPPFFKNR"
FT   gene            525183..525857
FT                   /locus_tag="SAK_0582"
FT   CDS_pept        525183..525857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0582"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45825"
FT                   /protein_id="ABA45825.1"
FT                   /translation="MMNLQENKTAIFDNVSKLALKAGRAHESVHIVAVTKYVNCQTTEA
FT                   LIRTGVNHIGENRVDKFLEKYQALKDEKLTWHLIGSLQRRKVKDVINYVDYFHALDSVK
FT                   LAAEIQKRAQKPIKCFLQVNISREDSKHGFTIEQIDDALNLISRYDKIELIGIMTMAPL
FT                   KATKEEISSIFEETESLRKRLQARNIERMPFTELSMGMSRDYDIAIQNGSTFVRIGTSF
FT                   FK"
FT   gene            525869..526474
FT                   /locus_tag="SAK_0583"
FT   CDS_pept        525869..526474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63787.1; match to
FT                   protein family HMM PF04472"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45139"
FT                   /db_xref="GOA:Q3K2N8"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2N8"
FT                   /protein_id="ABA45139.1"
FT                   /translation="MALKDRFDKIISYFDTDDVSENEVHEVQERTSVQRDSRAATAQEA
FT                   SQRSHMTNSAEEEMIGSRPRTSTYDPNRQERQRVQRDNAYQQATPRVQNKDSVRQQREQ
FT                   VTIALKYPRKYEDAQEIVDLLIVNECVLIDFQYMLDAQARRCLDYIDGASRVLYGSLQK
FT                   VGSSMFLLTPANVMVDIEEMNIPKTGQETSFDFDMKRR"
FT   gene            526477..526731
FT                   /locus_tag="SAK_0584"
FT   CDS_pept        526477..526731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0584"
FT                   /product="YggT family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45499"
FT                   /protein_id="ABA45499.1"
FT                   /translation="MILVLLILLKTIRVYSYILLAYALLSWFPGAYDSWIGRLVVQIVD
FT                   PIIRPLRRFNLQFLGLDFTVIVAFFLLNMLSRFLILLFT"
FT   gene            526733..527521
FT                   /locus_tag="SAK_0585"
FT   CDS_pept        526733..527521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0585"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44858"
FT                   /protein_id="ABA44858.1"
FT                   /translation="MTLDDIYQHFRPEEYAFIHKIDHLAQYVENTYSFITTEFLNPREF
FT                   KILESVLERRGSHYYTSGQYFQTEYVKVIIAPEYYQLDMVDFNLSLIEIKYNAKFNHLT
FT                   HAKIMGTLLNYLGVKRSILGDILVEEGCAQVLVDSQMTNHLVHSVTKIGTASVQLAEVP
FT                   LSKLLTPKQDIQKLTVIASSLRLDKILATILKISRTQSTKLIEADKVKVNYATVNRVSE
FT                   QLVEGDLISVRGYGRFTLNHNLGLTKNQKYKLEVDKMIHN"
FT   gene            527531..528301
FT                   /locus_tag="SAK_0586"
FT   CDS_pept        527531..528301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0586"
FT                   /product="cell division protein DivIVA, putative"
FT                   /note="identified by similarity to GB:CAB06818.1; match to
FT                   protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46243"
FT                   /protein_id="ABA46243.1"
FT                   /translation="MPLTALEIKDKTFSSKFRGYSEEEVNEFLEIVVDDYEDLIRRNRE
FT                   QEQYIKDLEEKIAYFNEMKESLSQSVILAQETAERVKISAQDEASNLMGKATFDAQHLI
FT                   DEAKLKANQILRDATDDAKRVAIETEDLKRQSRVFHQRLLSELEGQLKLANSSAWEELL
FT                   KPTAIYLQNSDASFKEVVEKVLDEDDALPVVDDTESFDATRQFSPDEMEELQRRVEESN
FT                   KQLEESGLLDTNNFQMEEPINLGETQTFKLNIED"
FT   gene            528586..531378
FT                   /gene="ileS"
FT                   /locus_tag="SAK_0587"
FT   CDS_pept        528586..531378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SAK_0587"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by similarity to SP:P41972; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   PF06827; match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45845"
FT                   /db_xref="GOA:Q3K2N4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2N4"
FT                   /protein_id="ABA45845.1"
FT                   /translation="MKLKETLNLGQTAFPMRAGLPNKEPQWQEAWDQADIYKKRQALNE
FT                   GKPAFHLHDGPPYANGNIHVGHALNKISKDIIVRSKSMSGFRAPYVPGWDTHGLPIEQV
FT                   LAKKGVKRKEMDLAEYLEMCRDYALSQVDKQRDDFKRLGVSADWENPYITLTPDYEADQ
FT                   VRVFGAMADKGYIYRGAKPVYWSWSSESALAEAEIEYHDIDSTSLYYANKVKDGKGILD
FT                   TDTYIVVWTTTPFTVTASRGLTVGPDMEYVVVVPVGSERKYLLAEVLVDSLAAKFGWEN
FT                   FEIVTHHTGKELNHIVTEHPWDTEVEELVILGDHVTTDSGTGIVHTAPGFGEDDYNVGI
FT                   ANGLDVVVTVDSRGLMMENAGPDFEGQFYDKVTPLVKEKLGDLLLASEVINHSYPFDWR
FT                   TKKPIIWRAVPQWFASVSKFRQEILDEIEKTNFQPEWGKKRLYNMIRDRGDWVISRQRA
FT                   WGVPLPIFYAEDGTAIMTKEVTDHVADLFAEYGSIVWWQRDAKDLLPAGYTHPGSPNGL
FT                   FEKETDIMDVWFDSGSSWNGVMNARENLSYPADLYLEGSDQYRGWFNSSLITSVAVNGH
FT                   APYKAVLSQGFVLDGKGEKMSKSLGNTILPSDVEKQFGAEILRLWVTSVDSSNDVRISM
FT                   DILKQTSETYRKIRNTLRFLIANTSDFNPKQDAVAYENLGAVDRYMTIKFNQVVDTINK
FT                   AYAAYDFMAIYKAVVNFVTVDLSAFYLDFAKDVVYIEAANSPERRRMQTVFYDILVKLT
FT                   KLLTPILPHTAEEIWSYLEHEEEEFVQLAEMPVAQTFSGQEEILEEWSAFMTLRTQAQK
FT                   ALEEARNAKVIGKSLEAHLTIYASQEVKTLLTALNSDIALLMIVSQLTIADEADKPADS
FT                   VSFEGVAFTVEHAEGEVCERSRRIDPTTKMRSYGVAVCDASAAIIEQYYPEAVAQGFEA
FT                   "
FT   gene            complement(531495..531797)
FT                   /locus_tag="SAK_0588"
FT   CDS_pept        complement(531495..531797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63792.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44953"
FT                   /protein_id="ABA44953.1"
FT                   /translation="MRLINTTSSHPELVRNQLQNTDAKLVEVYSAGNTDVVFTKAPKHY
FT                   ELLISNKYRAIKDEELEAIREFFLKRKIDQSIIIQEQMKSLHTAKLIEISYPTTA"
FT   gene            complement(531861..532316)
FT                   /locus_tag="SAK_0589"
FT   CDS_pept        complement(531861..532316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0589"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45628"
FT                   /protein_id="ABA45628.1"
FT                   /translation="MTNPTFGKKIDNVNYRSRFGVYAIIPNPTHDKIILVQAPNGAWFL
FT                   PGGEIEENENHLEALTRELIEELGYSATIGHYYGQADEYFYSRHRDTYYYNPAYIYEVT
FT                   AYHKDQAPLEDFNHLAWFSIQEAKEKLKRGSHRWGVQAWEKNHHSRK"
FT   gene            complement(532502..534763)
FT                   /gene="clpE"
FT                   /locus_tag="SAK_0590"
FT   CDS_pept        complement(532502..534763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="SAK_0590"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpE"
FT                   /note="identified by similarity to GB:AAD01782.1; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02151; match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45259"
FT                   /protein_id="ABA45259.1"
FT                   /translation="MLCQNCKLNESTIHLYTNVNGKQKQVDLCQNCYQIIKTDPNNPLF
FT                   SGLNHVSHAPGGINPFFDDFFGDLNNFRAFNGQDLPNTPPTQSGGNRGGGNGNGRNNNR
FT                   NQTATPSQAKGILEEFGINVTEIARHGDIDPVIGRDSEIIRVIEILNRRTKNNPVLIGE
FT                   PGVGKTAVVEGLAQKIVDGNVPHKLQGKQVIRLDVVSLVQGTGIRGQFEERMQKLMEEI
FT                   RQRQDVILFIDEIHEIVGAGTAGEGSMDAGNILKPALARGELQLVGATTLNEYRIIEKD
FT                   AALERRMQPVKVDEPSVEETITILKGIQKKYEDYHHVKYNNDAIEAAAVLSNRYIQDRF
FT                   LPDKAIDLLDEAGSKMNLTLNFVDPKEIDQRLIEAENLKAQATREEDYERAAYFRDQIA
FT                   KYKEMQQQKVDDQDTPIITEKTIEHIIEEKTNIPVGDLKEKEQSQLINLADDLKQHVIG
FT                   QDDAVVKIAKAIRRNRVGLGSPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIR
FT                   FDMSEYMEKHAVAKLVGAPPGYVGYEEAGQLTEKVRRNPYSLILLDEIEKAHPDVMHMF
FT                   LQVLDDGRLTDGQGRTVSFKDTIIIMTSNAGSGKTEASVGFGASREGRTNSVLGQLGNF
FT                   FSPEFMNRFDGIIEFKALDKENLLNIVDIMLSDVNARLAINGIHLDVTDKVKEKLVDLG
FT                   YDPKMGARPLRRTIQEHIEDAITDYYLENPSEKELRAIMTSNGNIIIKSSKKTEESTKG
FT                   "
FT   gene            535061..535291
FT                   /locus_tag="SAK_0591"
FT   CDS_pept        535061..535291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34305.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46123"
FT                   /protein_id="ABA46123.1"
FT                   /translation="MESHLVRIINRLELMATDGGNLKRNFEREGVVVAEVSFSNDPENG
FT                   PVFTLRDVEARESYSFDSIDLIAMEIYDLLY"
FT   gene            535433..536125
FT                   /locus_tag="SAK_0592"
FT   CDS_pept        535433..536125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0592"
FT                   /product="polar amino acid uptake (PAAT) family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45038"
FT                   /protein_id="ABA45038.1"
FT                   /translation="MNFSFLPQYWSYFNYGVMVTIMISTCVVFFGTIIGVLIALVKRTN
FT                   LHFLTILANFYVWVFRGTPMVVQIMIAFAWMHFNNLPTISFGVLDLDFTRLLPGIIIIS
FT                   LNSGAYISEIVRAGIEAVPSGQIEAAYSLGIRPKNTLRYVILPQAFKNILPALGNEFIT
FT                   IIKDSALLQTIGVMELWNGAQSVVTATYSPVAPLLFAAFYYLMLTTILSALLKQMEKYL
FT                   GKGVKIDG"
FT   gene            536118..536852
FT                   /locus_tag="SAK_0593"
FT   CDS_pept        536118..536852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0593"
FT                   /product="polar amino acid uptake (PAAT) family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45044"
FT                   /protein_id="ABA45044.1"
FT                   /translation="MVEPIISIQGLHKSFGKNEVLKGIDLDIHQGEVVVIIGPSGSGKS
FT                   TFLRTMNLLEVPTKGTVTFEGIDITDKKNDIFKMREKMGMVFQQFNLFPNMTVLENITL
FT                   SPIKTKGLSKLDAQTKAYELLEKVGLKEKANTYPASLSGGQQQRIAIARGLAMNPDVLL
FT                   FDEPTSALDPEMVGEVLTVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMDAGIIVEQG
FT                   APKEVFEQTKEIRTRDFLSKVL"
FT   gene            537139..538833
FT                   /locus_tag="SAK_0594"
FT   CDS_pept        537139..538833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0594"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45904"
FT                   /protein_id="ABA45904.1"
FT                   /translation="MNYKEIYQEWLENDSLGKDIKSDLEAIKGDESEIQDRFYKTLEFG
FT                   TAGLRGKLGAGTNRMNTYMVGKAAQALANTIIDHGPEAIARGIAVSYDVRYQSKEFAEL
FT                   TCSIMAANGIKSYIYKGIRPTPMCSYAIRALGCVSGVMITASHNPQAYNGYKAYWKEGS
FT                   QILDDIADQIANHMDAITDYQQIKQIPFEEALASGSASYIDESIEEAYKKEVLGLTIND
FT                   TNIDKSVRVVYTPLNGVGNLPVREVLRRRGFENVYVVPEQEMPDPDFTTVGYPNPEVPK
FT                   AFAYSESLGKSVDADILLATDPDCDRVALEVKDSKGEYIFLNGNKIGALLSYYIFSQRC
FT                   ALGNLPHHPVLVKSIVTGDLSKVIADKYNIETVETLTGFKNICGKANEYDISKDKTYLF
FT                   GYEESIGFCYGTFVRDKDAVSASMMVVEMTAYYKERGQTLLDVLQTIYDKFGYYNERQF
FT                   SLELEGAEGQERISRIMEDFRQDPILQVGEMTLENSIDFKDGYKDFPKQNCLKYYFNEG
FT                   SWYALRPSGTEPKIKCYLYTIGCTEADSLSKLNAIESACRAKMNSTK"
FT   gene            538972..539826
FT                   /gene="folD"
FT                   /locus_tag="SAK_0595"
FT   CDS_pept        538972..539826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SAK_0595"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /note="identified by similarity to SP:P54382; match to
FT                   protein family HMM PF00763; match to protein family HMM
FT                   PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45841"
FT                   /db_xref="GOA:Q3K2M6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2M6"
FT                   /protein_id="ABA45841.1"
FT                   /translation="MTELIDGKALSQKMQAELGRKVERLKEQHGIIPGLAVILVGDNPA
FT                   SQVYVRNKERSALEAGFKSETLRLSESISQEELIDIIHQYNEDKSIHGILVQLPLPQHI
FT                   NDKKIILAIDPKKDVDGFHPMNTGHLWSGRPMMVPCTPAGIMEMFREYHVDLEGKHAVI
FT                   IGRSNIVGKPMAQLLLDKNATVTLTHSRTRNLSEVTKEADILIVAIGQGHFVTKDFVKE
FT                   GAVVIDVGMNRDENGKLIGDVVFEQVAEVASMITPVPGGVGPMTITMLLEQTYQAALRS
FT                   VSL"
FT   gene            539823..540659
FT                   /locus_tag="SAK_0596"
FT   CDS_pept        539823..540659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0596"
FT                   /product="carbohydrate kinase"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM TIGR00196"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44520"
FT                   /protein_id="ABA44520.1"
FT                   /translation="MIVGEQEARALIKPRPKSSHKGDYGSVLLIGGFYPYGGAIIMAAL
FT                   ACVKTGAGLVTVATQSCNIPSLHSQLPEVMAFDSDDYKWLEKSIVQSDVIVIGPGLGVS
FT                   ESSRKILNQTMEKIQSHQSVILDGSALTLLSEGAFPQTKAKNLVLTPHQKEWERLSGIA
FT                   VSQQTKENTQTALKSFPKGTILVAKSSHTRIFQDLDEKEIIVGGPYQATGGMGDTLCGM
FT                   IAGMLAQFKEASPLDKVSVGVYLHSAIAQGLSKEAYVVLPTTISDEIPKEMARLSK"
FT   gene            540785..542125
FT                   /gene="xseA"
FT                   /locus_tag="SAK_0597"
FT   CDS_pept        540785..542125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="SAK_0597"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45286"
FT                   /db_xref="GOA:Q3K2M4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2M4"
FT                   /protein_id="ABA45286.1"
FT                   /translation="MSDYLSVSTLTKYLKLKFDKDPYLERVYLTGQVSNFRRRPNHQYF
FT                   SLKDDKSVIQATMWSGHFKKLGFELEEGMKVNVVGRVQLYEPSGSYSIIVEKAEPDGIG
FT                   ALAIQFEQLKKKLSQAGYFDDRHKQLIPQFVRKIGVVTSPSGAVIRDIITTVSRRFPGV
FT                   EILLFPTKVQGEGAAQEIAQTIALANEKKDLDLLIVGRGGGSIEDLWAFNEECVVEAIF
FT                   ESRLPVISSVGHETDTTLADFVADRRAATPTAAAELATPVTKIDILSWITERENRMYQS
FT                   SLRLIRTKEERLQKSKQSVIFRQPERLYDGFLQKLDNLNQQLTYSMRDKLQTVRQKQGL
FT                   LHQKLQGIDLKQRIHIYQERVVQSRRLLSSTMTSQYDSKLARFEKAQDALISLDSSRIV
FT                   ARGYAIIEKNHTLVSTTNGINEGDHLQVKMQDGLLEVEVKDVRQENI"
FT   gene            542103..542318
FT                   /gene="xseB"
FT                   /locus_tag="SAK_0598"
FT   CDS_pept        542103..542318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SAK_0598"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46203"
FT                   /db_xref="GOA:Q3K2M3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2M3"
FT                   /protein_id="ABA46203.1"
FT                   /translation="MSDKKTFEENLQELETIVSRLETGDVALEDAIAEFQKGMLISKEL
FT                   QRTLKEAEETLVKVMQADGTEVEMDT"
FT   gene            542318..543190
FT                   /locus_tag="SAK_0599"
FT   CDS_pept        542318..543190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0599"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="identified by similarity to SP:O66126; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44948"
FT                   /protein_id="ABA44948.1"
FT                   /translation="MVTIEKIDEAIHRYYKQTHSVVSPDLIKAILYSVDGGGKRIRPRI
FT                   LLEILEGFGVELIDGHYDVAAALEMIHTGSLIHDDLPAMDNDDFRRGRLTNHKKFDEAT
FT                   AVLAGDSLFLDPFDLVVKAGFKADVTVRLIELLSMSAGSFGMVGGQMLDMKGENKVLSI
FT                   DDLSLIHINKTGRLLAYPFVAAGILAEKSEEVKGKLHQAGLLIGHAFQVRDDILDVTAS
FT                   FEELGKTPNKDIVAEKTTYPNLLGLDKSQEILDDTLKKAQAIFQNLEKKANFNARKIID
FT                   IIEGLRLNG"
FT   gene            543183..544010
FT                   /gene="tlyA"
FT                   /locus_tag="SAK_0600"
FT   CDS_pept        543183..544010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="SAK_0600"
FT                   /product="hemolysin A"
FT                   /note="identified by similarity to SP:Q06803; match to
FT                   protein family HMM PF01479; match to protein family HMM
FT                   PF01728; match to protein family HMM TIGR00478"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46098"
FT                   /protein_id="ABA46098.1"
FT                   /translation="MAKERVDVLAYKQGLFDTREQAKRGVMAGMVINVINGERYDKPGE
FT                   KVADDTELKLKGEKLKYVSRGGLKLEKALQVFEISVADKLTIDIGASTGGFTDVMLQSG
FT                   ARLVYAVDVGTNQLVWKLRQDHRVRSMEQYNFRYAQKEDFKEGLPEFASIDVSFISLNL
FT                   ILPALKEILVDGGQVVALIKPQFEAGREQIGKNGIVKDKLVHEKVLTTVTNFTKDYGYT
FT                   VKHLDFSPIQGGHGNIEFLMHLQKCQDPQNLVLDQIQDVIEKAHKEFKKNEEE"
FT   gene            543997..544470
FT                   /locus_tag="SAK_0601"
FT   CDS_pept        543997..544470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0601"
FT                   /product="arginine repressor, putative"
FT                   /note="identified by similarity to SP:P17893; match to
FT                   protein family HMM PF01316; match to protein family HMM
FT                   PF02863"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46092"
FT                   /protein_id="ABA46092.1"
FT                   /translation="MKKSERLNLIKQIVLNHAVETQHELLRRLEAYGVTLTQATISRDM
FT                   NEIGIIKVPSAKGRYIYSLSNENDPIFTTAVAKPIKTSILSISDKLLGLEQFININVIP
FT                   GNSQLIKTFIMSHCQEHIFSLTADDNSLLLIAKSEADADHIRQSMIAMLEKKD"
FT   gene            544482..546140
FT                   /gene="recN"
FT                   /locus_tag="SAK_0602"
FT   CDS_pept        544482..546140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="SAK_0602"
FT                   /product="DNA repair protein RecN"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00634"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45707"
FT                   /protein_id="ABA45707.1"
FT                   /translation="MLLEISIKNFAIIEEISLNFETGMTVLTGETGAGKSIIIDAMNMM
FT                   LGSRASVEVIRHGANKAEIEGFFSVEKNQSLVQLLEENGIELADELIIRREIFQNGRSV
FT                   SRINGQMVNLSTLKAVGHYLVDIHGQHDQEELMKPNMHILMLDEFGNTEFNVIKERYQS
FT                   LFDAYRQLRKRVLDKQKNEQENKSRIEMLEFQIAEIESVALKSDEDQTLLKQRDKLMNH
FT                   KNIADTLTNAYLMLDNEEFSSLSNVRSAMNDLMALEEFDREYKDLSTNLSEAYYVIEEV
FT                   TKRLGDVIDDLDFDAGLLQEIENRLDVINTITRKYGGDVNDVLDYFDNITKEYSLLTGS
FT                   EESSDALEKELKILEHDLIESANQLSLERHKLAKQLENEIKQELTELYMEKADFQVQFT
FT                   KGKFNKEGNEIVEFYISTNPGEGFKPLVKVASGGELSRLMLAIKSAFSRKEDKTSIVFD
FT                   EVDTGVSGRVAQAIAQKIHKIGSHGQVLAISHLAQVIAIADYQYFIEKISSDSSTVSTV
FT                   RLLSYEERVEEIAKMLAGNNVTDTARTQAKELLGS"
FT   gene            546253..547089
FT                   /locus_tag="SAK_0603"
FT   CDS_pept        546253..547089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0603"
FT                   /product="DegV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44734"
FT                   /protein_id="ABA44734.1"
FT                   /translation="MSKIKIVTDSSITIEPELIKELDITVVPLSVMIDGTLYSDNDLKA
FT                   QGEFLNLMRGSKELPKTSQPPVGVFAEIYEKLMNEGVEHIIAIHLTHTLSGTIEASRQG
FT                   ANIAGADVTVIDSTFTDQCQKFQVVEAAKLAKEGADLDTILARVEEVRQKSELFIGVST
FT                   LENLVKGGRIGRVTGLLSSLLNIKVIMELTNHELVPIVKGRGLKTFSKWLDNFVESAQT
FT                   RKIAEIGISYCGKADMANNFREKLAVLGAPISVLETGSIIQTHTGEDAFAVMVRYE"
FT   gene            547082..547921
FT                   /locus_tag="SAK_0604"
FT   CDS_pept        547082..547921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0604"
FT                   /product="lipase/acylhydrolase, GDSL family"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45396"
FT                   /protein_id="ABA45396.1"
FT                   /translation="MNKKKILTGLSFFLVSLLLSFGIFSLIIPKSNPKLTKKDFLTKKV
FT                   IPLNYVALGDSLTEGVGDTTSQGGFVPLLSESLHNRYSYQVTSVNYGVSGNTSQQILKR
FT                   MTTDPQIEKDLEKADLLTLTVGGNDVLAVIRKELSHLSLNSFEKPAEAYKERLKEILAK
FT                   ARQDNPKLPIYVLGIYNPFYLNFPQLTKMQTVIDNWNKATKEVVDASENVYFVPINDRL
FT                   YKGINGKEGITESSNSQASITNDALFTGDHFHPNNIGYQIMSNAVMEKINETRKNWP"
FT   gene            547896..548498
FT                   /locus_tag="SAK_0605"
FT   CDS_pept        547896..548498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63810.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45605"
FT                   /protein_id="ABA45605.1"
FT                   /translation="MKQEKTGRNLNFWKWAFLLLLAINLSFTAVIASRLIQVREPNTGK
FT                   ISTGVQDKVKVGTFTTNKSQLNKTIALYLKQYQTKKMNYKIYAASSSILFEGSYQLLGY
FT                   EVPLYIYFEPYRLTNGAVQLKVTSFSVGTLPLPEKDVLQYIKSSYKLPNFVDIKPKKSV
FT                   ININLQDLKNKEGIYLKATAIDLVNDNFSFDIFKKKP"
FT   gene            548601..548876
FT                   /gene="hup"
FT                   /locus_tag="SAK_0606"
FT   CDS_pept        548601..548876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="SAK_0606"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by similarity to SP:P08821; match to
FT                   protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44456"
FT                   /protein_id="ABA44456.1"
FT                   /translation="MANKQDLIAKVAEATELTKKDSAAAVDAVFAAVADYLAEGEKVQL
FT                   IGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK"
FT   gene            complement(548964..550106)
FT                   /locus_tag="SAK_0607"
FT   CDS_pept        complement(548964..550106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0607"
FT                   /product="prophage LambdaSa03, site-specific recombinase,
FT                   phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46293"
FT                   /protein_id="ABA46293.1"
FT                   /translation="MWSEKHKSGKVNFVERYKDPYTNKWKRTSVLMEKDTPRIRKEAQR
FT                   ILEAKIADIVRKLQTSDMLFTNLIDEWWIFYQQEIKRSSIVTLKGNIREIRAEFGINIP
FT                   VVNIDPRYVQNYLDNLDCSRNKKERNKSMLNLIFDYAVSLDIIKDNPARRAKLPKIKKT
FT                   LNDWKKFEEKYLEEEEIKRLLKELFRRPSTRRLGLLSEFMSLNGCRIGEAISIEPDNID
FT                   FKNKTLQLHGTYDRTNGYINGEKTSPKTLASYRETIMTKREMEIIQELEFINELEKNTN
FT                   PRYRDMGYIFTTRNGVPIQINSFNLALKKANERLEQPINKNITSHIFRHTLVSRLAENN
FT                   VPLKAIMDRVGHADAKTTVQIYTHITKKMKSNIADIMENY"
FT   gene            complement(550234..550443)
FT                   /locus_tag="SAK_0608"
FT   CDS_pept        complement(550234..550443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB94962.1; match to
FT                   protein family HMM PF05154"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45261"
FT                   /protein_id="ABA45261.1"
FT                   /translation="MERRVNKVVYILLAFFLGGIGAHKFYAGKIGQGFLYIIFSITFIP
FT                   GIIGLIEALMALGKQTDEYGNIIV"
FT   gene            complement(550495..550875)
FT                   /locus_tag="SAK_0609"
FT   CDS_pept        complement(550495..550875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63608.1; match to
FT                   protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44944"
FT                   /protein_id="ABA44944.1"
FT                   /translation="MKINELLSEYNVSLFVFDGDIWGRDGFYFPDARTIYVNNKLSEID
FT                   RNKVILHELGHMTNNHNPYIYKRLLLQYENEADKYMIRELLKDYLANHDIYSFDWLKFA
FT                   NHYKISTVWGQEMIQTEFKKLI"
FT   gene            complement(550862..551221)
FT                   /locus_tag="SAK_0610"
FT   CDS_pept        complement(550862..551221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0610"
FT                   /product="prophage LambdaSa03, transcriptional regulator,
FT                   Cro/CI family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44826"
FT                   /protein_id="ABA44826.1"
FT                   /translation="MHSNDEIIDLMDSIRKEKNISISELSRKVGMSKSGVSLYFNKTRK
FT                   FPLDRANVFAQALGTTPEKIIGVKPKLSNDNSIDLSNLRERIVMFDGKPLSDDDVSKIE
FT                   QIIKLSLGVTGNEDK"
FT   gene            551413..551631
FT                   /locus_tag="SAK_0611"
FT   CDS_pept        551413..551631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0611"
FT                   /product="prophage LambdaSa03, transcriptional regulator,
FT                   Cro/CI family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45158"
FT                   /protein_id="ABA45158.1"
FT                   /translation="MAVDYLRVKAERVAKGYTQDYMASQLGWSDRARYAKRENGIVSFD
FT                   ADELARVAEILGISKDNIGIFFTYNVH"
FT   gene            551729..552061
FT                   /locus_tag="SAK_0612"
FT   CDS_pept        551729..552061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97901.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46045"
FT                   /protein_id="ABA46045.1"
FT                   /translation="MTKAERIRRFYYENPNSKLADSYQALKEYDISESHIKVTLSRDRK
FT                   NGVCDTNYDYTQYFESTKAKEELTEWKRDVRKDLVEQLLQANANETDSNQIRLNAKTIN
FT                   QLLVEI"
FT   gene            complement(552166..552501)
FT                   /locus_tag="SAK_0613"
FT   CDS_pept        complement(552166..552501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44588"
FT                   /protein_id="ABA44588.1"
FT                   /translation="MDKNVKQDLLGLMYMLTEDADKQIIISTAAGTYVGNFIPKEKNEK
FT                   YHTVYAISDKLHQISDTEQTSSDSDVIVLVDVTLISSSHQEFKMPFVYLFTDQIIGVSL
FT                   GKYSIGQ"
FT   gene            553227..553376
FT                   /locus_tag="SAK_0614"
FT   CDS_pept        553227..553376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63612.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46268"
FT                   /protein_id="ABA46268.1"
FT                   /translation="MKKLFKKLFVKKNQVIETRQKWTIETHGWEANARRYDNMIEHNNR
FT                   GRTC"
FT   gene            553649..553939
FT                   /locus_tag="SAK_0615"
FT   CDS_pept        553649..553939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97899.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44644"
FT                   /protein_id="ABA44644.1"
FT                   /translation="MKCYVNKQKKLAIDMNYKDKFGKFSSDSIQILEGKLTDSIQIDVE
FT                   NAMKEIIDKYSQLFDTPIIDDLFTEKEKQLKQSYDVETTLTEMFEVEYEDN"
FT   gene            553926..554609
FT                   /locus_tag="SAK_0616"
FT   CDS_pept        553926..554609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0616"
FT                   /product="conserved hypothetical protein TIGR01618"
FT                   /note="identified by match to protein family HMM TIGR01618"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45664"
FT                   /protein_id="ABA45664.1"
FT                   /translation="MKITKATEITKTHNWRILIYGKPGNGKTYLINYLKGKTLILDMDH
FT                   SSKTIAGNENIDIIQFDRTHPSDFMTEFLTELPELIKEYDNLVIDNITSWQSDWFIEQG
FT                   RKSKNGITNELQQYNMWTNYYLRVLTTIYSQPINIFVTAWESTQDLTLESGQMITQYVP
FT                   DIRKQVLSQTLGLTDVVGRIQVNPKTGGHGILLEGSDGLCAKNRLDNRTVCKAEELFNF
FT                   EGSDA"
FT   gene            554684..556048
FT                   /locus_tag="SAK_0617"
FT   CDS_pept        554684..556048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0617"
FT                   /product="prophage LambdaSa03, helicase, putative"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44715"
FT                   /protein_id="ABA44715.1"
FT                   /translation="MIVSPPGSGKSVVISDIAKSATQKNGYVLFLVHRKELIDQITNSF
FT                   KFHGIDMNKVDLMTVGKAKNRLDKLTKPTLIITDEGHHGKASTYQMIYEYFSDVPRIGF
FT                   TATPWRLSGDGFTDTYDVMVLGKTVEWLINNNKLAPYDYYSVLSIDTAKLKVQNGDYSN
FT                   KSIDESFGKKIFGDVVQEYIKKANGQKAILYAHSVEASQAFAKEFQSMGINAIHADAKT
FT                   PKAKRDKSMKDFRDGKIQVICNVDLISEGFDVPDCTVTILCRPTKSLVLFLQQSMRSMR
FT                   YQPNKKAIILDHVGNWNIHGLPDTPHHWENYFRGGWKKKSNKTNTVHAKECPVCSALWP
FT                   LSQQLCELCNHDFGLKEKQEKERIEAELELIKRERFRIKQLANKKFGKDLKTNWEIAQA
FT                   RVKDAGKGKPLYKLIYFYLKTDWVETNVNELAEVTGKSEKEIYSAYNWLKKKLRG"
FT   gene            556053..556535
FT                   /locus_tag="SAK_0618"
FT   CDS_pept        556053..556535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0618"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:B56658; match to
FT                   protein family HMM PF05037"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45416"
FT                   /protein_id="ABA45416.1"
FT                   /translation="MAGFTTDFSEVKEHAEFKEQPYEMIVYDAYEAVNDRNGKKRVVID
FT                   YVVRNDIKQEMQNYHLWDEQYPNSQTGKYHIGILMGKAKALGIKEGQHYDSFEAFLNDF
FT                   KGRTAKVTVKLDEYNGNKYPKVRYANQSDVPDSHHIWKEKTTGFTQAEIEEDDLPF"
FT   gene            556553..558106
FT                   /locus_tag="SAK_0619"
FT   CDS_pept        556553..558106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0619"
FT                   /product="conserved hypothetical protein/bacteriophage
FT                   resistance protein"
FT                   /note="identified by similarity to GB:AAA72952.1;
FT                   similarity to GB:AAB22892.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45184"
FT                   /protein_id="ABA45184.1"
FT                   /translation="MTSNEFIEALSKLTTETDWGAPIFGESVLKAELRKHLFKIVPIDH
FT                   NGYIHKLFYSEMVKDEDVMYFVSDGRKTYRFLFGDTILKTDKQGNEYLTYSVENNFPPF
FT                   AKLVIDYILGAYTFFENKLYDIRYKQFKLIDDFTLQTKYGFKDSGHILEILQGIHKTLN
FT                   IQPINYIEPYQIACKDFIIDLENSEIINQPPLQNVSYFKYYEVDYKTAINSKSIAEKYL
FT                   EYVIADSNSLNNAILQSYFIAQVACGVRPKTNFFISKSGVRTGKGLRHIALSGLFNKID
FT                   VELDTLKSNGFEALQAWAMFSGGEMALATEQGDIQGNAMERVLKIIATEKTHVARAIGQ
FT                   NQSMVNLTSVLCIDTNRTVALSDEMNGRKVLIQFKDRPKTETDYERESVFRKYWLAFTD
FT                   RDKNPKIDGCIGFLLNSLERFQKIGKWYQWKDVEVFNDIDLDEFQVALINALQEVDFVQ
FT                   RTDNKEVIDLSLQVYGKSNHALSKAISEIGVRSRSKKVNGKTVRGYEIENKTRFDKYIL
FT                   "
FT   gene            558375..559244
FT                   /locus_tag="SAK_0620"
FT   CDS_pept        558375..559244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAC04162.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44957"
FT                   /protein_id="ABA44957.1"
FT                   /translation="MYHTTALSFLKKGYQVIPLRKDTGTPMIKFKDIQITEEVIKNTNW
FT                   FNCDYALLMRGIWCIDIDTHDMDEKLAKELYIMIKKMGIDLLSVLSTDKYDNGLDGYSS
FT                   IIRHEYKNELISNFKNTFAELTASGGMHILFKKRDDINYTQKIGVMPGVDIKANDNNFV
FT                   KIFPSDGREVLQAVKTLPYYDGKFEEEVFKPKQEGITTYFGCSVTYTSNGSHEGREAYE
FT                   RVATGTSYNRNDDLFKGACWAFENGIDIDDLTSIIGTVKGRDVFTREEFELTIESAKRK
FT                   VSYVTIRT"
FT   gene            559264..559545
FT                   /locus_tag="SAK_0621"
FT   CDS_pept        559264..559545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63995.1; match to
FT                   protein family HMM PF06190"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46060"
FT                   /protein_id="ABA46060.1"
FT                   /translation="MELSQAGYMVFRANVGKVKTADGRFFDTGLPKGFCDLFGFKPNGQ
FT                   IFFIEVKNETGRIRPEQKNFMEVMASKGALAGVARSVEDALKIVNGYH"
FT   gene            559624..559920
FT                   /locus_tag="SAK_0622"
FT   CDS_pept        559624..559920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97891.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44365"
FT                   /protein_id="ABA44365.1"
FT                   /translation="MADKINAESMQAAYNENYQMFLAKNADYGNSFEKSLDDFGFIAGV
FT                   VRISDKYNRLYNLINSDKNVSESLSDTLNDMANYCTMLSIWLEKTENANDTRS"
FT   gene            560174..560338
FT                   /locus_tag="SAK_0623"
FT   CDS_pept        560174..560338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0623"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44454"
FT                   /protein_id="ABA44454.1"
FT                   /translation="MTKEEVIAFLTEQRDLRLVAYEWGKDNLSVFARWQLEQANMYLDI
FT                   IEWIEEVTE"
FT   gene            560608..560751
FT                   /locus_tag="SAK_0624"
FT   CDS_pept        560608..560751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45867"
FT                   /protein_id="ABA45867.1"
FT                   /translation="MIDEILKRLNKEFDNDLDNYEQERYAGYMDAIGVAIEIVEEVKRG
FT                   RK"
FT   gene            560748..561260
FT                   /locus_tag="SAK_0625"
FT   CDS_pept        560748..561260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63626.1; match to
FT                   protein family HMM PF07852"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45121"
FT                   /protein_id="ABA45121.1"
FT                   /translation="MNIEEAKKLIDKQSIGKGGVGDIPVVKTHIVKVLLDQLDKPKLEV
FT                   PQMIADVIESFDEDVNYLHEHMSYQSDEVREWLTHNEREFYEAWLAYPNITVEKENLYT
FT                   VEIPNPNERQLSFVLMRQLSGNVSIKVMHRDNLDLLKIDNNLQLTESEIRKDFDWAWQF
FT                   RKDVENE"
FT   gene            561281..561580
FT                   /locus_tag="SAK_0626"
FT   CDS_pept        561281..561580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0626"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44503"
FT                   /protein_id="ABA44503.1"
FT                   /translation="MNYDKNKNDAKKNFIIALVLLPFGLVLSGFVIKYGWNNILSTIDG
FT                   VPSINLPQAVGINVLISPFASKKNTDEDFATVIARAFISPLVVLLLLWIVTLFM"
FT   gene            561768..561962
FT                   /locus_tag="SAK_0627"
FT   CDS_pept        561768..561962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45051"
FT                   /protein_id="ABA45051.1"
FT                   /translation="MTYLKKLFEAVKFLNSMEKQNKKIMITFHNKKVHFYELEEITESS
FT                   SGTVEAKAKMLSLWGKIKL"
FT   gene            561959..562225
FT                   /locus_tag="SAK_0628"
FT   CDS_pept        561959..562225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAA85782.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44367"
FT                   /protein_id="ABA44367.1"
FT                   /translation="MKEKTIFISKKYANDFNNDKYNLSSGYYFRSGEKHDIAIVKYGEK
FT                   DYLKNTDLAYVVCDKIVDADSISFVYHGEYETWHFKLLNTEAN"
FT   gene            562613..563041
FT                   /locus_tag="SAK_0629"
FT   CDS_pept        562613..563041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45087"
FT                   /protein_id="ABA45087.1"
FT                   /translation="MMGRNQTKADILLNELRIIPKLIKELERDKIASNSLLSSPQWSDM
FT                   RTNGGIRQSQEDKNVSLISKCEYYNGQIQTLDKRKGEIVELIMRIPDMLQRHVLITTFV
FT                   NCQTYDEAIDRLEMNRNNYYMLKRKGVESLNLILNNTG"
FT   gene            563613..563987
FT                   /locus_tag="SAK_0630"
FT   CDS_pept        563613..563987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0630"
FT                   /product="prophage LambdaSa03, HNH endonuclease family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45645"
FT                   /protein_id="ABA45645.1"
FT                   /translation="MAFYYNCKRGCCKLRADKKGTHRVAFEKNKRRLLKTAHLCGICGR
FT                   PVDKSLKYPHPLSAAIDHIVPIAKGGHPSSIDNLQLTHWQCNRQKSDKLFINQTAVRAT
FT                   VVGNRNLPQSRDWSSYASKE"
FT   gene            564138..564494
FT                   /locus_tag="SAK_0631"
FT   CDS_pept        564138..564494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34269.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44525"
FT                   /protein_id="ABA44525.1"
FT                   /translation="MKKKCLICKKTFQAKTNRSLYCSEECRKKGIREKQRKLMQQKRAE
FT                   QRKEKKKVLNTNADVTEKPKKIRNLVQHYKKLKREILDNESEFGFTGIALVEGIDIHEE
FT                   NFVDLVMQKIKEQQ"
FT   gene            564491..565759
FT                   /locus_tag="SAK_0632"
FT   CDS_pept        564491..565759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM99482.1; match to
FT                   protein family HMM PF07360"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45319"
FT                   /protein_id="ABA45319.1"
FT                   /translation="MNYMGMGYLRRKLALFKTGVDKRYRYYAMDDRDNTRSIVMPDSVR
FT                   EMYRSVIEWTTKGVDSLADRIIFREFANDDFNAWEIFKANNPDIFFDTVIQSALIASCC
FT                   FVYIMPGNEDSLPKMQVIEASKATGILDPTTFLLTEGYAVLESDSNENPTLEAYFTGEK
FT                   TWYYPKDEKPYSIDNSTGHPLLVPVIHRPDAVRPFGRSRITQAGMYHQKAAKRTLERAE
FT                   VTAEFYSFPQKYVLGMDPDAEPMEKWRATVSTLLEISKDEDGDKPTVGQFTTASMAPFM
FT                   DHLKMYASLFAGGSGLTLDDLGFPSDNPSSVEAIKAAHENLRAAGRKAQRSFSSGFLNV
FT                   AYVAVCLRDEFPYLRNQFMDTVIKWEPLFEADANMLTLVGDGAIKLNQAIPGFMDADVI
FT                   RDLTGVKGSDNPTPKATEVTTDG"
FT   gene            565752..566972
FT                   /locus_tag="SAK_0633"
FT   CDS_pept        565752..566972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM99483.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46283"
FT                   /protein_id="ABA46283.1"
FT                   /translation="MVDDVLPKLLKSVQQDFEKYFGKSEVVAKAFAELQAKKATYKTVN
FT                   EFAIEVGQLLSLTLTGSVTSDKLPDGKMYYNIANRLVNDILRHNYELISDYAGNVQQNL
FT                   NKQAKISLKIQRPPLNQDKIDGLVNRLSSEPVFDDVKWLLDEPIVNFSQSIVDDCIRAN
FT                   ADFHAKAGMTPTIERISTGKCCDWCDRLAGKYIYHEEPKDFYKRHQHCQCVIDYHPKNG
FT                   KRQNSWSKKWTKETTDILERRKQMNIDIRDNNRKSDIKEYKEIVSILGTKAPISLAKFQ
FT                   DLKYNDGIRYERLKDQAHIQGNFKNGSWLDKVNPEKQARHIKSTAGEGKSYFFDDVDTD
FT                   ALYQKYKQTGELIKNRRGRTHKELIDLPEDISIGIDIYSGNLVNGLTIHYGKTGSHIVP
FT                   TYHERRE"
FT   gene            566972..567160
FT                   /locus_tag="SAK_0634"
FT   CDS_pept        566972..567160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45082"
FT                   /protein_id="ABA45082.1"
FT                   /translation="MELLQYNNKKISLVDIDDEIWTGTAYYCDADTNETPEDVLVVKNE
FT                   RGYTEISESEIKSIEII"
FT   gene            567268..568683
FT                   /locus_tag="SAK_0635"
FT   CDS_pept        567268..568683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0635"
FT                   /product="prophage LambdaSa03, terminase, large subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45946"
FT                   /protein_id="ABA45946.1"
FT                   /translation="MVTKTKAKLGNQRPTQSVNLHFAKTLAHEAINYYKKTGLSCYLWQ
FT                   ENMLIPMMAINEDNLWVHQKYGYAIPRRNGKTEVVYILELWALHKGLKILHTAHRISTS
FT                   HSSFEKVKKYLEMSGYVDGEDFISNKAKGQERIEFKSSGSVIQFRTRTSNGGLGEGFDL
FT                   LIIDEAQEYTSEQESALKYTVTDSDNPMTIMCGTPPTMVSTGTVFESYRKECLKGDRRY
FT                   SGWAEWSVDEMQPIHDVKSWYVANPSMGYHLNERKIEAELGEDEIDHNIQRLGYWPSFN
FT                   QKSVISEKEWAKLKVEQVPELKSKLFVGIKFGQDGNNVSLSIAARASENKVFVEAIDCL
FT                   SIRNGTQWIINFLKSADIAKVVIDGASGQELLAQEMREHGLKKPELPKVAEIITANTMW
FT                   EQGIMQETICHNDQPSLTAVVTNCEKRQIGSNGGFGYKSLYDDRDISLMDSALLAHWIC
FT                   YTTKPKRKQRTSC"
FT   gene            568764..569228
FT                   /locus_tag="SAK_0636"
FT   CDS_pept        568764..569228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM99485.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44814"
FT                   /protein_id="ABA44814.1"
FT                   /translation="MSEFKVIETQEELDTIVKARIAREREKYQDYDQLKTRVEKLETEN
FT                   SSLQTALNDAKSNTDSYTEKITTLENQIAGYETANLRTKVALQYGLPIDLANRLQGDDE
FT                   DGLKVDAERLASFIKPSQPQPPAKSNEPIITDKKEAGWIEMARNLVNKGE"
FT   gene            569231..570133
FT                   /locus_tag="SAK_0637"
FT   CDS_pept        569231..570133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0637"
FT                   /product="prophage LambdaSa03, structural protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45646"
FT                   /protein_id="ABA45646.1"
FT                   /translation="MAESIKAGTLFKPELVTEIMSKVKGHSTLAKLSGQTPIPFNGVEQ
FT                   FVFNLDGNAQIVGEGEQKLGNTAKVTSKIIKPLKFVYQARMTDEFKYASEEKRLNFLKH
FT                   YADGFAKKMAEAFDIAAIHGLEPRTMTDASFKATNSFDGVVTGNVIKYEADKIDDNIDA
FT                   AVTTIVANGNDVTGIALSPQAGQDMSKRKDKFDNVMYPEFRFGQRPSNFFNMTLDINKT
FT                   LTMKGGTAKDDHAIVGDFQNMFKWGYAENIPMEVIEYGDPDGSGRDLKAYNEILLRTEA
FT                   FIGWGILDEKAFSRVEVQG"
FT   gene            570130..570345
FT                   /locus_tag="SAK_0638"
FT   CDS_pept        570130..570345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK34260.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44743"
FT                   /protein_id="ABA44743.1"
FT                   /translation="MIYRDKNTGAVVVTDCALLGDWEIVPNTVDKTQTSDEKSWTVQTL
FT                   KEHLTGLGIEYNSSATKSELLELLPK"
FT   gene            570359..570790
FT                   /locus_tag="SAK_0639"
FT   CDS_pept        570359..570790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP81924.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46122"
FT                   /protein_id="ABA46122.1"
FT                   /translation="MTNFATTDDVILLWRQLSVDEIKRAEALLETVSDTLRLEASKVGK
FT                   NLDEMILETPYFATVLKSVTVDIVARTLMTATQGEPMSQESQSALGYTWSGTYLVPGGG
FT                   LFIKDSELKRLGLKKQRYGGIELYGEIERDNSYFSRQDD"
FT   gene            570741..571079
FT                   /locus_tag="SAK_0640"
FT   CDS_pept        570741..571079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP81925.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45362"
FT                   /protein_id="ABA45362.1"
FT                   /translation="MAKLKGITVTLVDKTISGKDPFGNPIKVDFDIKIENVLVAPATTE
FT                   DITNQLSLTGKKVEYILAIPKGDKHDWEDKEVRFFDKKWRTVGLALEGIEEFIPLEWNK
FT                   KVMVERYE"
FT   gene            571309..571644
FT                   /locus_tag="SAK_0641"
FT   CDS_pept        571309..571644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0641"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL98042.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45451"
FT                   /protein_id="ABA45451.1"
FT                   /translation="MIEVIIKKYLDEHLDVPSFFEHQKDEPARFIILEKTSGAKQNHLL
FT                   SSTFAFQSYAESLYEAALLNDKVKQVIEQLDVLPQVSGVHLNADYNFTDTATKRYRYQA
FT                   VFDINHY"
FT   gene            571654..572211
FT                   /locus_tag="SAK_0642"
FT   CDS_pept        571654..572211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0642"
FT                   /product="prophage LambdaSa03, structural protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44575"
FT                   /protein_id="ABA44575.1"
FT                   /translation="MVANSSNVTTAKPKIGGAIYTAPLGTELPKDTASELNEAFKSLGY
FT                   ISEDGLSNEDKRESEEIQAWGGDVVESAQKSKADKFTYTLIEALNIEVLKEIYGKDNVT
FT                   GDLKAGITVKSNSKPLEEHCLVIEMILKNNTVKRIVIPKGKVSEVGEIKYVDNEAAGYE
FT                   TTLQAFPDAEGNTHYEYIKGAG"
FT   gene            572211..572456
FT                   /locus_tag="SAK_0643"
FT   CDS_pept        572211..572456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAG18636.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45797"
FT                   /protein_id="ABA45797.1"
FT                   /translation="MKTSSGFEYKIEESRLKNYELVEALADLESNPLSLPKVLRLLLGD
FT                   QVESLKNHLRASDGTVSTEALMEEVKEIFESGQLKK"
FT   gene            572471..572842
FT                   /locus_tag="SAK_0644"
FT   CDS_pept        572471..572842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS66818.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45005"
FT                   /protein_id="ABA45005.1"
FT                   /translation="MLKMDEDALVCDLAETYHIYDYKQLPPLKVAVFSLGLREESRINR
FT                   VISGNRVSFERRILAGMFDRLGMLIWMKTTDGQKGKNRPEMVSTMFDNQQKDSEVVSFG
FT                   SGKDFEETRNNILGFGGDS"
FT   gene            572842..574854
FT                   /locus_tag="SAK_0645"
FT   CDS_pept        572842..574854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0645"
FT                   /product="prophage LambdaSa03, pblA protein, internal
FT                   deletion"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45891"
FT                   /protein_id="ABA45891.1"
FT                   /translation="MATNLGQAYVQIMPSAKGISGSISKTLDPEASSAGSSAGSLLGGK
FT                   LIGILGSVIAAAKIGEMVTKAISSSISEGAALQQSLGGVETLFKSNANLVKKYADEAYK
FT                   TTGLSANAYMESVTGFSASLLQSLGGDTAKAAKVANMAMIDMADNSNKMGTSMESIQYA
FT                   YQGFAKQNYTMLDNLKLGYGGTQEEMKRLLSDAQKLTGKKYDISNLSDVYEAIHAIQGK
FT                   IGITGTTAKEAATTFTGSFEAMKAASKNLLGKMALGEDIKPSLKALFDTTSNFVLNNFI
FT                   PMLTNVFKGFGSVISLTFSELIPKIVGFVQTSGPSLMQAGISFIISFVNGFLTAYPAFL
FT                   TVAGKIFTDFVSFVIQSIPGLLQAGATLVLNLIDGILANLPQVATSAVSVISNFISMLQ
FT                   ANYPAILKKGFEILSYLVQGIIARLPDIVITVGKLIAILAGAIASNLPKVLALGVQLLI
FT                   TFVKGILSVIGKINETANNIGEKLINAIKSIDLLSAGRAIMRGFLRGLEDVWGDIQNFV
FT                   GDIAGWIKDHKGPISYDRRLLIPAGNAIMQGLHQGLVDKFKPVKNLVNGMAEEIQSSFG
FT                   NPQLAFDMDTNVNNGFERIGTLNKNLSSQVTSTDNYTNGNAALLSAIKNLADRPIVVSA
FT                   QFDKNEFARVVAKPIAARQKFDEQTEERLRGINRW"
FT   gene            574848..576380
FT                   /locus_tag="SAK_0646"
FT   CDS_pept        574848..576380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0646"
FT                   /product="prophage LambdaSa03, tail component, putative"
FT                   /note="identified by match to protein family HMM PF05709;
FT                   match to protein family HMM TIGR01633"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45014"
FT                   /protein_id="ABA45014.1"
FT                   /translation="MVDYKTVRCHFGDVELTKWITITDGFTVFSGADYDPELKEIGGKD
FT                   GSIFIGTKTKHKVIKVPFWVKYNTIEDYDALQLALSSKKPKMLMFSHIPGRYYLAVQVG
FT                   DLNFKEIKMNGFGEITFIVADAYAHSTSYRRIKDYTQDGNKMTFKIKNNGTAPAFPIFR
FT                   IKHLGENGYIGIANETGAFAVGSPEEEDGTIVHRNEVLFDYSKAIAQALDGAPNVAKLN
FT                   HMPPTYDTELKRMRIDNILGSGKGGEYVVIGNRGTTPGYTEHVGTRTFIINPDSNGEYT
FT                   LNEHLWWQQIFIATAQDQKGFLKLCVTGIDDEGNDEFLYGIETYKRKNGFETEYNFFAL
FT                   DDDGVGWRFYKQFKFQADRNYHNPFSMNRSRAVEIFREEDKFRIYFNGAHHHVTVPSLK
FT                   GKKSRKIHLAMGTCSDSSKYINYNLFEKVNFEKMGVSHYNNIVNKYQPGDEVIINFEND
FT                   TVSTKDIDSIQDVVLGSKMISIPPGESELVVHLSSWVAALPDISIDFEERYK"
FT   gene            576381..580502
FT                   /locus_tag="SAK_0647"
FT   CDS_pept        576381..580502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0647"
FT                   /product="prophage LambdaSa03, minor structural protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01391;
FT                   match to protein family HMM PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46334"
FT                   /protein_id="ABA46334.1"
FT                   /translation="MLTIHGPDLKPVLFLDNDKQGALNYFNHKWYRKQKTGSSVLEFSV
FT                   YKKDLLGDSPLSHKYHVLNDQAFVSFVHKGKVQLLNIMKIDEDEKQIDCYCENLNLELL
FT                   NEYCNAYKATKAMSFEEYLVQFDILNWGALTVGTNEVKDKKLTLEWTSQETKLARLLSI
FT                   ANNFDAEIEFETKLNFNHTFKQLIINIYKEYEEGKSYGVGRDKTDVILRYQKNISGIRK
FT                   TVDKRQIYNAIRPYGKKNVKGERVISNPVTRKVTKTVGSNRTYLGGDLKYYGHTIKKAN
FT                   VQAIINYAVQYNILPSGIITQLYLESFWGDSTVGRRDNNWSGMTGGAQTRPSGVKVTTG
FT                   MARPANEGGTYMHYASVDDFLKDYTYLLAKQGIYNVVGKKNIADYTKGLFRAGGAKYDY
FT                   AAAGYQSYTNLMTNIRNGINKVTGNILNTIDKLWQTPVQPITAVNVARRATKTMQALNE
FT                   ATRLKGRRIGSGQCYALSGWYAKKLDGAWIDSSIGGIRGRIGGGMAAALIGTDYNWGAY
FT                   GWKLDRSPNAGNLQAGGIYNVKANFGAPFYTTQWGHTGIIKSVSKTRVTVLEQNFVGRM
FT                   YVVENSYDINSFASGLQTVCYPREIAQGMSVNGATTQQVTGGTQISYEEVVQEARTETY
FT                   EEEQIIYIDNSIYKEWKDENGKVEYYLKNGFLYAPLSRDRYPSVLTGNETRDNWIRKDM
FT                   EVETDSQEVLMSTGLKDLKAHAYPAITYEVDGYVDLELGDVVRIQDDGYEPPLILTARV
FT                   VEQEISITNPSSNKTKFSNFVEKESQLASDLISDMLRLYDESIPYEIKLATSNGVAFKN
FT                   GTGESVLTPSLQKNGKDYEAVYFYKNGDSLIDIGPSLIVKASDFNHVLNITVEAYLNEE
FT                   LVASTQISFTDTEDGADGKDGLPGPQGPPGIDGLQGPRGEQGIPGPAGADGKATYTHIA
FT                   YALDETGTTGFSVSDNTGKTYIGMYVDDNIIDSNDPKKYKWNLIKGADGARGIQGPAGA
FT                   DGKTPYWHVAYANSSDGTVDFSVSDSANKRYIGQYTDYDAIDSSDPKKYRWTDMVGTVV
FT                   VGTNNLIDGTKSFFGTDWFTSATLEDENLSNCPFTLKKWISGQKVSHAKDIMVEQGVTY
FT                   TFSAYVKREVAGNLYFYLYDIADGFITSDTPRETIIKNVDSSLRRFEITFTPTKTGRIR
FT                   PRFAMVSSEQGSFSSGGFMLVRGNKTGDWQESEADKASNLDSKADGAFTVEQLNAIAEE
FT                   QRLMKANLEAAASLQEVQDKAKELLDQIKKIEDGQKVSEQTMISNANRVVQILAKLENV
FT                   QLVTEAITQYMSYSNDGLVIKMKDGTSSVRVTTDRIAFYSGGTETAFISQGYLQIESGV
FT                   FTLRLRIGSFLFEESSKGRLQIKKIRGIGG"
FT   gene            580503..582506
FT                   /locus_tag="SAK_0648"
FT   CDS_pept        580503..582506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0648"
FT                   /product="prophage LambdaSa03, minor structural protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF05895"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45075"
FT                   /protein_id="ABA45075.1"
FT                   /translation="MTTFYSNSDRSYRLTYIVDEVSTSVADNSSQVRFRLYLTSGTNSY
FT                   AQYNFGGYAWVGAKYDFNAPSSIGFNGNQLLIDKTIRVPHDADGNKTVVVAAKLLGPGG
FT                   YAPGTLTIPDQKFTLTKIPRTSAVSVSSGYFGDTLNVNINQSSSDFTHDVRYNVNGITG
FT                   VVASDIKGSTTFKTSLDWANTIPNATSTPATIYVDTKSNGSVIGTSTAIFYLTLPDSVK
FT                   PKISSLVLSDTNQKASALVGSNNFVQIVSNPTVVFNGANGIYGSTIQNFYAEIVGKNQS
FT                   TQSDGGLLGILKFEGKATVKATVTDSRGRVSDPVTTEINVLPYSGIALDFSAQRGGADG
FT                   TQIVVTVNASVSPLTVNKLQKNKMTLSFKTAPTGTKTFKIDTSEASKTYTDKYQLINQN
FT                   FVLSGEFPSDQSFDIYGTISDSFGTNDTKRVPLLAKFVAVEIEDSGNPETTGVAIGKEW
FT                   ERGSIDAAGDIYARGKPIQQKQLALNNGGSFRHDDTDLNSLQDTGFYCVFRGANRPSGA
FT                   GPGYLTVVRHETANYAYQQFYDRTNKTIFTRVLENGSWSGWSEYAKKDSLPQATPAIED
FT                   TGWQSIGNGFNYRKIGSMVTIKYDFATNGINSFTVGSMPTNLIPNEMMFAVTAWTVQLN
FT                   VLNVQVSADGRILWFNPSKWAVNVKGQINWII"
FT   gene            582518..582910
FT                   /locus_tag="SAK_0649"
FT   CDS_pept        582518..582910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63647.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44696"
FT                   /protein_id="ABA44696.1"
FT                   /translation="MLEFLNRYPVLLEDKSVKETKAILAFTSSTIKANFEVTLPAEEND
FT                   KKFVETLKTCEKLIFEQLYKDKAEAEQFEKINDAIAKSKAQSDKAENMIKLMSATVNDL
FT                   IKTMADGGKLNDTTLNNASENSSTHI"
FT   gene            582933..583061
FT                   /locus_tag="SAK_0650"
FT   CDS_pept        582933..583061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0650"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM79915.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45764"
FT                   /protein_id="ABA45764.1"
FT                   /translation="MMINYFAMQIELGWITIDDVPAFCRERVRKLIEVSTVGTEGK"
FT   gene            583070..583372
FT                   /locus_tag="SAK_0651"
FT   CDS_pept        583070..583372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44379"
FT                   /protein_id="ABA44379.1"
FT                   /translation="MNIDILQIGAASGAILSVVGLWAFVVNPFKTAMQKNEDTMSALKD
FT                   TIKELAYELKDSQRDREKIHKILDIHEQRLGKTEDDIIVNKEQIKTLFNRRNKYD"
FT   gene            583365..583592
FT                   /locus_tag="SAK_0652"
FT   CDS_pept        583365..583592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0652"
FT                   /product="prophage LambdaSa03, holin, phi LC3 family"
FT                   /note="identified by match to protein family HMM PF04531;
FT                   match to protein family HMM TIGR01598"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45504"
FT                   /protein_id="ABA45504.1"
FT                   /translation="MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVT
FT                   LLVLLGVVTDPTTEGLSDSEQALTYHEPKK"
FT   gene            583718..585049
FT                   /locus_tag="SAK_0653"
FT   CDS_pept        583718..585049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0653"
FT                   /product="prophage LambdaSa03, peptidoglycan endolysin"
FT                   /EC_number="3.2.1.17"
FT                   /note="identified by similarity to GB:AAN28166.2; match to
FT                   protein family HMM PF01183; match to protein family HMM
FT                   PF05257"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45123"
FT                   /protein_id="ABA45123.1"
FT                   /translation="MATYQEYKSRSNGNAYDIDGSFGAQCWDGYADYCKYLGLPYANCT
FT                   NTGYARDIWEQRHENGILNYFDEVEVMQAGDVAIFMVVDGVTPYSHVAIFDSDAGGGYG
FT                   WFLGQNQGGANGAYNLVKIPYSATYPTAFRPKSFKNAVTVTDNTGLNKGDYFIDVSAYQ
FT                   QADLTTTCQQAGTTKTIIKVSESIAWLSDRHQQQANTSDPIGYYHFGRFGGDSALAQRE
FT                   ADLFLSNLPSKKVSYLVIDYEDSASADKQANTNAVIAFMDKIASAGYKPIYYSYKPFTL
FT                   NNIDYQKIIAKYPNSIWIAGYPDYEVRTEPLWEFFPSMDGVRWWQFTSVGVAGGLDKNI
FT                   VLLADDSSKMDIPKVDKPQELTFYQKLATNTKLDNSNVPYYEATLSTDYYVESKPNASS
FT                   ADKEFIKAGTRVRVYEKVNGWSRINHPESAQWVEDSYLVNATDM"
FT   gene            complement(585311..585514)
FT                   /locus_tag="SAK_0654"
FT   CDS_pept        complement(585311..585514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AD1752"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46280"
FT                   /protein_id="ABA46280.1"
FT                   /translation="MYFTLLTRMIEMDKELTPQEKANKKWAENNREHRTYLSKRSTARS
FT                   FINKNATKEDLLELKQLIESKL"
FT   gene            585900..586079
FT                   /locus_tag="SAK_0655"
FT   CDS_pept        585900..586079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63656.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45045"
FT                   /protein_id="ABA45045.1"
FT                   /translation="MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEV
FT                   VTVERVEDVMRELE"
FT   gene            586485..586682
FT                   /locus_tag="SAK_0656"
FT   CDS_pept        586485..586682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0656"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45884"
FT                   /protein_id="ABA45884.1"
FT                   /translation="MSEKAILLIILIAFVIIAIIKIALLKLYMNTIKPKVDNEGNIITK
FT                   PVKDDLTPEEREEREFDKDW"
FT   gene            complement(586726..587658)
FT                   /gene="pyrD"
FT                   /locus_tag="SAK_0657"
FT   CDS_pept        complement(586726..587658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="SAK_0657"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by similarity to SP:P54321; match to
FT                   protein family HMM PF01180; match to protein family HMM
FT                   TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44965"
FT                   /db_xref="GOA:Q3K2G4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033886"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2G4"
FT                   /protein_id="ABA44965.1"
FT                   /translation="MVSLKTEIAGFSFDNCLMNAAGIYCMTKEELLAIENSEAGSFVTK
FT                   TGTLEAREGNPQPRYADTDWGSINSMGLPNKGIDYYLDFVTELQDQDNSKNHVLSLVGL
FT                   SPEETHIILKKVENSSYNGLIELNLSCPNVPGKPQIAYDFEMTDLILSEIFSYYQKPLG
FT                   IKLPPYFDIVHFDQAATIFNKYPLAFINCVNSIGNGLVIDDETVVIKPKNGFGGIGGDF
FT                   IKPTALANVHAFYKRLNPSIKIIGTGGVKNGRDAFEHILCGASMVQIGTALQKEGPEIF
FT                   QRVSRELKEIMADKGYQSLEDFRGQLNYL"
FT   gene            complement(587845..589080)
FT                   /gene="fibB"
FT                   /locus_tag="SAK_0658"
FT   CDS_pept        complement(587845..589080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fibB"
FT                   /locus_tag="SAK_0658"
FT                   /product="beta-lactam resistance factor"
FT                   /note="identified by similarity to PIR:G95071; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46228"
FT                   /protein_id="ABA46228.1"
FT                   /translation="MALKELTAKEFESYSGNYDLQSFMQTPEMAKLLKKRGYDITYMGY
FT                   QIDGKMEIISIVYTIPMTGGLHMEVNSGPAHSNSKYLKHFYKELQNYAKSQGALELLIK
FT                   PYDTYQEFTGEGKPKGAPNTYLIDDLTSIGYHHDGLHIGYPGGKPDWHYVKNLEGITPQ
FT                   NLLKSFSKKGRPLVKKAMSFGIKIRVLKREELHIFKDITSSTSDRRDYMDKSLDYYQDF
FT                   YDSFGDKAEFVIATLNFREYDHNLQLNAKKLEEQITVLDNRHQNNTDSAKYHRQRTELV
FT                   NQLASLDKRRKEVEPFIQKFGNQDVVLAGSLFIYSPKETVYLFSGSYTEFNKFYAPAVL
FT                   QEYVMQEALKRQSTFYNFLGIQGNFDGSDGVLRFKQNFNGYIVRKMGTFRYYPNPLKYK
FT                   SIQLLKKILRRT"
FT   gene            complement(589099..590310)
FT                   /locus_tag="SAK_0659"
FT   CDS_pept        complement(589099..590310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0659"
FT                   /product="FemAB family protein"
FT                   /note="identified by similarity to GB:CAB89535.1; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44865"
FT                   /protein_id="ABA44865.1"
FT                   /translation="MYREITAVEHDRFVSESNQTNLLQSSNWPKVKDNWGSQLLGFFDG
FT                   ETQIASASILIKSLPLGFSMLYIPRGPIMDYSNLDIVTKVLKDLKAFGKKQRALFIKCD
FT                   PLIYLKMVNAKDFENSPDEKEGLIAIDHLQRAGADWTGRTTDLAHTIQPRFQANLYANQ
FT                   FGLDKMSKKTRQAIRTSKNKGVDIQFGSHELLEDFAELMKKTEDRKGINLRGIDYYQKL
FT                   LDTYPNNSYITMASLDVAKRLEKIEKECQIAQSERIKSLELNREKKVKQHHGTIDRLNK
FT                   EIDFLKEAQKAYDRDIIPLAATLTLEFGNTSENIYAGMDDYFKSYSAPIYTWFETAQRA
FT                   FERGNIWQNMGGIENDLSGGLYHFKSKFEPIIEEFIGEFNIPVNRLLYKASNYVYALRK
FT                   KRNS"
FT   gene            complement(590323..591543)
FT                   /locus_tag="SAK_0660"
FT   CDS_pept        complement(590323..591543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0660"
FT                   /product="FemAB family protein"
FT                   /note="identified by similarity to GB:CAB89535.1; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45815"
FT                   /protein_id="ABA45815.1"
FT                   /translation="MYHVTVGISEKEYDAFAIASSQTNLLHSSKWAQVKSNWQNERLGF
FT                   YKDDQLVAVASILIKSLPLGFTMLYIPRGPIMDYSNKELVNFVLKTLKNFGRKKRAVFA
FT                   KFDPALLLRQYHLKEENVAEEIDESRQAIDNLKSAGAQWIGPTKAISETIQPRFQANIY
FT                   TKANIEENFPKHTKRLIKDAKHRGVQIYRANIDDLPKFATVVALTENRKGVALRNENYF
FT                   HQLMTIYGEDAYLYLAKVNLPKRLAQFKEQLLQIQKDLSETPSHQKSRLTRLNQQEASV
FT                   KQYILEFQEFSKKYPDEPVIAGILSIRFGNVLEMLYAGMDDSFRKFYPQYLLNARVFED
FT                   AFKNDIVSANLGGVEGSLNDGLTKFKSNFNPMFEEYIGEFNLAINPLLYKLANLAYTIR
FT                   KKQRHSH"
FT   gene            complement(591543..592355)
FT                   /locus_tag="SAK_0661"
FT   CDS_pept        complement(591543..592355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0661"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44688"
FT                   /protein_id="ABA44688.1"
FT                   /translation="MTSIKLVAVDIDGTLLNSKREITPEVAKAVQEAKSKGVKIVIATG
FT                   RPIIGVQDLLEELKLNEEGDYVITFNGGLVQDTATGDDIIKETLTYEDYLDFELLARKL
FT                   GVHMHAITKEGIYTANRDIGKYTIHEVTLVNMPLFYRTPEEMGDKEIIKLMMIDQPDIL
FT                   DAAIAKIPKKVLDNYTIVKSTPFYLEILPKNVNKGTALLHLAEKMGLTVDQTMAIGDEE
FT                   NDRAMLEVVGNPVVMQNGNPELKKIAKYITKSNEESGVAYALREWVIN"
FT   gene            complement(592426..593742)
FT                   /locus_tag="SAK_0662"
FT   CDS_pept        complement(592426..593742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0662"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45550"
FT                   /protein_id="ABA45550.1"
FT                   /translation="MNEKVFRDPVHTYIHVNNQVIYDLINTKEFQRLRRIKQTSTTSFT
FT                   FHGAEHSRFSHCLGVYELARKVTEIFDEHYSDLWNKNESLLTMAAALLHDIGHGAYSHT
FT                   FERLFNTDHEAYTQEIITNPTTEINAILRKVAPDFPDKVASVINHSYPNKQVVQLISSQ
FT                   IDCDRMDYLLRDSYYTAASYGQFDLTRILRVIRPTDSGIAFARNGMHAVEDYIVSRFQM
FT                   YMQVYFHPASRAMELLLQNLLKRARFLFDTHRDFFEQTSPNLIPFFTDQYDLQDYLALD
FT                   DGVMNTYFQSWMQADDNILADLANRFINRKVFKSITFEESDKENLVKMKELVSQVGFDP
FT                   DYYTGVHANFDLPYDVYRPEHSNPRTEIQIIQKNGQLAELSSLSPIVKALTGSNYGDQR
FT                   FYFPKEMLTLDSLFSSTKEEFQSYITNEHLTLTKDNSHS"
FT   gene            593818..594204
FT                   /locus_tag="SAK_0663"
FT   CDS_pept        593818..594204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK33593.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44469"
FT                   /protein_id="ABA44469.1"
FT                   /translation="MKLEINNNIQIDNETEMIHEIHDCQFIEKGSYVYLNYINAEGERV
FT                   VIKANHEELLMTRFSNPKSVMRFHRETPALVNIPTPLGVQHLITETSHYQFDLSQQRLH
FT                   INYVLKQTETGDCFANYELRIQWY"
FT   gene            594548..597232
FT                   /locus_tag="SAK_0664"
FT   CDS_pept        594548..597232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0664"
FT                   /product="calcium-transporting ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45439"
FT                   /protein_id="ABA45439.1"
FT                   /translation="MLKEQKKSLFYTQGQEEVLTSLESSREGLSTTEAKNRLEMYGRNE
FT                   LEEGKKRSLIAKFFDQFKDLMIIILLVAAALSVITEGMHGLTDALIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKDMSSPIARVRRDGHTIEVDSKELVPGDLVMLEAGDVVPADLRLLE
FT                   AASLKIEEAALTGESVPVEKDISQVVAEDAGIGDRVNMAYQNSNVTYGRGYGVVTNTGM
FT                   YTEVGKIADMLANADESETPLKQSLVQLSKLLTYLIVIIAVITFLVGIFVRKEGWIEGL
FT                   MTSVALAVAAIPEGLPAIVTIVLSMGTKTLAKRNSIVRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGVLQSSSEEISVDNNTLRIMNFSNDTKIDPSGKLIGDPTETALVQ
FT                   FGLDKNFDVREVLKNEPRVAELPFDSDRKLMSTIHKESDGRYFIAVKGAPDQLLKRVTK
FT                   IEDNGLVRDITAEDKEAILNTNKELAKQALRVLMMAYKYETQIPTLETDIVESDLVFSG
FT                   LVGMIDPERPEAAEAVRVAKEAGIRPIMITGDHQDTAEAIAKRLGIIDANDTEDHVFTG
FT                   AELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNDGKVVAMTGDGVNDAPSLKTA
FT                   DIGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKSIQYLLSANMAEV
FT                   FTIFFATLLGWDVLAPVHLLWINLVTDTLPAIALGVEPAEPGVMTHKPRGRQSNFFDGG
FT                   VMGAIIYQGILQTILVLGVYGWALMYPEHAGYRMIHADALTMAFATLGLIQLVHAFNVK
FT                   SVYQSIFTVGAFKNRTFNWSIPVAFILLMVTIVVPGFNKLFHVTHLSSTQWLTVVIGSL
FT                   LMVVLTEIVKFIQRKLGQDEKAI"
FT   gene            complement(597277..598137)
FT                   /pseudo
FT                   /locus_tag="SAK_0665"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAN58454.1"
FT   gene            598289..600220
FT                   /gene="fbp"
FT                   /locus_tag="SAK_0666"
FT   CDS_pept        598289..600220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="SAK_0666"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF06874"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46271"
FT                   /db_xref="GOA:Q3K2F6"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2F6"
FT                   /protein_id="ABA46271.1"
FT                   /translation="MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGE
FT                   YDAVDYLLRTGAGSIRAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLSASAY
FT                   KTKLWEMIPLQIQVLKYFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTI
FT                   IEKLFELDQVEDLIIVLSQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFPNLDIQW
FT                   GNHDVTWMGAASGSYLCMVNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYEPLPSF
FT                   VPILDGEEMTHPDELDLLNMIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKDL
FT                   SISIKEVVHQLKDFNSRCIDSKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEKG
FT                   SMYLTYNDNLLFHGCIPMHSNGDFKSFKIAGKTYGGRDLLDLFESQIRLAYARPEKHDD
FT                   LATDIIWYLWCGENSSLFGKNAMTTFERYYVSDKVTHQERKNPYFKLRDKDDICTALLQ
FT                   EFDLPKFGHIVNGHTPVKEKNGEQPIKANGKMLVIDGGFAKGYQKNTGLAGYTLIYNSY
FT                   GIQLISHLPFTSIEEVLSGTNYIIDTKRLVEEAKDRILVKDTTIGQKLTKEIKDLDHLY
FT                   RHFQEYDD"
FT   gene            600310..601434
FT                   /locus_tag="SAK_0667"
FT   CDS_pept        600310..601434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0667"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45856"
FT                   /protein_id="ABA45856.1"
FT                   /translation="MDIKAEIQKLAKEIGISKIGFTTADNFDYLEKSLRASVEEGRNSG
FT                   FEHKVIEDRIYPERLLESAKTIISIGVAYPHKLPQQPQKTSYKRGKITPNSWGLDYHYV
FT                   VGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAGIGFIGKNGLVISKEYGS
FT                   YMFLGELITNLEIEPDKPVDYDCGDCRRCLDACPTSCLIGDGSMNAKRCLSFQTQDKGM
FT                   MDIEFRKKIKTVIYGCDICQICCPYNKGINNPLATEIDPELAQPELIPFLSLSNGQFKE
FT                   KFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKNNNPIHTATAIWALGEIV
FT                   KKPNDEILEFMSNLTLKDEDSRKELELIRHKWQF"
FT   gene            601503..602601
FT                   /gene="prfB"
FT                   /locus_tag="SAK_0668"
FT   CDS_pept        join(601503..601574,601576..602601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="prfB"
FT                   /locus_tag="SAK_0668"
FT                   /product="peptide chain release factor 2, programmed
FT                   frameshift"
FT                   /note="identified by similarity to SP:P28367; match to
FT                   protein family HMM PF00472; match to protein family HMM
FT                   PF03462; match to protein family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44739"
FT                   /db_xref="GOA:Q3K2F4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2F4"
FT                   /protein_id="ABA44739.1"
FT                   /translation="MEVAEIRQKIVENKEKLTSFRRSLDLDRLEEEIALLENQMTEPDF
FT                   WNDNIAAQKTSQELNELKGKYDTFHNMQELSDETELLLEMLDEDDSLKEELEENLMQLD
FT                   KIMGAYEMTLLLSEPYDHNNAILEIHPGSGGTEAQDWGDLLLRMYTRFGNANGFKVEVL
FT                   DYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRLVRISPFDSAKRRHTSFASVEVMPE
FT                   LDDTIEVEVRDDDIKMDTFRSGGAGGQNVNKVSTGVRLTHIPTGIVVSSTVDRTQYGNR
FT                   DRAMKMLQAKLYQLEQEKKAQEVDALKGDKKEITWGSQIRSYVFTPYTMVKDHRTNFEL
FT                   AQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            602620..603312
FT                   /gene="ftsE"
FT                   /locus_tag="SAK_0669"
FT   CDS_pept        602620..603312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SAK_0669"
FT                   /product="cell division ATP binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44889"
FT                   /protein_id="ABA44889.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRNLNLSIQQGEFVYLVGPSGAGKSS
FT                   LIRLLYREEKLSSGRLKVGEFNLNKLKRRQIPILRRSIGVVFQDYKLLPTKTVYENVAF
FT                   AMQVIGAKRRHIKKRVPEVLELVGLKHKMRSFPTQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEIAWEIMHLLERINLQGTTVLMATHNSQIVNTLRHRVIEIEAGSVIRDEE
FT                   KGEYGYHD"
FT   gene            603296..604225
FT                   /locus_tag="SAK_0670"
FT   CDS_pept        603296..604225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0670"
FT                   /product="cell division protein FtsX, putative"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46046"
FT                   /protein_id="ABA46046.1"
FT                   /translation="MVIMINFFRHFWESLKNLKRNFWMTFASVTSVTITLLLVGLFSSV
FT                   LLNVEKLTTDVSGNFTISAFLNVDSTDAQKQVKDKDGKLKDNPDYHKVYDKIKRISGVE
FT                   KVTYSSKAEQLKEVQKEYGSDVIDDTYKDALLDVYVVGTSSAKVSKSVSEAIGRIEGVD
FT                   YTKEPIDSTKLSNLTDNIRIWGFGGVALLIVLAIFLISNTIRMSIMSRRTDIEIMRLVG
FT                   AKNSYIRGPFFFEGAWVGILGAIVPSLIFYFGYQFVFNKFNPKFETSHVSLYPMDIMVP
FT                   AIIGGMVIIGIIIGSLGSVLSMRRYLKI"
FT   gene            complement(604247..605695)
FT                   /locus_tag="SAK_0671"
FT   CDS_pept        complement(604247..605695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0671"
FT                   /product="ISSag8, transposase"
FT                   /note="The translational stop site for this transposase
FT                   gene is located outside the IS element.; identified by
FT                   match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45208"
FT                   /protein_id="ABA45208.1"
FT                   /translation="MFHKENPDYNRNQVGFYSLDELVPKDHLLRQIDEAIDFSFIYDLV
FT                   KDSYCADNGRPSLDPVMLVRIPMIQCLFGIRSMRQTIKDIEVNVAYRWFLGLTLEDKVP
FT                   HFTTYGKNYNRRFQDKQVIEAIFAYILGLCLNAGFIDPTDIFVDGTHIKAAANNHKYIN
FT                   QEVDAQAKFMSDQLEKEIAKDREKHGKKSLGIAKEKEPISKKISTTDPDSGWFHKGEHK
FT                   QVFAYNAQVACDKYGWALGYSIHAGNVHDSQAFPELFDKIKALTPHYLIADSGYKTPSI
FT                   AHYLLTIGIIPVFSYTRPRSKKGMLRLKDFIYDEYYDVYLCPENHPLSYSTTTRDGYRE
FT                   YKSNPAVCQSCPLLSVCTQSKNHQKVITRHLWKDDLEVCEDIRHQRGMKERYQQRKETI
FT                   ERLFGTAKEYHNLRYTRLRGKSKMEATLGLTLACLNMKKYSKIMAGIVFLVCLKVIISR
FT                   PIVITIVKEKTSWINIPVCLQSER"
FT   gene            complement(605840..606550)
FT                   /locus_tag="SAK_0672"
FT   CDS_pept        complement(605840..606550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0672"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO80138.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45985"
FT                   /protein_id="ABA45985.1"
FT                   /translation="MNIKRHSIFLWLTTSILAILMAVGMTIYFNTYQASPLARRIAKTA
FT                   TNHKNYLLFRSKGKVKANIIFYQGALVEEEAYSQLARDLADKGYNTYILKTPLNLPVLS
FT                   PHKAKTIINQNHLTNVYLAGHSLGGVVASQNAKVAPVRGLILLASYPSRKSDLSHKKLR
FT                   VLSITASNDHILNWEKYEEAKKRLPNSSTFRTIVGGNHSRFGNYGHQKGDGKATLSHKS
FT                   SEKQLATFISNFIH"
FT   gene            complement(606547..607245)
FT                   /locus_tag="SAK_0673"
FT   CDS_pept        complement(606547..607245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0673"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44385"
FT                   /protein_id="ABA44385.1"
FT                   /translation="MPFIFRHSFFNKVLIFWYTIIMKIYKTINHIAGENTYYLVNDQAV
FT                   ILIDPGSNGQEIIAKIKSFEKPLVAILLTHTHYDHIFSLDLVRDTFDNPPVYVSEKEAA
FT                   WLSSPDDNLSGLGRHDDIINVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSWGGVSFV
FT                   FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPSHYSVHPGHGMNTTIG
FT                   HEKNFNPFFQ"
FT   gene            607413..608177
FT                   /locus_tag="SAK_0674"
FT   CDS_pept        607413..608177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0674"
FT                   /product="acetoin reductase"
FT                   /EC_number="1.1.1.303"
FT                   /note="identified by similarity to SP:Q04520; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   TIGR02415"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46200"
FT                   /protein_id="ABA46200.1"
FT                   /translation="MSKVAIVTGAGQGIGFAIAKRLHADGFKIGVLDYNEETAQAAVDK
FT                   LSPEDAVAVVADVSKRDQVFDAFQKVVDTFGDLNVVVNNAGVAPTTPLDTITEEQFEKA
FT                   FAINVGGTIWGSQAAQKHFRELGHGGKIINATSQAGCEGNPNLTVYGGTKFAVRGITQT
FT                   LAKDLASEGITVNAYAPGIVKTPMMFDIAHEVGKNAGKDDEWGMEQFAKDITLKRLSEP
FT                   EDVANAVGFLAGDDSNYITGQTIVVDGGMVFH"
FT   gene            608290..610797
FT                   /locus_tag="SAK_0675"
FT   CDS_pept        608290..610797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0675"
FT                   /product="DnaQ family exonuclease/DinG family helicase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01407"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44568"
FT                   /protein_id="ABA44568.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIIDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEQLFLEGCELRTPRIDTVELSQVFYPCLEKYSLGALAESLNIELTDA
FT                   HTAIADARATAQLFIKLKAKISSLPKEVLETILTFADNLLFESYLLIEEAYQEADFVNP
FT                   KEYYFWQGLVLKKEKAVGKPKKLSSDFQVNMALLGMDARPKQVVFADLVKAHFNDQTTT
FT                   FLEAQPGLGKTYGYLLPLLDQSQKQQIIVSVPTKILQDQIMAKEIKHIQELFHIPCHSI
FT                   KGPRNYLKLDAFYKSLQVQDRNRLINRFKMQLLVWLTETTTGDLDEIKQKQRLESYFDQ
FT                   LKHDGEVTQSSLFYDLDFWKRSYDKVAQSQLVIINHAYFLERVQDDKDFAKGKVLVFDE
FT                   AQKLVLGLENFSRGQLDISHQLQVIQKIIDSSIPLLQKRLLESISYELSHAVELFYRHN
FT                   SFEFSETWLKRLKNSINALEVVGLDELQTFFTATYTNYWFETDKVNEKRLTILRGARED
FT                   FLKFSKFLPPTKKTYMISATLQISPKVYLSDLLGGFSSISTEKIAHEKNANQKVWIDTS
FT                   MPNILDLSPEQYAYEIAKRLQDIMTLKQPTLVLLTSKQTMFMVSDYLDKWEIKHLTQDK
FT                   NGLAYNVKKRFDRGESNLLLGTGSFWEGVDFVHRDRLIEVITRLPFDNPKDYFIQKLSQ
FT                   SLTKEGKNFFYDYSLPMTVLKLKQALGRTTRREEQKSAVIILDSRLVIKSYGQTIMHSL
FT                   GRDFEISKEKINKVLTEMAKFLI"
FT   gene            610883..612076
FT                   /locus_tag="SAK_0676"
FT   CDS_pept        610883..612076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0676"
FT                   /product="aspartate aminotransferase, putative"
FT                   /note="identified by similarity to SP:P23034; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45436"
FT                   /protein_id="ABA45436.1"
FT                   /translation="MTYLSERVLNMEESVTLAAGAKARELRVQGRDILSLTLGEPDFAT
FT                   PKNIQQAAIEAITDGRASFYTPSSGLPELKSAINAYFERFYGYSLKPNQVVVGTGAKFI
FT                   LYTFFMTVLNPGDEVIIPTPYWVSYADQIKMAEGKPVFVTAKEVNHFKVTVEQLEAVRT
FT                   DKTKVILLNSPSNPTGMIYKAEELEAIGNWAVEHDILILADDIYGRLVYNGNIFTPISS
FT                   LSESIRNQTIVINGVSKTYAMTGWRVGFAVGNHDIIAAMSKVVSQTTSNLTAVSQYATI
FT                   EALNGSQESFEKMRLAFEERLNIIYPLLCQVPGFEVVKPQGAFYLFPNVTKAMEMKGYT
FT                   DVTAFTDAILEEVGLALVTGAGFGAPENVRLSYATDLETLKEAVRRLHVFMGSNEIN"
FT   gene            612097..613443
FT                   /gene="asnS"
FT                   /locus_tag="SAK_0677"
FT   CDS_pept        612097..613443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="SAK_0677"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="identified by similarity to SP:P39772; match to
FT                   protein family HMM PF00152; match to protein family HMM
FT                   PF01336; match to protein family HMM TIGR00457"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45162"
FT                   /db_xref="GOA:Q3K2E5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2E5"
FT                   /protein_id="ABA45162.1"
FT                   /translation="MSKKLISIVDVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   VIGESHEYPITPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYSTYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   IAEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIKP"
FT   gene            complement(613483..614040)
FT                   /locus_tag="SAK_0678"
FT   CDS_pept        complement(613483..614040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO82299.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46279"
FT                   /protein_id="ABA46279.1"
FT                   /translation="MTKSPARLISFISIAIAINLVGANLALFLRLPIYLDTIGTLLIAV
FT                   ILGPWYAASTAFLSALINWMTTDIFSLYYSPVAIVVAIITGILIKRNCKPSSLLWKSLI
FT                   ISLPGTIIASVITVILFKGITSSGSSIIAQFLHGIGLDMTSSLILVQVGTDYMDRLISL
FT                   ILVFSTITLLKKHSPNLINQRF"
FT   gene            complement(614037..615020)
FT                   /locus_tag="SAK_0679"
FT   CDS_pept        complement(614037..615020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0679"
FT                   /product="inosine-uridine preferring nucleoside hydrolase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45373"
FT                   /protein_id="ABA45373.1"
FT                   /translation="MNKEKIIIDCDPGIDDTLALMYAIQHPKLEVVAITITAGNSPVEL
FT                   GLKNTFVTLELLNRHDIPVYVGDNLPLQREFVSAQDTHGMDGLGENNFTLAQPIIFQEE
FT                   SADCFLANYFEHKNDTSIIALGPLTNISRALQTNPKLGKHCKRFISMGGSFKSHGNCSP
FT                   VAEYNYWCDPHAAQYVFENLDKKIEMVGLDITRHIVLTPNHLSYMERINPDVSSFIQKI
FT                   TKFYFDFHWQYEHIIGCVINDPLAIAYFVNENIATGFDSYTDVACHGIAMGQTIVDQYH
FT                   FYKKDANSKILTSVNTNLFWNDFMTVLLHAQNSVIIEDLEMLGLNK"
FT   gene            complement(615266..615679)
FT                   /locus_tag="SAK_0680"
FT   CDS_pept        complement(615266..615679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0680"
FT                   /product="organic hydroperoxide resistance protein,
FT                   putative"
FT                   /note="identified by similarity to GB:AAL73576.1; match to
FT                   protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44529"
FT                   /protein_id="ABA44529.1"
FT                   /translation="MLYEVTSSNTQGVDGKVYLSNGKIVETNHPLNHLPGFNPEELIAL
FT                   AWSTCLNATIKAILEQKGFKDLKSRVDVTCQLMKEKQVGKGFYFQVNAVASIEKLSLSD
FT                   SKLIVNKAHSRCPISKLISNAKTINLDTVKWSV"
FT   gene            615833..616723
FT                   /locus_tag="SAK_0681"
FT   CDS_pept        615833..616723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0681"
FT                   /product="ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF03668"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45007"
FT                   /db_xref="GOA:Q3K2E1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2E1"
FT                   /protein_id="ABA45007.1"
FT                   /translation="MSDEQIKLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPTLVPKF
FT                   LELAAQSGDTSKIAMVVDMRSRLFFREINSILDSLEINDNINFKILFLDATDTELVSRY
FT                   KETRRSHPLAADGRVLDGISLERELLAPLKSMSQNVVDTSELTPRQLRKVISKEFSNQD
FT                   SQSSFRIEVMSFGFKYGIPLDADLVFDVRFLPNPYYKPELRDKTGLDTEVYDYVMSFDE
FT                   SDDFYDHLLALIKPILPGYQNEGKSVLTVAIGCTGGQHRSTAFAHRLSEDLKADWTVNE
FT                   SHRDKNKRKETVNRS"
FT   gene            616918..617694
FT                   /locus_tag="SAK_0682"
FT   CDS_pept        616918..617694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01826"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44672"
FT                   /protein_id="ABA44672.1"
FT                   /translation="MPKFYEQIFQYRFAEGDGDFAGHPLGNLIIAGVAEMQGSTYNAMQ
FT                   SLTQFFHTTGKIYPSSEHPLTLHAVFKDGHEVVGESQIADYKGMIDHVYVTNTYNEETP
FT                   TASRKVVDAILESDMIVLGPGSLFTSILPNLVIPEIKQALLETRAEVAYVCNIMTQRGE
FT                   TEHFTDADHVEVLKRHLGQDAIDTVLVNIEKVPESYMENNHFDEYLVQVEHDFSGLRKH
FT                   ARRVISSNFLKLEKGGAFHHGDFVVEELMNLVGTHL"
FT   gene            617691..618602
FT                   /locus_tag="SAK_0683"
FT   CDS_pept        617691..618602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK33617.1; match to
FT                   protein family HMM PF02650; match to protein family HMM
FT                   TIGR00647"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46160"
FT                   /db_xref="GOA:Q3K2D9"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2D9"
FT                   /protein_id="ABA46160.1"
FT                   /translation="MSFTVKVKEELLGHKSENKMELSAIIKMSGSLGLANHGLNLSITT
FT                   ENAKIARHIYSMLEEHYHLQPEIKYHQKTNLRKNRVYTVFIEEKVDVILADLKLADAFF
FT                   GIETGIEHSILDNDENGRAYLRGAFLSTGTVREPDSGKYQLEIFSVYLDHAQDLANLMK
FT                   KFMLDAKVIEHKHGAVTYLQKAEDIMDFLIVIDAMEARDAFEEIKMIRETRNDINRANN
FT                   VETANIARTITASMKTINNIIKIMDTIGFDALPSDLRQVAQVRVAHPDYSIQQIADSLE
FT                   TPLSKSGVNHRLRKINKIADEL"
FT   gene            618617..620014
FT                   /gene="pepDA"
FT                   /locus_tag="SAK_0684"
FT   CDS_pept        618617..620014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepDA"
FT                   /locus_tag="SAK_0684"
FT                   /product="dipeptidase A"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by similarity to SP:Q48558; match to
FT                   protein family HMM PF03577"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45333"
FT                   /protein_id="ABA45333.1"
FT                   /translation="MACTTILVGKKASYDGSTMIARTEDSVNGDFTPKKLKVMTSKDQP
FT                   RHYKSVLSNFEVDLPDNPLPYTSVPDALGKDGIWGEAGINSKNVAMSATETITTNSRVL
FT                   GADPLVSDGIGEEDILTLVLPYIQSAREGVERLGAILEKYGTYESNGIAFSDTEEIWWL
FT                   ETIGGHHWIARRVPDDVYVTNPNQLGIDHFEFNNCDDYMCSSDLKEFIEQYHLDLTYSN
FT                   EHFNPRYAFGSQRDKDRHYNTPRSWAMQRFLNPEIEQDPRSLFIPWCQKPYRKITVEDI
FT                   KYVLSDHYQDSVYDPYGPEGDAVSRRAFRSVGINRTSQTSILQLRPNKSLETTGVQWLS
FT                   YGSMPFATMVPLFTQVETVPNYFSNTTKDASTDNFYWTNRLIAALADPHFYQHEADIES
FT                   YIERTMAQGHAHINGVDREVAENKEIDFQQKNQEMSDYIQKESQELLNRILFDASNLMT
FT                   NRFSMGD"
FT   gene            620156..621676
FT                   /gene="adcA"
FT                   /locus_tag="SAK_0685"
FT   CDS_pept        620156..621676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="SAK_0685"
FT                   /product="zinc ABC transporter, zinc-binding protein AdcA"
FT                   /note="identified by similarity to SP:Q8CWN2; match to
FT                   protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45415"
FT                   /protein_id="ABA45415.1"
FT                   /translation="MRKKFLLLMSFVAMFAAWQLVQVKQVWADSKLKVVTTFYPVYEFT
FT                   KNVVGDKADVSMLIKAGTEPHDFEPSTKNIAAIQDSNAFVYMDDNMETWVPKVAKSVKS
FT                   KKVTTIKGTGDMLLTKGVEEEGEEHEGHGHEGHHHELDPHVWLSPERAISVVENIRNKF
FT                   VKAYPKDAASFNKNADAYIAKLKELDKEYKNGLSNAKQKSFVTQHAAFGYMALDYGLNQ
FT                   VPIAGLTPDAEPSSKRLGELAKYIKKYNINYIYFEENASNKVAKTLADEVGVKTAVLSP
FT                   LEGLSKKEMAAGEDYFSVMRRNLKVLKKTTDVAGKEVAPEEDKTKTVETGYFKTKDVKD
FT                   RKLTDYSGNWQSVYPLLQDGTLDPVWDYKAKSKKDMTAAEYKKYYTAGYKTDVESIKID
FT                   GKKHQMTFVRNGKSQTFTYKYAGYKILTYKKGNRGVRYLFEAKEKDAGQFKYIQFSDHG
FT                   IKPNKAEHFHIFWGSESQEKLFEEMENWPTYFPAKMSGREVAQDLMSH"
FT   gene            complement(621789..622049)
FT                   /gene="rpmE"
FT                   /locus_tag="SAK_0686"
FT   CDS_pept        complement(621789..622049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="SAK_0686"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44542"
FT                   /db_xref="GOA:Q3K2D6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2D6"
FT                   /protein_id="ABA44542.1"
FT                   /translation="MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANTAQ"
FT   gene            complement(622158..623093)
FT                   /locus_tag="SAK_0687"
FT   CDS_pept        complement(622158..623093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0687"
FT                   /product="DHH family protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44971"
FT                   /protein_id="ABA44971.1"
FT                   /translation="MIIFQQILDKIKEYDTIIIHRHMRPDPDALGSQIGLRDIIRHNFP
FT                   KKKVLATGFDEPTLAWIAKMDQVTDQDYQGALVVVTDTANTPRIDDERYKKGDFLIKID
FT                   HHPNDEVYGDLSYVDTNASSASEIVTDFALSCDLLLSTSAARVLYNGIVGDTGRFLYPA
FT                   TTSKTLKIASKLREFDFDFSAMARQMDSFPFKIAKLQGFIFEQLKIDKNGAACVTLTQE
FT                   DLKRFDVTDAETAAIVGVPGKIDIVESWAIFVEQSDGHYRVRLRSKSHIINEIAKRHNG
FT                   GGHPLASGANSYSLEENQAIYQEIQEILSL"
FT   gene            623359..624381
FT                   /gene="add"
FT                   /locus_tag="SAK_0688"
FT   CDS_pept        623359..624381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="SAK_0688"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="identified by match to protein family HMM PF00962;
FT                   match to protein family HMM TIGR01430"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45869"
FT                   /db_xref="GOA:Q3K2D4"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2D4"
FT                   /protein_id="ABA45869.1"
FT                   /translation="MTQAVLKELAKAELHCHLDGSLSLPAIRKLANMADIILPSSDKEL
FT                   RKYVIAPAQTESLVDYLKTFEFIRPLLQTKEALRFAAYDVARQAALENVIYIEIRFAPE
FT                   LSMDKGLTASDTVLAVLEGLADAQKEFNIVARALVCGMRQSSHKTTKDIIKHIVDLAPK
FT                   GLVGFDFAGDEFSYPTDSLVDLIQEVKRSGYPMTLHAGECGCAKHIADSLNLGIKRMGH
FT                   VTALTGQRDLIKRFVEEDVVAEMCLTSNLQTKAASSIQSFPYQELYDAGGKITINTDNR
FT                   TVSDTNLTKEYSLFVTYFGTKIEDFLVFNQNAVKASFTSDSEKDTLLHKLQENYDSYLK
FT                   "
FT   gene            624440..624883
FT                   /locus_tag="SAK_0689"
FT   CDS_pept        624440..624883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0689"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF07972; match to protein
FT                   family HMM TIGR01753"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44674"
FT                   /protein_id="ABA44674.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVADKLRDLGLDVEVEECTMVDAAD
FT                   FEDADIAIVATYTYGDGDLPDEIVDFYEDLAEVDLSGKVYGVVGSGDTFYDYFCKSVDE
FT                   FEAQFALTGAQKGADCVKVDLAAEDEDIENLEAFAEEIASKLN"
FT   gene            624960..625235
FT                   /locus_tag="SAK_0690"
FT   CDS_pept        624960..625235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0690"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="identified by match to protein family HMM PF01817;
FT                   match to protein family HMM TIGR01805"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45469"
FT                   /protein_id="ABA45469.1"
FT                   /translation="MELEEIRQEIDEIDQQLVSLLETRMGLILEVIAFKKKHRLPVLDN
FT                   NRENEVLNNVLKKVQNHQFDDVIRATFKDIMTESRVYQKENIVDGD"
FT   gene            625228..626424
FT                   /locus_tag="SAK_0691"
FT   CDS_pept        625228..626424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0691"
FT                   /product="voltage-gated chloride channel family protein"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45468"
FT                   /protein_id="ABA45468.1"
FT                   /translation="MIKRFDNYAQYVLVLGFSLLIGGVVGAITAVFGRVLLFLTAFRSD
FT                   YIAYLLPFLSIVGLFIVFVYQKFGGKSVKGMGLVFEVGHGNEETIPKRLVPLVILTTWL
FT                   THLFGGSAGREGVAVQIGATVSHYFQKYCRLQNASQLFLVMGMAAGFAGLFQTPLAATF
FT                   FAIEVLVVGRLMVSYVLPSLIAALTANFVSHSLGLEKFSHSIATSMALTPDIILKLLVL
FT                   GLCFGLCGNLFAYLLAKAKLIASSRLLNPYKRIFTLGLLATFLLFIFHFGRYSGLGTNL
FT                   IEASFTNKNLYDYDWLLKLCLTVITLAAGYQGGEVTPLFAIGASLGVIIAPILGLPVIL
FT                   VAALGYTSVFGSATNTLLGPILIGGEVFGFANTPYFVIVCLVAYSISHAHTIYGAQSR"
FT   gene            627004..627351
FT                   /gene="rplS"
FT                   /locus_tag="SAK_0692"
FT   CDS_pept        627004..627351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="SAK_0692"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by similarity to SP:P30529; match to
FT                   protein family HMM PF01245; match to protein family HMM
FT                   TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46136"
FT                   /db_xref="GOA:Q3K2D0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2D0"
FT                   /protein_id="ABA46136.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPEFRAGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            627462..627533
FT                   /locus_tag="SAK_0693"
FT   tRNA            627462..627533
FT                   /locus_tag="SAK_0693"
FT                   /product="tRNA-Arg"
FT   gene            complement(627496..628380)
FT                   /pseudo
FT                   /locus_tag="SAK_0694"
FT                   /note="site-specific recombinase, phage integrase family,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts which are not the result of
FT                   sequencing error; identified by similarity to
FT                   GB:AAF12706.1"
FT   gene            628380..628784
FT                   /locus_tag="SAK_0695"
FT   CDS_pept        628380..628784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0695"
FT                   /product="ISSag6, transposase orfA"
FT                   /note="identified by similarity to GB:CAD46233.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45898"
FT                   /protein_id="ABA45898.1"
FT                   /translation="MIYSTLAKEQGVQGYLDGKGSLRDICKWYDISSRSVLQKWIKRYT
FT                   SGEDLKATSRGYSRMKQGRQATFEERVEIVNYTIAHGKDYQAAIEKFGVSYQQIYSWVR
FT                   KLEKNGSQGLVDRRVKGLESRPDLTEIEQL"
FT   gene            628946..629428
FT                   /pseudo
FT                   /locus_tag="SAK_0696"
FT                   /note="This orfB transposase gene has at least one
FT                   frameshift. The closest ISFinder database match is to orfB
FT                   of the IS3 family element, ISSau2. The end-sequences of
FT                   this single copy element were not identified.; ISSag6,
FT                   transposase orfB, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts which are not the
FT                   result of sequencing error"
FT   gene            complement(629936..630097)
FT                   /locus_tag="SAK_0697"
FT   CDS_pept        complement(629936..630097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0697"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO04335.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45715"
FT                   /protein_id="ABA45715.1"
FT                   /translation="MGGIGAHKFYAGKIGQVFLYIIFSITFIPGIIDLIEALMALGKQT
FT                   DEYGNIIV"
FT   gene            630839..632116
FT                   /locus_tag="SAK_0698"
FT   CDS_pept        630839..632116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0698"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44594"
FT                   /protein_id="ABA44594.1"
FT                   /translation="MIKNAIAYITRKKNRTLIIFAILTIVLSCLYSCLTIMKSSNEIEK
FT                   ALYESSNSSISITKKDGKYFNINQFKNIEKIKEVEEKIFQYDGLAKLKDLKVVSGKQSI
FT                   NREDLSDEFKNVVSLEATSNTKRNLLFSSGVFSFKEGKNIEENDKNSILVHEEFAKQNK
FT                   LKLGDEIDLELLDTEKSGKIKSHKFKIIGIFSGKKQETYTGLSSDFSENMVFVDYSTSQ
FT                   EILNKSENNRIANKILMYSGSLESTELALNKLKDFKIDKSKYSIKKDNKAFEESLESVS
FT                   GIKHIIKIMTYSIMLGGIVVLSLILILWLRERIYEIGIFLSIGTTKIQIIRQFIFELIF
FT                   ISIPSIISSLFLGNLLLKVIVEGFINSENSMIFGGSLINKSSFMLNITTLAESYLILIS
FT                   IIVLSVVMASSLILFKKPKEILSKIS"
FT   gene            632126..632782
FT                   /locus_tag="SAK_0699"
FT   CDS_pept        632126..632782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0699"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GB:AAK92524.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44497"
FT                   /protein_id="ABA44497.1"
FT                   /translation="MDILEIKNVNYSYANSKEKVLSGVNQKFELGKFYAIVGKSGTGKS
FT                   TLLSLLAGLDKVQTGKILFKNEDIEKKGYSNHRKNNISLVFQNYNLIDYLSPIENIRLV
FT                   NKSVDESILFELGLDKKQIKRNVMKLSGGQQQRVAIARALVSDAPIILADEPTGNLDSV
FT                   TAGEIINILKELAQDRNKCVIVVTHSKEVADSADIILELSGKKLKKVNKMNLEVE"
FT   gene            632782..634158
FT                   /locus_tag="SAK_0700"
FT   CDS_pept        632782..634158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0700"
FT                   /product="ABC transporter, permease protein Vexp3"
FT                   /note="identified by similarity to PIR:H95069; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45385"
FT                   /protein_id="ABA45385.1"
FT                   /translation="MIKNAFAYVTRKSLKSLIIILVILSMATLSIISLSIKDATDRASK
FT                   ETFANITNSFSMEINRQVNPGTPRGGGNVKGEDIKKISQTNSIDSYVKRINSVADLVDH
FT                   DIIETQDTLANQSPERAKNFKRTVMLTGVNDSAKETKFVSEAYKLVEGKHLENKDKNKI
FT                   LMHKDLAKKNNLKVGDKIKIKSNLFDADNEKVANETVEVEIKGLFDGHNSGGVSAAQEL
FT                   YENTLITDVHSAAKVYGNTEDTAVYQDATFFVKGDKNLDSVIKDLGKLDINWREYNLIK
FT                   SSSNYPALQQSISGIYSISNKLFVGSLIFAGVVVSLLLFLWMNARKKEIAVLLSLGISK
FT                   LEIFGQFIIEMVFISIPALLGSYFLAQYTADKLGNNILNKVTGDIAKQIARQSASSQLG
FT                   GGAEAEGFNKTLSGLDINVLPKFIIYVVIFMSFVLLVSLILSSIYTLRKNPKELLIDNN
FT                   "
FT   gene            634255..634908
FT                   /gene="vncR"
FT                   /locus_tag="SAK_0701"
FT   CDS_pept        634255..634908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncR"
FT                   /locus_tag="SAK_0701"
FT                   /product="DNA-binding response regulator VncR"
FT                   /note="identified by similarity to GB:AAD25108.1; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46321"
FT                   /protein_id="ABA46321.1"
FT                   /translation="MKILTVEDDKLIREGISEYLSEFGYTVIQAKDGREALSKFNSDIN
FT                   LVILDIQIPFINGLEVLKEIRKKSNLPILILTAFSDEEYKIDAFTNLVDGYVEKPFSLP
FT                   VLKARIDSLIKKNFGHLEKFEYKNLSVNFNSYTAKINDEKIDVNAKELEILKCLLDNDG
FT                   QVLTRMQIIDYVWKDSEEIPYDRVVDVYIKELRKKLQLDCITTIRNVGYKLERK"
FT   gene            634905..636206
FT                   /locus_tag="SAK_0702"
FT   CDS_pept        634905..636206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0702"
FT                   /product="sensor histidine kinase VncS, putative"
FT                   /note="identified by similarity to GB:AAD25109.1; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45199"
FT                   /protein_id="ABA45199.1"
FT                   /translation="MKKLKIFPKMFIQIFSILGILIILVHSLFFFIFPKTYLETRKVKI
FT                   HIMADEISKNMNGKELKYLDQTLELYSKSSDIKVFIKKNNNKNELQINDNINVNVKSDS
FT                   NSLIIEEREIKLHDGKKIHLQFVSTADMQKDAKDLSLKFLPYSLSISFLFSIVISLIYA
FT                   KSIKNNIQEITMVTDKMIKLDKETRLKISSNDEIGQLKQQINDLYCALLNTINDLEFKN
FT                   KEILKLEKLKYDFFKGASHELKTPLSSLKILLENMKYNIGKYKDRDFYISECINIVDNL
FT                   TKNVSQILSFYSIKDLNNDEEYLNVGDTLDEVLEKYSILVNQKKININKELLDYNIYIG
FT                   KTALNIVFSNLISNAVKYTNRNGIINIKIANDWLLIENSYDKNKILDASFDLKLDNSNG
FT                   LGLNIVKNILNKYNIKYEILHGENYFIFKIKIIS"
FT   gene            complement(636258..636845)
FT                   /locus_tag="SAK_0703"
FT   CDS_pept        complement(636258..636845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0703"
FT                   /product="transposase OrfB, IS3 family, truncation"
FT                   /note="identified by similarity to GB:AAM99533.1; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45013"
FT                   /protein_id="ABA45013.1"
FT                   /translation="MATVKTKTALKKTQKTYPQNLLNQKFNPDKPNQVWSTDFTYISIG
FT                   YKKYVYLCAIIDLYSRKYIAWKLSHRMDAKLACDTLELALNKRKIEGTLLFHSDQGSQF
FT                   KAREFRKIIDDNNIMHSFSKPRYPYDNAVTEAFFKYLKHRQINQKNYQNIKQVQLDCFE
FT                   YIENFYNNYIPHTANLGLTPNQKEENYFNAIK"
FT   gene            637083..637262
FT                   /locus_tag="SAK_0704"
FT   CDS_pept        637083..637262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0704"
FT                   /product="CsbD family protein"
FT                   /note="identified by match to protein family HMM PF05532"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45636"
FT                   /protein_id="ABA45636.1"
FT                   /translation="MSQEKLKSKLDQAKGGAKEGFGKITGDKELEAKGFIEKTIAKGKE
FT                   LADDAKDAVKEKLK"
FT   gene            637304..637492
FT                   /locus_tag="SAK_0705"
FT   CDS_pept        637304..637492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0705"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC63656.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44466"
FT                   /protein_id="ABA44466.1"
FT                   /translation="MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVRE
FT                   EEVVTVERVLDVLRKLS"
FT   gene            637917..639122
FT                   /locus_tag="SAK_0706"
FT   CDS_pept        637917..639122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0706"
FT                   /product="cell division protein, FtsW/RodA/SpoVE family"
FT                   /note="identified by similarity to GB:AAM22611.1; match to
FT                   protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45559"
FT                   /protein_id="ABA45559.1"
FT                   /translation="MSQKSNYFKGQIDYAVVIPVFFLLMIGLASIYVATMNDYPSNIYI
FT                   AMFQQVSWIIMGCIIAFVVMLFSTEFLWKATPYLYALGLTLMVLPLIFYSPQLFAATGA
FT                   KNWVTIGSVTLFQPSEFMKISYILMLSRITVSFHQKNRKTFQDDWKLLGLFGLVTLPVM
FT                   ILLMLQKDLGTALVFLAILSGLILLSGISWWIILPILSTIVLFIASFLMIFISPNGKEW
FT                   FYNLGMDTYQINRLSAWIDPFSFADSIAYQQTQGMVSIGSGGVTGKGFNILELSVPVRE
FT                   SDMIFTVIAENFGFIGSAIVLGLYLIIIYRMLRITIESNNQFYTFISTGFIMMIVFHVF
FT                   ENIGAAVGILPLTGIPLPFISQGGSSLLSNLIGIGLVLSMSYQNTVRQAKANGSHLKYR
FT                   SI"
FT   gene            639241..639801
FT                   /locus_tag="SAK_0707"
FT   CDS_pept        639241..639801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0707"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45086"
FT                   /protein_id="ABA45086.1"
FT                   /translation="MNYHDYIWDLGGTLLDNYESSTRAFVETLKEFGYQADHDSVYQKL
FT                   KESTADAIAYFIPEEADFLKEYKANEAKVLETPILFQGAKELLAKIQRQGSRNFLVSHR
FT                   DNQVIVILEKTEIIDYFTEVVTADNGFSRKPSPESMLYLKEKYQIDNCLVIGDRDIDKQ
FT                   AGESAGFDTLLVDGSKSLMEIIE"
FT   gene            639823..641754
FT                   /gene="gyrB"
FT                   /locus_tag="SAK_0708"
FT   CDS_pept        639823..641754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SAK_0708"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44807"
FT                   /protein_id="ABA44807.1"
FT                   /translation="MEQRAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEI
FT                   VDNSIDEALAGFAGHIKVYIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGG
FT                   KFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKNGKVHYQEYQRGVVVNDLEIIGDTD
FT                   LSGTTVHFTPDPEIFTETTVFDFDKLAKRIQELAFLNRGLRISISDKREGQEVEKEYHY
FT                   EGGIGSYVEFINENKEVIFENPIYTDGELDGISVEVAMQYTTGYQETVMSFANNIHTHE
FT                   GGTHEQGFRTALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQT
FT                   KTKLGNSEVVKITNRLFSEAFNRFLLENPQVAKKIVEKGILASKARIAAKRAREVTRKK
FT                   SGLEISNLPGKLADCSSNNAEMNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVE
FT                   KATMDKILANEEIRSLFTAMGTGFGADFDVSKVRYQKLVIMTDADVDGAHIRTLLLTLI
FT                   YRFMRPVLEAGYVYIAQPPIYGVKVGSEIKAYIQPGVNQEEELRQALDTYSSGRSKPTV
FT                   QRYKGLGEMDDHQLWETTMDPENRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEAN
FT                   AVYSNLDI"
FT   gene            641848..643572
FT                   /gene="ezrA"
FT                   /locus_tag="SAK_0709"
FT   CDS_pept        641848..643572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ezrA"
FT                   /locus_tag="SAK_0709"
FT                   /product="septation ring formation regulator EzrA"
FT                   /note="identified by match to protein family HMM PF06160"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45470"
FT                   /db_xref="GOA:Q3K2B6"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2B6"
FT                   /protein_id="ABA45470.1"
FT                   /translation="MSSGIILLLVAIVLLVIIAYVVGVVIRKRNDTLIANLETRKQELV
FT                   DLPVQEEIEQVKLLHLIGQSQSTFREWNQKWTDLSTNSFKDIDFHLVEAENLNDSFNFV
FT                   RAKHEIDNVDSQLTIIEEDIVSIREALEVLKEQEEKNSARVTHALDLYETLQKSISEKE
FT                   DNYGTTMPEIEKQLKNIEAEFSHFVTLNSTGDPIEASEVLNKAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKDIEQRFQEVREAIRSNSDGLVSLDLD
FT                   RARDENEHIQEKIDKLYDIFEREIAAYKVAHKDSKIIPQFLAHAKSNNEQLGHEIKRLS
FT                   AKYILNENESLSLRSFTNDLEEIETKVLPSVENFGQEASPYTHLQILFERTLKTLTTVE
FT                   ENQMEVFEAVKTIESVETRARQNMDKYVNKLHMIKRFMEKRNLPGIPQDFLSTFFTTSS
FT                   QIEALINELSRGRIDIEAVSRLNDVTTNAIANLEQATYLVVQDATLTEQLLQYSNRYRS
FT                   FEQNVQKSFEQALYLFEVEHNYKASFDEISYALETVEPGVTDRFVTSYEKTQERIRF"
FT   gene            643666..644307
FT                   /gene="serB"
FT                   /locus_tag="SAK_0710"
FT   CDS_pept        643666..644307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="SAK_0710"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00338; match to protein
FT                   family HMM TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44558"
FT                   /protein_id="ABA44558.1"
FT                   /translation="MIKGLLVMDVDSTLIMEEAIDLLAIEAGVGKQVAALTDAAMRGEL
FT                   DFEEALKKRVALLKGLPVTILTDILSSIHFTPGAYELIKECHKRQMKVGLVSGGFHETI
FT                   DILAKQLQVDYVKANRLGVKGGFLTGEVEGEIVTKEVKKIKLKEWASENHLDLSQTIAM
FT                   GDGANDLPMIKSAGVGIAFCAKPIVREEAAYQINEKNLLKVFDIIDANEN"
FT   gene            complement(644328..644813)
FT                   /locus_tag="SAK_0711"
FT   CDS_pept        complement(644328..644813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0711"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46220"
FT                   /protein_id="ABA46220.1"
FT                   /translation="MEIWDAYDQYGFITGLTLNRDQNIPQGLFHLVVDVILFHEDGDVL
FT                   MMKRHPKKKAFPAYFEATAGGSALKGENAKQAILRELKEETGIVPQCLTFLNREWFSER
FT                   SYFVDHFIAKYNGAKDIITLQEGETVDYIWLKPEYIDLFLSKNKLIPSQIKLLKSLI"
FT   gene            complement(644826..645281)
FT                   /locus_tag="SAK_0712"
FT   CDS_pept        complement(644826..645281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0712"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58933.1; match to
FT                   protein family HMM PF07997"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45337"
FT                   /protein_id="ABA45337.1"
FT                   /translation="MTELDNKILQKASGENRLDPDQQRYYLGTYKERVVLHLSLKEAQE
FT                   EKFQLAITSALNNLILEYPNLSLKLSPNLPTDVQMFYMKLANRLSLAATIVNEANANSP
FT                   FGIIIHSDKAENVEWNDFETQFPDLFNSPKKEESPKKSLWQHFFSQK"
FT   gene            645479..646786
FT                   /gene="eno"
FT                   /locus_tag="SAK_0713"
FT   CDS_pept        645479..646786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="SAK_0713"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45999"
FT                   /db_xref="GOA:Q3K2B2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2B2"
FT                   /protein_id="ABA45999.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYGGLGTQKAVDNVNNVIAEAIIGYDVRDQQAIDRAMIALDGTPNKG
FT                   KLGANAILGVSIAVARAAADYLEVPLYSYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIMPVGAPTFKEALRWGAEVFHALKKILKERGLETAVGDEGGFAPKFEGTEDGVETI
FT                   LKAIEAAGYEAGENGIMIGFDCASSEFYDAERKVYDYSKFEGEGGAVRTAAEQIDYLEE
FT                   LVNKYPIITIEDGMDENDWDGWKALTERLGGRVQLVGDDFFVTNTDYLARGIKEEAANS
FT                   ILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSL
FT                   SRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK"
FT   gene            complement(646894..647958)
FT                   /locus_tag="SAK_0714"
FT   CDS_pept        complement(646894..647958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0714"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:D86644"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45109"
FT                   /protein_id="ABA45109.1"
FT                   /translation="MKRKQFIKLGIATLLTVISLYTPINLATNHTTENIVTAQEYKTKE
FT                   NGTLPFKHKRQLVLGELDDKGRATFAHIQLKVKDEPKKKRVKRLKTTPVGWHNFKFYYN
FT                   DGTQKAWLMSRGRLICHQFSGLNNERKNLVPMTNWLNTGNYNSTNSSNPESMLFYEKQL
FT                   KTWLSTHKNYYLDYKVTPIYQNNELIPRKIELKYVGIDKTGKLLPIFIGNKSTQDQFGI
FT                   STVTLENTSPNATIDYLSGKAQNTVLSAKEQRKLIAKHEEEKRLAEKKAEEEKAAAETQ
FT                   KKLEEEQARLAAEAQRKQEEEQARLAAETQKKQETLVQEQTSQGYKRDYRGRWHRPNGQ
FT                   YASKAEIAAAGLQW"
FT   gene            648187..649470
FT                   /gene="aroA"
FT                   /locus_tag="SAK_0715"
FT   CDS_pept        648187..649470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="SAK_0715"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45909"
FT                   /db_xref="GOA:Q3K2B0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K2B0"
FT                   /protein_id="ABA45909.1"
FT                   /translation="MKLLTNANTLKGTIRVPGDKSISHRAIIFGSISQGVTRIVDVLRG
FT                   EDVLSTIEAFKQMGVLIEDDGEIITIYGKGFAGLTQPNNLLDMGNSGTSMRLIAGVLAG
FT                   QEFEVTMVGDNSLSKRPMDRIALPLSKMGARISGVTNRDLPPLKLQGTKKLKPIFYHLP
FT                   VASAQVKSALIFAALQTKGESLIVEKEQTRNHTEDMIRQFGGHLDIKDKEIRLNGGQSL
FT                   VGQDIRVPGDISSAAFWIVAGLIIPNSHIILENVGINETRTGILDVVSKMGGKIKLSSV
FT                   DNQVKSATLTVDYSHLQATHISGAMIPRLIDELPIIALLATQAQGTTVIADAQELKVKE
FT                   TDRIQVVVESLKQMGADITATADGMIIRGNTPLHAASLDCHGDHRIGMMIAIAALLVKE
FT                   GEVDLSGEEAINTSYPNFLEHLEGLVNA"
FT   gene            649463..649975
FT                   /gene="aroK"
FT                   /locus_tag="SAK_0716"
FT   CDS_pept        649463..649975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SAK_0716"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44918"
FT                   /protein_id="ABA44918.1"
FT                   /translation="MPKVLLGFMGVGKTSVANCLENEVIDMDSLIEKHIGMSISRFFTE
FT                   EGEASFRALESQFLNELLKKKNEGLVIASGGGIVLLEENRRLLTLNRHNNILLTGSFEV
FT                   LYHRIKKDEKNRRPLFLNHSKEEFYDIYQKRMLLYSGLSDMIIDTDYLTPQKIATVIGE
FT                   SLVNLSN"
FT   gene            650032..651405
FT                   /locus_tag="SAK_0717"
FT   CDS_pept        650032..651405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0717"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44877"
FT                   /protein_id="ABA44877.1"
FT                   /translation="MSRNNYGQLNHHEELRYNYLLKNIHYLNEREKMEFQYLHYKKTAV
FT                   RPQRRTESPPTNSYYEEPYSDSYYQDDDFYSEPQLTSQGLPIYQEERAPKKKKQRARKE
FT                   KQRVKVMAPFPPKAITPPRKKKKFKGFLKFIGIILLIVLSGMVFMFVKGMRDVNNGKSH
FT                   YSPAIIEDFKGKDAVDGTNILILGSDKRVSERSTDARTDTIMVANVGNKDNKVKMVSFM
FT                   RDLLVNIPNYSTEGYYDMKLNASFNLGEQDNHKGAEYVRQTLKNHFDIDIKYYVMVDFE
FT                   TFADAIDTLFPNGVKINAKFGLVGGQSADSVKVPDDLRMKNGVVPSQKIKVGIQYMDGR
FT                   TLLNYARFRKDDDGDFGRTQRQQQVMRAIVSQIKDPRRLFTGSAAIGKAYALTSSNLSY
FT                   SFVLTDGIPILSDAKNGIKQMTIPREGDWVDDYDQYGGQGLTIDFAKYKKILKKMGLR"
FT   gene            651506..652861
FT                   /gene="rumA"
FT                   /locus_tag="SAK_0718"
FT   CDS_pept        651506..652861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="SAK_0718"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46089"
FT                   /protein_id="ABA46089.1"
FT                   /translation="MLHKNDIIETEISDISHEGMGIAKVDGFVFFVENALPGEIIKMRV
FT                   LKLRKRIGYGKVEEYLTTSPHRNEGLDYTYLRTGIADLGHLTYEQQLLFKQKQVADNLY
FT                   KIAHISDVLVEPTLGMTIPLAYRNKAQVPVRRVDGQLETGFFRKNSHTLVSIEDYLIQE
FT                   KEIDALINFTRDLLRKFDVKPYDEEQQSGLIRNLVVRRGHYTGQLMLVLVTTRPKIFRI
FT                   DQMIEKLVSAFPSVVSIMQNINDRNSNVIFGKEFRTLYGSDTIEDQMLGNTYAISAQSF
FT                   YQVNTEMAEKLYQKAIDFSDLNSEDIVIDAYSGIGTIGLSVAKQVKHVYGVEVVEKAVS
FT                   DAKENATRNGITNSTYVADSAENAMAKWLKEGIKPTVIMVDPPRKGLTESFVYSAAQTK
FT                   ADKITYISCNSATMARDIKLFEELGYHLVKIQPVDLFPMTHHVECVALLVKA"
FT   gene            653383..653901
FT                   /locus_tag="SAK_0719"
FT   CDS_pept        653383..653901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0719"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL94822.1; match to
FT                   protein family HMM PF08020"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45122"
FT                   /protein_id="ABA45122.1"
FT                   /translation="MRTYYNKEELKAEIEKTFEKYISEFDNIPENLKDKRVDEVDRTPA
FT                   ENLSYQVGWTSLVLKWEEDERKGLQVKTPSDEFKWNQLGELYQWFTDTYAHLSLQELKA
FT                   KLNENINSIYAMIDSLSEEELFKPHMRKWADGATKTATWEVYKFIHVNTVAPFGTFRNK
FT                   IRKWKKIVL"
FT   gene            complement(654026..654124)
FT                   /locus_tag="SAK_0720"
FT   CDS_pept        complement(654026..654124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0720"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46254"
FT                   /protein_id="ABA46254.1"
FT                   /translation="MELAQSIIDTYQPESVEDMQNALKHIVFICKQ"
FT   gene            complement(654203..654733)
FT                   /locus_tag="SAK_0721"
FT   CDS_pept        complement(654203..654733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0721"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44442"
FT                   /protein_id="ABA44442.1"
FT                   /translation="MESSDNTNLKFLKAFSELLETKSFEQITVSDLAKKAQLSRRAFYN
FT                   HFNSKEDFLRESILIIFDDITKILNNDLLYEEVVLKEMLNYMYTNKEIIKSFVCFFPNI
FT                   DNIIKDYIKGMIIHSDIPDLEKQLETAYQIPYSFALDIYISTIESIILNWIDNNFTESP
FT                   EKIAKYITSVVRI"
FT   gene            654904..660228
FT                   /locus_tag="SAK_0722"
FT   CDS_pept        654904..660228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0722"
FT                   /product="collagen-like surface protein, putative"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF01391; match to protein
FT                   family HMM PF04650; match to protein family HMM PF07501;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45585"
FT                   /protein_id="ABA45585.1"
FT                   /translation="MLRKYKQRNYDVAHTKQRFSIKRFKFGAASVLVGLTFLGMSSHSV
FT                   LADESSIMSTEVPQTAGVKPEVTVTQPTSDVTSLATDTSTSAVLSTDASHSNPTGSAEH
FT                   AVGMNAEDVAVPETQDKEANKTLQVASSSTSELTAENQDSEIAVSSNEHVEVVKDGQTA
FT                   TQSVSRSHMSNIKDVNIENMTFADLKKLANIDNLSAVDFKKHPQLKAIFEQVVQNSPEV
FT                   SNWPKVGGFSARDYILTNGIDSYREQLGHIRRQTVLAQSINDKIVRRKEDSIAPIDASK
FT                   DKTTVRGTGYGFGGTPLHYTIETERKGNKIDVTVTYEVDGQSNETFRNDFFFYAGDGFD
FT                   TQKPINVSVTTEGLKNGADSKNTTLGKGYSSQANGAFGLRTTIDFTPYSHNTNKGKQIY
FT                   KFSLPIKDVNGDLSLRMMVTAYNAQTGGNQTNDPYSNDNYYYGNAPFDADFNPNYRGGT
FT                   TRVTEEIPPSTLYIPTTTLKEGETEVVSEGTPGTKTTVHRTHQFGNQTFLGLPIGKPEI
FT                   KEPSPRIVKVGISQENMSQFPRGPKGDRGETGPAGKDGEAGAQGPVGPAGPKGDRGETG
FT                   PAGKDGEAGTQGPVGPAGPKGDRGETGPAGKDGEAGAQGPVGPAGPKGEAGPAGERGET
FT                   GAQGPMGPAGPKGEAGPAGERGETGAQGPMGPAGPKGEAGPAGERGETGAQGPMGPAGP
FT                   KGEAGPAGKDGVSPTITTKPGADGNSTDVTITIPGKEDTIINIKNGRDGLDGKTPKVDS
FT                   LRLEEQGITVVTFYIDTNNDGKYTPGVDDIIQSELIKDGKDGKDGKDGKDGKTPTVEQT
FT                   PIKDASGKTIGTTIIVKDGDGKEVSRSNVLNGKDGVSPKVTVTPGKDKDGQPGHTITIQ
FT                   KPDGSTEDVFIKDGKDGKDGKDGKTPTVEQTPIKDASGKTIGTTIIVKDGDGKEVSRSN
FT                   VLNGKDGVSPKVTVTPGKDKDGQPGHTITIQKPDGSTEDVFIKDGKDGKDGKDGKTPTV
FT                   EQTPIKDASGKTIGTTIIVKDGDGKEVSRSNVLNGKDGVSPKVTVTPGKDKDGQPGHTI
FT                   TIQKPDGSTEDVFIKDGKDGKDGKDGKTPTVEQTPIKDASGKTIGTTIIVKDGDGKEVS
FT                   RSNVLNGKDGVSPKVTVTPGKDKDGQPGHTITIQKPDGSTEDVFIKDGKDGKDGKDGKT
FT                   PTVEQTPIKDASGKTIGTTIIVKDGDGKEVSRSNVLNGKDGVSPKVTVTPGKDKDGQPG
FT                   HTITIQKPDGSTEDVFIKDGKDGKDGKDGKTPTVEQTPIKDASGKTIGTTIIVKDGDGK
FT                   EVSRSNVLNGKDGVSPKVTVTPGKDKDGQPGHTITIQKPDGSTEDVFIKDGKDGKDGKD
FT                   GKTPTVEQTPIKDASGKTIGTTIIVKDGDGKEVSRSNVLNGKDGVSPKVTVTPGKDKDG
FT                   QPGHTITIQKPDGSTEDVFIKDGKDGKDGKDGKTPTVEQTPIKDASGKTIGTTIIVKDG
FT                   DGKEVSRSNVLNGKDGVSPKVTVTPGKDKDGQPGHTITIQKPDGSTEDVFIKDGKDGKD
FT                   GKDGKDGKTPTVEQTPIKDASGKTIGTTIIVKDGDGKEVSRSNVLNGKDGVSPKVTVTP
FT                   GKDKDGQPGHTITIQKPDGSTEDVFIKDGKDGKDGKDGKDGDCACKPEVPGKPEVPGKP
FT                   EVPGKPEVPGKPEVPGKPEVPGKPEVPGKPEVPGKPEVPGKPEVPGKPEVPGKSEVPGK
FT                   PEVPGKPEVPGKPEVPGKPEVSGESTLIPLKVNYTSGERLENQELPSTGESNNPLILLG
FT                   ALGLLTGAYMMNSKKKED"
FT   gene            661088..662956
FT                   /locus_tag="SAK_0723"
FT   CDS_pept        661088..662956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0723"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS39307.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44393"
FT                   /protein_id="ABA44393.1"
FT                   /translation="MFDKYIFDTYYEQIVKTVKGFIFNNKDNTDLSTYMVPEPNGFIEF
FT                   DNFELYKINYEIINNGELNLEIIVIANVIVRQYIKGEMEVDTKTKFVSVYAEVELDADI
FT                   KNFRIYNTEFKSDQYKKSRNLKLSKDWVPYIRKKDFDDIAEKFLRKYYPQALTQPTPVP
FT                   VETIVSEMGLSIHQEKLTIDNSVFGKMVFKDTDVEVIEDEQLVSKHFNKGSILVDKDVV
FT                   FKRNVGSYNNTVIHECVHWELHKVFHEVKMVLDKDHSQVSSWTEENLADSSMWTSLDWM
FT                   EWQANGIAPRILMPKVQTRIKIRELFQTLTLVNPDISRSELVQEVVDNLATFFEVSRQA
FT                   AKIRMIDLGFKEANGVYNYLDDRYMHNFAFELEAFDKGSSYTITSNDLCFEYCFNESFR
FT                   QIIDRNKFIYVDNHLCLKDKKFIYMTKDGPIMTDYAYEHMDECCLIFKVKSKNFTSISN
FT                   ETYYDYVLNRGVTKESEIKADFVDILQNPSLMDQLPPLDMMKLGKKISELLKELPFEFS
FT                   GTLRSHRKRKNCTQPFLAKLVGITERTLRDYETLEDNLPRLELTLSFCFALKLRPELSD
FT                   DMIKKAGHQLTISPPHQVYKMLLSTSYYKPLGEINSILQAAEMKTL"
FT   gene            663365..663934
FT                   /locus_tag="SAK_0724"
FT   CDS_pept        663365..663934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0724"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83200.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45545"
FT                   /protein_id="ABA45545.1"
FT                   /translation="MPINVNFFNYCQTQSSSTGVEPSKGEVLAPMFVQDYYMSSEYSGL
FT                   IRGTFRQCRIMSIPILTAFVPVAEEEYEQMVWWYNNSVNDYLKDFRKPKKNTLEVSSWE
FT                   VFTEKQDLAIADEGIELYLVMDQLDFLKAKLAATNFQAPEILDMLFEGYENKEIFEYLG
FT                   VKKSAGYKKVNNAQKEGLKLYKELNK"
FT   gene            complement(663973..665928)
FT                   /locus_tag="SAK_0725"
FT   CDS_pept        complement(663973..665928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0725"
FT                   /product="prophage LambdaSa04, DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44564"
FT                   /protein_id="ABA44564.1"
FT                   /translation="MLIKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGP
FT                   VTVYDLTKENLPDQILQALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNS
FT                   WRCSMVWSAYLGLPLSLEGVGTVLKLKEQKLKEGGDVIRYFCLPCKPTKINGGRKRNFP
FT                   HHAPDKWAAFINYNKRDVEVELAIKNKLRNHPVPDFLWEEYHQDQNINDRGIGIDVDFV
FT                   KAAITIDEESKSKIQEELKELTGLENPNSVLQMIGWLREHGVTTNSLDKKAVKELLKVV
FT                   DAKTTKVLKLRQQAAKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQN
FT                   LPQNHLPDLKEARDLFKTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIE
FT                   ARVLSHLAGEKWRSMVFEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYG
FT                   GAVGALKAMGAIDMGLDEQELQPLVDSWRQANPNIVLFWWDVDKAVKTAIKYQKQTETH
FT                   GIQFKVRKGMLFITLPSGRKLAYVKPKMGENQFGGESVTYEGTGTAKRWERLESYGPKF
FT                   VENIIQAISRDILAYSMKQLKDFRIVGHVHDEIIIECDQSQNLEQIATLMGKAPYWMPD
FT                   INLRADGYECLFYQKD"
FT   gene            complement(665978..666142)
FT                   /locus_tag="SAK_0726"
FT   CDS_pept        complement(665978..666142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0726"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83202.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45410"
FT                   /protein_id="ABA45410.1"
FT                   /translation="MFETIFFYSLIGIYLFFGLYLNYMTIRDDIRREKERKAEKKHHSN
FT                   NTTPLHRSR"
FT   gene            complement(666159..666722)
FT                   /locus_tag="SAK_0727"
FT   CDS_pept        complement(666159..666722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0727"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83203.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45348"
FT                   /protein_id="ABA45348.1"
FT                   /translation="MTTKVQTTKVITGKNTRFSYLNANEPKSINGSTPKYSVSLIIPKD
FT                   DIETVDKIKAAIELAYKEGESKLKGNGKSVPALSILKTPLRDGDLERPDDEAYRNAYFV
FT                   NANSPHKPGVVDANRQEIIDTSELYSGIYGRASISFYAFNSNGNKGIACGLNNLQKLRD
FT                   GEPLGGRTRAEDDFATDDDDDFLN"
FT   gene            complement(666727..667848)
FT                   /locus_tag="SAK_0728"
FT   CDS_pept        complement(666727..667848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0728"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83204.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46201"
FT                   /protein_id="ABA46201.1"
FT                   /translation="MTNHAVLSASASHRWLNCPPSVRLTEDMPDVTSEFALEGTDAHEL
FT                   CAYLVEKALGRKARDPTEDLSFYNEEMQNCAEEYRNYVMEQVEKAKDYSHDPTVLIEQR
FT                   LDFSKWVPEGFGTGDCLIVADGLLQVIDYKHGLGILVDADHNPQMMCYALGALEMFDGI
FT                   YDFDNVTMTIFQPRKNNISTFEMDKAELLEWAEDQLSPKAELAFKGEGELKSGKHCQFC
FT                   KIKNVCRKRAEENLALAKMEFADPATLDYEDIAEILTKLDLLVSWANDVKAYALKEATE
FT                   GHSIPGYKLVEGRSVRKFSDEAAVSQAVMDAGFDPYEKKLLTITAMTKLLGKKTFNDLL
FT                   GGLIVKQSGKPTLVPLDDSRQELNLATNEFKED"
FT   gene            complement(667841..668164)
FT                   /locus_tag="SAK_0729"
FT   CDS_pept        complement(667841..668164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0729"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83205.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45510"
FT                   /protein_id="ABA45510.1"
FT                   /translation="MSKMKQLNELINEMEGTAKYYLRLVDEFKKILSTEEETTTTSKEP
FT                   KHKPQKELKLEDVRSVLATKAKDGYKNEVRALLNKYGAESLSALATEHYAAVLEEAGGI
FT                   GHD"
FT   gene            668561..670846
FT                   /locus_tag="SAK_0730"
FT   CDS_pept        668561..670846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0730"
FT                   /product="prophage LambdaSa04, DNA primase, P4 family"
FT                   /note="identified by match to protein family HMM PF03288;
FT                   match to protein family HMM TIGR01613"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44457"
FT                   /protein_id="ABA44457.1"
FT                   /translation="MQFTLSHSGQSGVQTTTVYPHQVTITDETSLKRIAQYDHVAGLFS
FT                   NNTRSNANFLKSDVLVMDIDNDHTENHDDWITEEYLKILFSDYHFALVTSRNHMVQKGS
FT                   KVARPKFHIYFQINEVTDKDTYAFLKEELTNQYNFFDTNAKDAARFFFGNPNAQVFWND
FT                   SWLTIDADLLDSSFDSDEEDFDADFYTPPTGPITEGSRNSTMSQFAAKILKRLGITQEA
FT                   RDGFDEQALKCDPPLDKTELDTIWGSAVRFYNRTIKGSEGYVSPEAFNRGELKPDDYSD
FT                   IGEAGVLAREYGEKLAYTNATDYLTFTGQYWKEDKQLAIGAVLEFMDLQLEDASDKYEK
FT                   VIKDLVNTGVSENLVREGGKALAKVIETPTQQKLYTTYLAARTYYQFVMKRRDYRYITA
FT                   THNTAKPMLAIDLSELDKDDMVLNTPEATYDLRIGLSGSHEHDPKDYITKMTTVSPGDQ
FT                   GMGLWQETLATFFCNDQELIDYVQEIIGMAAIGKVYQEHMIIAYGGGANGKSTFWNTIA
FT                   RVLGSYSGKLSADALTMSNKRNVSPELAELKGKRLVIASEMAEGMRLNTAVVKQITSTD
FT                   EIQAEKKYKDPFHFVPSHTLVLYTNHLPKVGANDDGTWRRLVVIPFNAKITGRSDIKNF
FT                   ADYLYDHAAPAIMSWIIEGAEKAIKANFKTKVPAAVANSVKVYREANDWLGHFLSECCE
FT                   VGDKLSEKSGELYSRYRAYCVQNMEYTRNTTDFYAALAQAGFERKRTNKGNFIMGLKLA
FT                   DDGDDFLD"
FT   gene            670867..670971
FT                   /locus_tag="SAK_0731"
FT   CDS_pept        670867..670971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0731"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45931"
FT                   /protein_id="ABA45931.1"
FT                   /translation="MSSTPSESGDFRSDSRGNQKEKIYQEMNTKKFMD"
FT   gene            671130..671411
FT                   /locus_tag="SAK_0732"
FT   CDS_pept        671130..671411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS39321.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44680"
FT                   /protein_id="ABA44680.1"
FT                   /translation="MREKVVERKLVSEVRNRGGICPKWVSPSFAGVPDRLVFLPSGKFG
FT                   LVEVKAPGEKPRLLQVSRHRLFERLGFKVHVLDRVDKIGEVLDEIETT"
FT   gene            671392..672768
FT                   /locus_tag="SAK_0733"
FT   CDS_pept        671392..672768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0733"
FT                   /product="prophage LambdaSa04, helicase, SNF2 family"
FT                   /note="identified by match to protein family HMM PF00176"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46128"
FT                   /protein_id="ABA46128.1"
FT                   /translation="MKLKLHDYQEVTKDFIIRTPYAAVILDMGMGKTATTLSAINELMF
FT                   DRYEVYKVLVIAPLRVATTVWSDEIDQWEELNHLRYSKIVGTPKQRQAALEKDADIYIV
FT                   NRENLPWLVEQCSPYFKWDMVVIDELSSFKSWQSKRFKAFMAMRPYMKRVVGLTGTPSS
FT                   NGLMDLFAEFKVIDGGERLGRFIGEYRGRYFREGRRNGNVVYEYLPMDYAECQIYDKID
FT                   DITISMKAMDYLDMPELISTKKVVRLTDKEKASYSQFKKDYIMADLEDTEVTAANAASL
FT                   SNKLVQMANGAVYSDDQQVVSLHDQKLDALEDIIEAANGEPVLVAYWFKHDLKRIEERL
FT                   AKLKVKGTVLKTEEDIREWNKGNVSVGLLHPASSGHGLNLQKGGHHLVWFGLTWSLELY
FT                   QQTNARLWRQGQQAETVVIQHIVTECTIDEEILKVLENKDAQQARLLEAVKAQVGGTDG
FT                   "
FT   gene            672761..673258
FT                   /locus_tag="SAK_0734"
FT   CDS_pept        672761..673258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0734"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83210.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45221"
FT                   /protein_id="ABA45221.1"
FT                   /translation="MDKAEYILTHYNELKWELEMLKYRLNNFKPVTENEVISSLVFERS
FT                   DEPKVTSTPTNQRSEMIALSFREKMVQENEELLSDLSQRYIRLASDLETFDMAIRFLKG
FT                   DLSEFAVELLKPDCNWDYLMREFHISRGTVHNWRRKLLEHIRQIFVKLGRSLTIELYMN
FT                   SP"
FT   gene            673376..673477
FT                   /pseudo
FT                   /locus_tag="SAK_0735"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAR83212.1"
FT   gene            673651..674688
FT                   /gene="metK"
FT                   /locus_tag="SAK_0736"
FT   CDS_pept        673651..674688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SAK_0736"
FT                   /product="prophage LambdaSa04, S-adenosylmethionine
FT                   synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45393"
FT                   /protein_id="ABA45393.1"
FT                   /translation="MIYTSEQVSSGHPDKLCDQISDAIVTECLKYDKNSRVAVETLIKD
FT                   NQVVVAGEVSTRHFFNLEGIVKKVLELYGMEDIMVTNLLGVQSPDIAQGVDSGGAGDQG
FT                   IMFGYATDETPEFLPLPYVLATRVLEKLTNLGHPALGKDAKAQVTYDYENKRIETFLVS
FT                   IQHDEEVDLASVKRIVTQAMMSVAQRYRQNLDFKVLVNPTGRFVLGGSYADAGVTGRKI
FT                   VADTYGGFAHHGGGAFSGKDPSKVDRSAAYMARKIAKDFVREGYAKRCEVQLAYAIGVA
FT                   EPVGVYVSTFGTSDYPAEQLEGVVRERYDLTPQGLIKELNLLDVDYTKTTCLGHFTKSY
FT                   LPWEQ"
FT   gene            674690..675055
FT                   /locus_tag="SAK_0737"
FT   CDS_pept        674690..675055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0737"
FT                   /product="prophage LambdaSa04, HNH endonuclease family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45403"
FT                   /protein_id="ABA45403.1"
FT                   /translation="MPRRPSTPCKQSGCPNLVSYGNKYCEIHKANHSLDAKSTKAKGYN
FT                   ARWNKERLRYLKLNPLCVYCQREGRLTKATVVDHITPHRGDQDLFWNQSNWQALCKTCH
FT                   DRKTKTTDRYVEYTYRF"
FT   gene            675788..677026
FT                   /locus_tag="SAK_0738"
FT   CDS_pept        675788..677026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0738"
FT                   /product="prophage LambdaSa04, DNA methylase"
FT                   /note="identified by match to protein family HMM PF01555;
FT                   match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44546"
FT                   /protein_id="ABA44546.1"
FT                   /translation="MEIKELPLSDLKPASYNPRKKLKKGDKEYEKIKQSLLKFGYVDPI
FT                   IVNDDLTVIGGHQRLTVLKDLKYETAKCVIVSLSKEDEKALNIALNKITGQWDDQPLAD
FT                   LLLDLQESDFNLDLTGFEPPEIDDILSNIHDKDLSEDDFDVDEELKKPTVARRGDIWQL
FT                   GKHRVICGDSTEAETYEQLLGDKKANLIVTDPPYNVDVEETAGKILNDNMSDRDFYQFL
FT                   FDMFTQVESHMEADASIYVFHADTEGLNFRKAFKDAGFYLSGSCIWKKNSLVLGRSPYQ
FT                   WQHEPCLFGWKQKGKHQWFSDRKQTTIWEYDRPKSSKDHPTMKPIQLMAYPIQNSSMRG
FT                   TLVFDPFLGSGSTLMAADQTGRVCYGIELDEKFVDVIVKRYMESTSNRDVSVLRNGETL
FT                   SYDQALEVMEEHS"
FT   gene            677023..678276
FT                   /locus_tag="SAK_0739"
FT   CDS_pept        677023..678276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0739"
FT                   /product="prophage LambdaSa04, methyltransferase, C-5
FT                   cytosine-specific family"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46233"
FT                   /protein_id="ABA46233.1"
FT                   /translation="MTLTFLDFFAGVGGFRRGLELAGMTCLGYCEKDKFARKSYEAMYD
FT                   TEGEWFHDDITSIDPTRLPKADLWTAGSPCQNLSIAGKRAGLYGERSGLFFTFVDLLQS
FT                   QKEEDKPEWVLLENVKGLLSSGGGRDYLDYLSILDQAGYDLEWQVFNSKDYGVPQNRER
FT                   IYTLGHLRSRGRRQVLPLSGESGSHLKQLIGGMQSYRVYDPSGIATTLVGEGGGLGAKT
FT                   GLYLIDQSLTEPKLTDEARCITARYTAGATKRTAMNSGVLEVQPILTPDRVIKRQNGRR
FT                   LKEQDEPMFTLTSQDRHGVLEGIKVRNGTKQGYQVAELGDSVDLSYPGSQTRRARVGKG
FT                   IAHNLSCGGRMGAVVWNGRVVKIRRLTPRECFRLQGFSDDLFDKAQAVNSDAQLYKQAG
FT                   NGVTVTVVYTIGKAILSA"
FT   gene            678619..679068
FT                   /locus_tag="SAK_0740"
FT   CDS_pept        678619..679068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0740"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAS39331.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44879"
FT                   /protein_id="ABA44879.1"
FT                   /translation="MDDKTLERLRKTYPTGTRVRLVHMDDPYSVPIGMLGTVEDVDDIG
FT                   SLIVSWDNGQSLNVLHGIDRVVIVEPNRHDFIRSIYCYLRAGHNEFVFDSGDIPVQLTH
FT                   EEVITLMTSTHPQTEIDIYIDECNHFNLKPTTVLTKEEIEKAIQE"
FT   gene            679165..679578
FT                   /locus_tag="SAK_0741"
FT   CDS_pept        679165..679578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0741"
FT                   /product="prophage LambdaSa04, terminase, small subunit,
FT                   P27 family"
FT                   /note="identified by match to protein family HMM PF05119;
FT                   match to protein family HMM TIGR01558"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46018"
FT                   /protein_id="ABA46018.1"
FT                   /translation="MKETLGNDLYLLKQKAPRCPQWLEDDAKKEWKRMGKILEQIGILT
FT                   EMDMTAFAGYCQAYARWKEAEEFLSKHGSIIKTPNGYLQQVPQVSISQTNLKIMLKFCE
FT                   QFGLTPSARNRLATMDAEVGTGDEMEDLLGGVL"
FT   gene            679575..681167
FT                   /locus_tag="SAK_0742"
FT   CDS_pept        679575..681167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0742"
FT                   /product="prophage LambdaSa04, terminase, large subunit"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45667"
FT                   /protein_id="ABA45667.1"
FT                   /translation="MTYHYEPSPFMLPTSRYDKAKADRAVTFINNLSHTKGKWAGKKFD
FT                   LLPWQEQIVRDLFGIVKEDGNRQFLTAYIEIPKKNGKSELAAAIALYLLYADNEASAEV
FT                   YGAACDRNQASIVFDVAKQMVLMSRPLEKRSKIMGATKRIVNYSNAGFYQVLSAETGTK
FT                   HGLNVSGLVFDEIHAQPNRHLYDVLTKGSGDAREQPLFFIITTAGTDKNSICYELHTKA
FT                   LDILKGRKKDTSFYPVVYGLSDADDWNDEANWLKANPSLGHTIGIDRVREAYQQALDNP
FT                   AEENVFKQLRLNMWTSSSVAWIPEHVYAKGNSPIDYEALKGRDCYAGLDLSSTSDITAF
FT                   VLVFPPRHSEENYIILPFFWLPEDTLELRCRRDHVLYDVWERQGYIKTTEGNVVHYGFI
FT                   EAFIEQLSETYHIKEIAYDRWNATQMVQNLEGMGLTMVPFGQGYKDMSPPSKEFYKLMM
FT                   EGKIQHGGHPVLKWMGQNVVMRQDPAGNIKPDKEKSVEKIDGIVALIMGLDRCIRHQGN
FT                   GTSVYDERGLLSF"
FT   gene            681223..681525
FT                   /locus_tag="SAK_0743"
FT   CDS_pept        681223..681525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0743"
FT                   /product="prophage LambdaSa04, RelB antitoxin family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44967"
FT                   /protein_id="ABA44967.1"
FT                   /translation="MAKTGTLNLRVDDSVKSAADEILKRLGIPMSTAIDMFLNQIILTG
FT                   GIPFDVSLAEAPQRVNVDYMSQEEFYDKLITSFEDAKGGKRQDVREFLSQFKENA"
FT   gene            681525..681830
FT                   /locus_tag="SAK_0744"
FT   CDS_pept        681525..681830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0744"
FT                   /product="prophage LambdaSa04, RelE/ParE family protein"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46327"
FT                   /protein_id="ABA46327.1"
FT                   /translation="MKEYQVTISDDAKADLLSIYHYVRDELCAPQAADNLLEKISQAML
FT                   SLSIFPERCSIIEDLVGKGYTFRQLIVKKYRIIYHVLEDEVIIVAVVYGSRHMDNW"
FT   gene            681847..682119
FT                   /locus_tag="SAK_0745"
FT   CDS_pept        681847..682119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0745"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS09633.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45182"
FT                   /protein_id="ABA45182.1"
FT                   /translation="MELVKTIQIGDDIYLPIPDQFGIQEGQEFNLYQSSDGTLVLSPLD
FT                   SKLSADYQSLSSDEQETTVVEQATLDKVANSVLSRHLDAFKELAE"
FT   gene            682200..683489
FT                   /locus_tag="SAK_0746"
FT   CDS_pept        682200..683489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0746"
FT                   /product="prophage LambdaSa04, portal protein, HK97 family"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01537"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45413"
FT                   /protein_id="ABA45413.1"
FT                   /translation="MGLLDLLGRKRARDKPQNSYEGQDFYYLFGRTTSGENVDEFKAMQ
FT                   TTAVYACVRILAEAVASLPIHVYEMTSSGKKKKIDHPLYFLLHDEPNPEMSSFIFRETI
FT                   MSHLLIWGNAYVQIIRDKAGRVISLYPLLPDKMSVHRDDSGKLYYKYQRQTEENPNFKD
FT                   KGTVLLKQEDILHVPGLGFDGLIGYSPIAMAKNVIGMTLATENYGAAFFKNGANPGGVL
FT                   EHPGILKDPKRVRDSWNAVYNGVTNAHKVAVLEEGMKYTQVGIPPEEAQFLQTRKFQIN
FT                   EIARLYRIPPHMVGDLEKSSFSNIEQQSLEFVKYTLDPWVVRLEQAFKRSLFLPEEKKR
FT                   YLIKFNVDGLLRGDYQSRMNGYAIARQNGWLSTNDIRELEDLNLLSDEEGGNLYLINGN
FT                   MTKLKDAGGFMKQPTETEPAEDPPEEEEDA"
FT   gene            683482..684180
FT                   /locus_tag="SAK_0747"
FT   CDS_pept        683482..684180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0747"
FT                   /product="prophage LambdaSa04, ClpP endopeptidase (S14)
FT                   family, non-peptidase homologue, putative"
FT                   /note="identified by match to protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44881"
FT                   /protein_id="ABA44881.1"
FT                   /translation="MRKFWNFTDEGEVRTLRIEGQIADETWFGDEVTPQLFKNDLTSET
FT                   GDITLWINSPGGDVFAAAQIYNMLMDYQGDVHVIIDGLAASAASVIAMAGTTVSMSPVA
FT                   MMMIHNPWTFAQGEAKDMAKVIEMLGEIKESIINAYELRTGLSRTKISHLMDSESWFNA
FT                   KKAVELGFADKVLFEKEETPEQDYQNSYTFSRVTAAHDLVVKLQASLQPPKPQKTIPFN
FT                   QLEKRLNLLK"
FT   gene            684194..685402
FT                   /locus_tag="SAK_0748"
FT   CDS_pept        684194..685402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0748"
FT                   /product="prophage LambdaSa04, major capsid protein, HK97
FT                   family"
FT                   /note="identified by match to protein family HMM PF05065;
FT                   match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44690"
FT                   /protein_id="ABA44690.1"
FT                   /translation="MSKLLELKEKRNAAWAQAKAFLDTVRSEDGLVSDEDSKRYEEMEA
FT                   KIELYNKEIARLERQEKIDLELAQPTSQALTTQPTVIVDNQKEDEKKGVASDIYTQTFW
FT                   TSVRKRNFYDVKDVLRVGEDTEGGHLVPDEYEKKLVQELQEENFFRSLATVIKTSSGER
FT                   KIPVVTGHGSASWMDENGLYPETDETFGQVTLDSHKIGTAIRISEELLNDSVFDLESYM
FT                   TSEFARRIGTEEEKSFLVGDGSKKPTGIFTQADVEGPTTATKDVTFDDMIELYHSLPAP
FT                   YRKNAVWILHDTTVKAIRKLKDNNGNYIWQPSTQAGQPDLILNRPYYTSTFAPLPEAGN
FT                   KAIAFGDFSYYWIADRQGRTFKRLNELYANNGQIGFLASQRVDGKLVLPEAVKTLTIKG
FT                   KTA"
FT   gene            685399..685656
FT                   /locus_tag="SAK_0749"
FT   CDS_pept        685399..685656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0749"
FT                   /product="conserved hypothetical protein TIGR01560"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45850"
FT                   /protein_id="ABA45850.1"
FT                   /translation="MMTLEEVKLYLKVENGEEDYLIEQLMATSRQICEDILRESSTSEV
FT                   LKTAILYGVAYLYEHREEANHKELKETLYHLLLADRKDVF"
FT   gene            685656..685994
FT                   /locus_tag="SAK_0750"
FT   CDS_pept        685656..685994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0750"
FT                   /product="prophage LambdaSa04, head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45995"
FT                   /protein_id="ABA45995.1"
FT                   /translation="MKIAPLREQLVFQEKRLKQDDIGNESAIWDDLFMRWCSCRPLALT
FT                   ESDGSATKLIHNKVQFTLRYDKAVLALNSLTTRIYFRDQYYAIESIDGDTVARSLIYIV
FT                   ATKEELYD"
FT   gene            685987..686355
FT                   /locus_tag="SAK_0751"
FT   CDS_pept        685987..686355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0751"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT29567.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45862"
FT                   /protein_id="ABA45862.1"
FT                   /translation="MTKIGLDDLASVIEKDLTTYAKDTTDTMREVVEEVTDDAVDTLKV
FT                   TSPKRRGKYAKGWTSKATTDTNTALTKAIHNRTPGLTHLLEDGHAKQNGGRVEGRKHIS
FT                   PVEKKAIQSFEDKLRQKL"
FT   gene            686364..686690
FT                   /locus_tag="SAK_0752"
FT   CDS_pept        686364..686690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0752"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT35269.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44630"
FT                   /protein_id="ABA44630.1"
FT                   /translation="MRFEELFPVLKKTKLPVAYHHFEEGHSPSPPFMVYLVTDSDNLGA
FT                   DNWAYHKAINVQIELYTTKKDLATEKTVESVLDAHRLYFDKVETYITNEKLYQTIYSIT
FT                   LLGG"
FT   gene            686693..687262
FT                   /locus_tag="SAK_0753"
FT   CDS_pept        686693..687262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0753"
FT                   /product="prophage LambdaSa04, major tail protein, phi13
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR01603"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45576"
FT                   /protein_id="ABA45576.1"
FT                   /translation="MAEKNKVTFGLQDVHWAEVTNEGADGALTYGKVERLRGAAELTLE
FT                   PTGDKGSYKADNINFYTTESNDGYEGTLKVALLYQEFLTRVLGEQLDATTNTISEIANS
FT                   EKKNFALMFRFEGDKKETLHVLYYCYASRPTVGSKTKSGSDINEVELTFTASPRPLDKV
FT                   VRRRTTEETSDEIRENWFKSVFEPAA"
FT   gene            687274..687693
FT                   /locus_tag="SAK_0754"
FT   CDS_pept        687274..687693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0754"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83232.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44878"
FT                   /protein_id="ABA44878.1"
FT                   /translation="MRQNITISGKTYPLATNAYTPIAYKEQFGKDYFHDLFNMLSAESI
FT                   MAQLEQLEEGEELKASQIDLSILSDFDMTFFHRLFWVFAKSANPRIKPFEDFFMSMEEF
FT                   PLQEVGPVLMSMLNQGMTTRKKQKLPKQRARKSSR"
FT   gene            687762..687857
FT                   /locus_tag="SAK_0755"
FT   CDS_pept        687762..687857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0755"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR83233.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45535"
FT                   /protein_id="ABA45535.1"
FT                   /translation="MALDYQTDYVELRSRDETGVRRATQADFDNF"
FT   gene            687988..691107
FT                   /locus_tag="SAK_0756"
FT   CDS_pept        687988..691107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0756"
FT                   /product="prophage LambdaSa04, tail tape measure protein,
FT                   TP901 family"
FT                   /note="identified by match to protein family HMM PF05017;
FT                   match to protein family HMM TIGR01760"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44395"
FT                   /protein_id="ABA44395.1"
FT                   /translation="MAGNIKGITIEIGGDTQPLQTALKGVNKQASEATKELRQIDKALK
FT                   FDTGNVTLLTQKQEVLAKQVETTKEKLATLRQAQAQVEAQFKAGNIGADQYRAFQREVE
FT                   STQTVLKGYESKLESVNRALSENGAQVETNQSKLNRLQNEQAQLVSESEKLQSSFKLQE
FT                   SALATTASEADKLALAQQKVASHSEILEKQIHNLEQQLSLTKSEYGENSVEANKLEKTL
FT                   NETKTAYNNLQNEMEELASSSASSKASLEETNSLLKADLLMEFGDQLGELSQKLIDFGQ
FT                   QSLDAFLEVDEGMDIIVTKTGATGSALEEMTDIAKTLATELPTDFNTAGSAVGELNTQF
FT                   GLTGDALKSAATQLIQFSEINGSDVTSSAISAKQAIEAYGLEATDLSSVLDTVTYTSQS
FT                   TGVGVQELMDKAVAGSPQIKALGLSFDEGITLMGQFEKAGVDSSAALSSLSKASVKYAG
FT                   DGLTLQEGLAGTIEQIKTSTSETEALSLASEIFGSKAAPRMVDAIKRGALSFEDLAGTA
FT                   DKAAGIVTQTYEGTLDPVDKFTTAQNTAKLAMAEMGDAIAATLAPILEVIASLLQAVAT
FT                   WFSGLSEPVKQFIVIVGSLVAALGLVLPIFIALQAAAMAMGTTIMGMITAAAPIVGIIL
FT                   GVIAVVALLVVGIQQLWQHHEGFRTAVTEIWNAIYAFLTVIIQQISSFVMSIWGTLITW
FT                   WTENQQLILNATNTVWTAISTVIQTIMTILAPYLQASWENIKLIITTAWDIIKVVVETA
FT                   INVVLGIIKAVMQIITGDWSGAWETIKQVVSTVWEVIKSLISIVLSAIAQFISNSWNGI
FT                   KGTMTNLLNSIKGVVSNVWNGIKSTISSILSSIGSTVSSIWNGMKATISGVLSGISSTV
FT                   SFVWNGVKSTITNAINGAKNAVSSAINAIKNLFNFKIKWPHIPLPHFSVSGSANPLDWL
FT                   KGGLPKISIQWYAKGGILTKPTAFGMTGNSLMVGGEAGREAVLPLNNQTLGSIGSSIAA
FT                   TMPNKGTTITVNITDVVIREEADMKKLADYVAGRLAAEMARQALLRGGRV"
FT   gene            691104..691829
FT                   /locus_tag="SAK_0757"
FT   CDS_pept        691104..691829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0757"
FT                   /product="prophage LambdaSa04, tail protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45940"
FT                   /protein_id="ABA45940.1"
FT                   /translation="MIKHNELVLNRKGTSSFPFKVLVEDRPSIQVPRSKTQLLDHRGLS
FT                   GAIVQTNKHREVIEKSYRLYLIGASEKEVNEFSAFLMQEGFWLESERLKLTRLWCYRTD
FT                   SFDIKQDDHDVFVIDVTFICHPTRFFKNVDRQVLTTNGVLKTQGSALAFPTITITGQSV
FT                   SETSFTVGDQVIRIEKFTEPLVMVNHPERPSFKTLSGKAVKWSGDFITIDASHPTQSVG
FT                   VILGSGILSLTFETNWGWV"
FT   gene            691829..694744
FT                   /locus_tag="SAK_0758"
FT   CDS_pept        691829..694744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0758"
FT                   /product="prophage LambdaSa04, minor structural protein"
FT                   /note="identified by match to protein family HMM TIGR01665"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45060"
FT                   /protein_id="ABA45060.1"
FT                   /translation="MLYLLDGQTKTPKWNGQPLFETVSASVEEVLNGTFQLRLTYPITD
FT                   SGVHETLRADELILCPTPDLGKQLFRIKQVKIQDDTVELECYHISDDVMKRQVKPFSAI
FT                   NTTCQSALMRMVEACPSDLGLFSFDSDVTERHTYVSDEDLTLYQALMDGKHSLLGMWEG
FT                   EFVRDNFQLMVKKHRGNDKGVILTSHHNLKAFEDKGDSDKVITRIYATSTFQAEGSDED
FT                   TVLSVVVESPLINQYPYIHEARYENNTLQTEEELRQWAMAKFTHEHIDNISRQITVEAY
FT                   QLDGQEVHLGDTVTLKSQKHKVDVKKKAVGYTFDALEEVYLSVTFDDEVTFTNSGSSGV
FT                   NSLTSAAKTILDVNQSVTEHRASKERANFNKVFDRQFERLQTEVEDGIAIAKAEGERSG
FT                   KKAALDYLATNGLEARVAAFQKATIDELTVSSSAWMTRLVSQQILSEYVKSLEVEADKV
FT                   VIPGQHTPVFSLDRDGNLSIDTPLLKVRGESLATQADLKTISLTPGPKGDAGADGVGIQ
FT                   SREQYYLVSAQKTGLTATSASWTKTIPTLTSTLKYLWNYEKTTFTNGSTTVTTPVIIGV
FT                   YGDKGVDGKAGKDGKTLYTWRMYADNDKGDGISAVSTGKRYLGLAVNKESATPSTNPSD
FT                   YTWSSFFEGTELGGRNYIDDYAMKAATFSSITSEWKKEVVEDTSSVSGVTVKMTCTKAG
FT                   TGGFHRNFYDLRSRIGANMTFSIDLKASKTVSLTIGNELGGTKVVQVSSSWQRYSVSWK
FT                   VTSAQNHSYVFYLKSGTWAVGDVVYLRNVQLEDGNVASAPGPSLNDLIAQIDAKADNGF
FT                   MKQQLDLLTEKTESLRVDLEARALAKEVADWLKSYKEFEKNNEAVLAQFNQDFIDNTAR
FT                   IAAIEADLKANSLLLNFVNTYLRAGDNGVIIGKKDNSEYIELTPQGMMIKSAGNAVMTV
FT                   TVGVIKIHHGVFVETLQVGYYRLEAARHNAKHLVCRFIDAK"
FT   gene            694757..696613
FT                   /locus_tag="SAK_0759"
FT   CDS_pept        694757..696613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0759"
FT                   /product="prophage LambdaSa04, minor structural protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF05895"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45974"
FT                   /protein_id="ABA45974.1"
FT                   /translation="MADYGSNNDRGYTLLLRVEETGTSTADNTSTVRVQLWLKNGYTTF
FT                   GMYDCRASVSINGQTLSWSGRPDMYTAHSSLHLIDKTITVPHDSNGSKTISFSATFSGS
FT                   GGWSPGTLNTGSQTLRLSDIPRSSSATVSGNLMGQDVTITIKRASSDFTHNMTWHFGSL
FT                   SGTIGTGIATSATWTPSISQLATQIPNSTSGNGHLTLATIYGGKTIGSMTIPITLNLPT
FT                   SVVPTLGSISVSESHATAKTILTGTSFAQLVSNPKVTFNQGAGIYGSTIPSTGFRAEVF
FT                   KFENNQWVQLQNVTSSNNGLLGGINWIGRAKVSAYVTDSRGRQSARKEVEITLLEYFKP
FT                   IFSFSAVRAGSSMNQVTVTRKLKIAPLTINSVQKNKAALTWEVVDLASGQKVTNAGGAA
FT                   NWTSTTEHTKTDFQAILGGTYDTTKSYTIIGRLEDLFYATIFEFTIGPEKVVYGLSPSG
FT                   MGIGKAWTRGVLDVDGSLPAYFDGDIYMKNKKLLDIFYPVGVIYESTSSSNPSTFMGGT
FT                   WERFGNGRVLVGVSENESEFNSVNQSGGSKTHTLTIDEMPSHSHAQYVTANNGSGAVRR
FT                   DYSSDGSSTIYPQGNNTGNTGGGKPHNNLQPYVTVYRWRRAA"
FT   gene            696631..697029
FT                   /locus_tag="SAK_0760"
FT   CDS_pept        696631..697029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0760"
FT                   /product="prophage LambdaSa04, holin"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45741"
FT                   /protein_id="ABA45741.1"
FT                   /translation="MKELLATNKVLFSAIGGLIGSIFGEVDGFLFALMVFISIDYITGL
FT                   MAAAVEKKLASNIGFKGIFKKIVLLFLVAVGQIIDEHVLKQGGMVRTAIIFYYLSNEGL
FT                   SIIENAARIGLPVPEKLKDVLKQLKQGD"
FT   gene            697031..698041
FT                   /locus_tag="SAK_0761"
FT   CDS_pept        697031..698041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0761"
FT                   /product="prophage LambdaSa04, mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase family protein"
FT                   /note="identified by match to protein family HMM PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45507"
FT                   /protein_id="ABA45507.1"
FT                   /translation="MTFLSKIKDGCLASWEHGILPSVSAAQAILESGWGESLLAQYPNH
FT                   NLFGIKASSDWKGKRVDLPTQEYIDGKFVTVEATFRKYDSWEESIKDHALFFSETAWRR
FT                   SHYQNVLGEEDYKKTCLALQASGYATDPNYGSKLITLIEAHHLNTWDDRILNKKGETTM
FT                   SKHLVICGHGQGQTGYDPGATNPSLGITEAGKVREFANLMKKYSGNRIDYITDHNVYDY
FT                   RSIGSLGNGYESITELHFNAFNGQARGSEILIYSGYTADSLDQKLLAILAKRFTNRGFK
FT                   QVNWPTMPMSQQVEDTIIDWWRLPSSIIIVMWASMKPIKTVWLVNLYKPSLGKLK"
FT   gene            697996..698436
FT                   /locus_tag="SAK_0762"
FT   CDS_pept        697996..698436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0762"
FT                   /product="prophage LambdaSa04, LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45361"
FT                   /protein_id="ABA45361.1"
FT                   /translation="MAREFVQAITGQAQVISPSPNTPQSRVTSYHVGDPVTVQQHATHY
FT                   QTGQAISSWVKGKTFKVIRVKDVNQSNSKKAYLLEGINSWVLEQDVKGTTNGHSEQTYT
FT                   VQKGDTLYGIARKFKTSVSELVRLNSIINPSLISVGQKLKLK"
FT   gene            699217..700458
FT                   /locus_tag="SAK_0763"
FT   CDS_pept        699217..700458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0763"
FT                   /product="prophage LambdaSa04, site-specific recombinase,
FT                   resolvase family"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46237"
FT                   /protein_id="ABA46237.1"
FT                   /translation="MAVRLIKTKSNRKKQRVCAYTRVSTTNSSQLDSLENQKAYFETFY
FT                   VNREDVDFLGVYYDKGISGSKEKRPSFQAMLEACRQGQIDLIHTKSISRFARNTMTVLE
FT                   VSRELKALGVGIYFEEQNINTLSNEGEGMLSVLASLAEEELQSMSDNQRWAFQRKFQRG
FT                   EMVINTKRFMGYDVDDKGELVINEAEAQIVRRIFQLYLDGMGMHRIAKLLNQENVPTVT
FT                   DAKWHDTTVRNILKNEKYKGTVLLQKYFHVGINGPKRLNQGQVEQYLIEDNHEPIVSKE
FT                   VWQAVQDKLASKTWKQGVNKHYRFTSMLKCEYCGSTLKRQVTYKKQIVWCCSKYIKEGK
FT                   ASCRGMRVPEKAIEEWKLRTPVTVIERNEYGQKHYSYSSQESAADGHPSASNQNKSGSL
FT                   LSGVHRPRRTAIKL"
FT   gene            700361..701707
FT                   /locus_tag="SAK_0764"
FT   CDS_pept        700361..701707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0764"
FT                   /product="prophage LambdaSa04, site-specific recombinase,
FT                   resolvase family"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45179"
FT                   /protein_id="ABA45179.1"
FT                   /translation="MQLTVTHQQATKIRVAAYCRVSTDQDEQLSSYENQVSYYRDYILK
FT                   HEDYELVDIYADEGISATNTKKREAFNRLIQDCRAGKVDRILVKSISRFARNTLDCIKY
FT                   VRELKELGIGVTFEKENIDSLDSKGEVLLTILSSLAQDESRSISENATWGIRKKFERGE
FT                   VRVNTTKFMGYDKDENGKLVINPEQAEVVKHIYHQFLKGYSPESIAKELNTNGIKGWSG
FT                   KANWYPSSILKMLQNEKYKGDALLQKTYTVDFLTKKRTENDGQVNQYYVTNNHEAIIDT
FT                   EMWDTVQEELARRKDFREKHKLKTYIMQSDDNPFTTKVFCAECGSAFGRKNWTTSRGKR
FT                   KVWQCNNRYKVKGQIGCQNNHIDEEMLEKAFMKAVELLQEHRADVVVKWQKLEKGTNLL
FT                   HKHYAKQMYQLLDLEKFDGTIMNKVLDHISISEVGQIIVIFLEGTEVEL"
FT   gene            701777..702550
FT                   /locus_tag="SAK_0765"
FT   CDS_pept        701777..702550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0765"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44818"
FT                   /protein_id="ABA44818.1"
FT                   /translation="MGENLNSNIDPRIIFKQLPPATIIKGFVAGETKCNYEIYLLELLN
FT                   KSVYFREKGKSKFHAPEDESHGECDAVADDYKIDFKLLSSSSRLQASSLFSPSITNLGN
FT                   GITAIGESRNPNGEIKATQIHVAFRFRTVSDLIRLKVKRQHVRKQCLEKDIIKVLNMLE
FT                   KQKNLLLFFPYIFYTEEEISTNELDDIILNAISYDFSSLFAYRHIKVQSFETYLLTIVR
FT                   DEFNIFKISNKRLKLIEKLSCSELPTFVKLKSYSI"
FT   gene            702564..704069
FT                   /locus_tag="SAK_0766"
FT   CDS_pept        702564..704069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0766"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /note="identified by similarity to PDB:1O6Y; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45709"
FT                   /protein_id="ABA45709.1"
FT                   /translation="MVNPEFYEKIAKIFCGDDLELFKYKSGPDLVHFFNNNFKISDSYG
FT                   QGFPTRWRYVNQKLLDFSSVGKIDEYFNIILSKQYLLTERQISEIDALVHQQRILDELN
FT                   KVCSVYSLKLSQKDGAFHLVEIDLDLIEIGSGGFANIYFQKSTGLVLKKLNEESARSAS
FT                   IRSRFKREYEITKSCSDIGSIIKVYDFDIGNCSYTMEKADNILDDFVKESFLTEDSQIN
FT                   IIRQILYSMSLVHQRGVLHRDLSPTNIFFINGIIKLADFGLGKNLNTLTSHQTMDTASF
FT                   GQLFYCAPEQLTLLKDADKRSDVYSLGRIINFVMTKNPNDFSHSLRSISEKATNLNPEY
FT                   RYEDATNMLEKLNRLVSIRGDEKYEVMIWDKISNQKIDSDVENYIYELSGIDLCQKCMQ
FT                   KGNIFLDALFEFVKIDDSHAIYIVQQIGSHYKTQLKKFEDADIFANFAYRILKGNFTYT
FT                   INEVAATILRYVAFEVNRFNAQHKIDDLKARGLEPLIEDILER"
FT   gene            704319..704531
FT                   /locus_tag="SAK_0767"
FT   CDS_pept        704319..704531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0767"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:D97764"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45598"
FT                   /protein_id="ABA45598.1"
FT                   /translation="MQLLDELVLPKDITIADVSQSIQEFEIERDALQEFFDDMLKTYTT
FT                   YQEMKDYIKSREANTPKQETEEKSL"
FT   gene            704649..705386
FT                   /locus_tag="SAK_0768"
FT   CDS_pept        704649..705386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0768"
FT                   /product="HAD-superfamily phosphatase, subfamily IIIB"
FT                   /note="identified by match to protein family HMM PF03767;
FT                   match to protein family HMM TIGR01672"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44446"
FT                   /protein_id="ABA44446.1"
FT                   /translation="MKKVLVSSLLVLGITITLQTVVEAKGPKVAYTQEGMTALSDTNKD
FT                   KVTTISIDEIQKSLEGKKPITVSFDIDDTLLFSSQYFQYGKEYVTPGSFDFLHKQKFWD
FT                   LVAKRGDQDSIPKEYAKKLIAMHQKRGDKIVFITGRTRGSMYKEGEVDKTAKALAKDFK
FT                   LDKPIAVNYTGDKPKKPYKYDKSYYIKKYGSDIHYGDSDDDIHAAREAGARPIRILRAP
FT                   NSTNLPLPEAGGYGEEVLENSAY"
FT   gene            705707..706225
FT                   /locus_tag="SAK_0769"
FT   CDS_pept        705707..706225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0769"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL94822.1; match to
FT                   protein family HMM PF08020"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44992"
FT                   /protein_id="ABA44992.1"
FT                   /translation="MRVYENKEELKKEISKTFEKYIMEFNNIPENLKDKRIDEVDRTPA
FT                   ENLSYQVGWTNLVLKWEEDERKGLQVKTPSDKFKWNQLGELYQWFTDTYAHLSLQELKA
FT                   KLNENINSIYAMIDLLSEEELFEAHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTK
FT                   IRKWKKIVL"
FT   gene            complement(706354..706590)
FT                   /locus_tag="SAK_0770"
FT   CDS_pept        complement(706354..706590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0770"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46217"
FT                   /protein_id="ABA46217.1"
FT                   /translation="MFFPNIDNIIKNYIKEMITHSDIPDLQKQLETAYQVPYSFALGIY
FT                   ISTIESIILNWIDHDFTEEPEEIARYITSVVRI"
FT   gene            707062..707394
FT                   /locus_tag="SAK_0771"
FT   CDS_pept        707062..707394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0771"
FT                   /product="cell wall surface anchor family protein,
FT                   truncation"
FT                   /note="identified by similarity to SP:Q02192; match to
FT                   protein family HMM PF04650; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45994"
FT                   /protein_id="ABA45994.1"
FT                   /translation="MLRKYKQRNYNVAHTKQRFSIKKFKFGVASVLIGLTFLGMSSHSV
FT                   LADESSIMSTEVPQTAGVKPEVTVTQPTSDVTSLATDTSTSAVLSTDASHSNPTESAEH
FT                   AVGLEC"
FT   gene            complement(707515..708264)
FT                   /locus_tag="SAK_0772"
FT   CDS_pept        complement(707515..708264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0772"
FT                   /product="ISSag5, transposase orfB"
FT                   /note="identified by similarity to GB:AAM99533.1; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45088"
FT                   /protein_id="ABA45088.1"
FT                   /translation="MDNQIYKKQILEIYTKANKRLGVKSIKVILQRDYDTKISEGRIYH
FT                   LMKNMALPKMATVKPKTALKKTQKTYPQNLLNQKFYPDKPNQVWSTDFTYISIGYKKYV
FT                   YLCAILDLYSRKCIAWKLSHRMDAKLACNTLELALNKRKIEGTLLFHSDQGSQFKAREF
FT                   RKIIDDNNIMHSFSKPGYPYDNAVTEAFFKYLKHRQINRKHYQNIKQVQLDCFEYIENF
FT                   YNNYIPHTANLGLTPNQKEENYFNAIK"
FT   gene            complement(708384..708659)
FT                   /locus_tag="SAK_0773"
FT   CDS_pept        complement(708384..708659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0773"
FT                   /product="ISSag5, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44431"
FT                   /protein_id="ABA44431.1"
FT                   /translation="MSTFKRYDEEFKQSLVNLYQTGKTQSELCKDYRVSTSALAKWIKQ
FT                   YSQFKLEDNSVLTAKQIQELQKRNAQLEEENLILKKASAIFMQNLK"
FT   gene            complement(709317..709664)
FT                   /locus_tag="SAK_0774"
FT   CDS_pept        complement(709317..709664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0774"
FT                   /product="chaperone protein HslO, putative"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45347"
FT                   /protein_id="ABA45347.1"
FT                   /translation="MDKIIKSISASGAFRSYVLDSTETVKLAQEKHHTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKRPQVKF
FT                   WLALLWGMVIL"
FT   gene            complement(709858..711066)
FT                   /locus_tag="SAK_0775"
FT   CDS_pept        complement(709858..711066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0775"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45843"
FT                   /protein_id="ABA45843.1"
FT                   /translation="MVTFDFKHVQTLHTISQLPISVMSRDKELVQLYGNEDYLLPYYQF
FT                   LKHLAIPYNQDITVYEDLFEESFLIFPVCQYLIAIGPFYPYSPDINRQEQLSSRFLEQF
FT                   SHRSKKEILSYIKLVPCFPTTSIRSLLVSIDAFFQTQFEASCQQAINHLLEESEQIVAD
FT                   PDIVLHLKHTKKNSFQLPTVLNHLNHIIDLVKLGNTQLLKQEINRLPSSSVTSSSIPAL
FT                   RAEKNLTVVYLTKLLELSFEENTDVAKSYALVKHYMALNEEAPDLIDVSRIRCAALIDF
FT                   SESLTNKSISDKQQMYNSILHYVDNHLYSKLKVSDIANYLYISDSHLRSVFKKYSDISL
FT                   QSYILKAKIKEGQLLLQRGVPIGEVAKLLHFYDTTHFLKTFKKYVGISSNEYLTKYRET
FT                   SCQ"
FT   gene            711448..713112
FT                   /locus_tag="SAK_0776"
FT   CDS_pept        711448..713112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0776"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44713"
FT                   /protein_id="ABA44713.1"
FT                   /translation="MKLSKKLLFSAAVLTIVAGSTVEPVAQFATGMSIVRAAEVSQERP
FT                   AKTTVNIYKLQADSYKSEITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTD
FT                   ISVDELKKLTTVEAADAKVGTILEEGVSLPQKTNAQGLVVDALDSKSNVRYLYVEDLKN
FT                   SPSNITKAYAVPFVLELPVANSTGTGFLSEINIYPKNVVTDEPKTDKDVKKLGQDDAGY
FT                   TIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDE
FT                   PTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQDALDKATANTDDAAFLEIPVASTIN
FT                   EKAVLGKAIENTFELQYDHTPDKADNPKPSNPPRKPEVHTGGKRFVKKDSTETQTLGGA
FT                   EFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFEIKGLAYAVDA
FT                   NAEGTAVTYKLKETKAPEGYVIPDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNK
FT                   RPSIPNTGGIGTAIFVAIGAAVMAFAVKGMKRRTKDN"
FT   gene            713201..714124
FT                   /locus_tag="SAK_0777"
FT   CDS_pept        713201..714124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0777"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45581"
FT                   /protein_id="ABA45581.1"
FT                   /translation="MKQTLKLMFSFLLMLGTMFGISQTVLAQETHQLTIVHLEARDIDR
FT                   PNPQLEIAPKEGTPIEGVLYQLYQLKSTEDGDLLAHWNSLTITELKKQAQQVFEATTNQ
FT                   QGKATFNQLPDGIYYGLAVKAGEKNRNVSAFLVDLSEDKVIYPKIIWSTGELDLLKVGV
FT                   DGDTKKTLAGVVFELYEKNGRTPIRVKNGVHSQDIDAAKHLETDSSGHIRISGLIHGDY
FT                   VLKEIETQSGYQIGQAETAVTIEKSKTVTVTIENKKVPTPKVPSRGGLIPKTGEQQAMA
FT                   LVIIGGILIALALRLLSKHRKHQNKD"
FT   gene            714126..715043
FT                   /locus_tag="SAK_0778"
FT   CDS_pept        714126..715043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0778"
FT                   /product="sortase family protein"
FT                   /note="identified by similarity to GB:AAC13546.1; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46025"
FT                   /protein_id="ABA46025.1"
FT                   /translation="MGQKSKISLATNIRIWIFRLIFLAGFLVLAFPIVSQVMYFQASHA
FT                   NINAFKEAVTKIDRVEINRRLELAYAYNASIAGAKTNGEYPALKDPYSAEQKQAGVVEY
FT                   ARMLEVKEQIGHVIIPRINQDIPIYAGSAEENLQRGVGHLEGTSLPVGGESTHAVLTAH
FT                   RGLPTAKLFTNLDKVTVGDRFYIEHIGGKIAYQVDQIKVIAPDQLEDLYVIQGEDHVTL
FT                   LTCTPYMINSHRLLVRGKRIPYVEKTVQKDSKTFRQQQYLTYAMWVVVGLILLSLLIWF
FT                   KKTKQKKRRKNEKAASQNSHNNSK"
FT   gene            715000..715851
FT                   /locus_tag="SAK_0779"
FT   CDS_pept        715000..715851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0779"
FT                   /product="sortase family protein"
FT                   /note="identified by similarity to GB:AAC13546.1; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44369"
FT                   /protein_id="ABA44369.1"
FT                   /translation="MKKRLVKIVTIIRNNKIRTLIFVMGSLILLFPIVSQVSYYLASHQ
FT                   NINQFKREVAKIDTNTVERRIALANAYNETLSRNPLLIDPFTSKQKEGLREYARMLEVH
FT                   EQIGHVAIPSIGVDIPIYAGTSETVLQKGSGHLEGTSLPVGGLSTHSVLTAHRGLPTAR
FT                   LFTDLNKVKKGQIFYVTNIKETLAYKVVSIKVVDPTALSEVKIVNGKDYITLLTCTPYM
FT                   INSHRLLVKGERIPYDSTEAEKHKEQTVQDYRLSLVLKILLVLLIGLFIVIMMRRWMQH
FT                   RQ"
FT   gene            715933..718605
FT                   /locus_tag="SAK_0780"
FT   CDS_pept        715933..718605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0780"
FT                   /product="cna B-type domain protein"
FT                   /note="identified by match to protein family HMM PF00092;
FT                   match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45860"
FT                   /protein_id="ABA45860.1"
FT                   /translation="MKKRQKIWRGLSVTLLILSQIPFGILVQGETQDTNQALGKVIVKK
FT                   TGDNATPLGKATFVLKNDNDKSETSHETVEGSGEATFENIKPGDYTLREETAPIGYKKT
FT                   DKTWKVKVADNGATIIEGMDADKAEKRKEVLNAQYPKSAIYEDTKENYPLVNVEGSKVG
FT                   EQYKALNPINGKDGRREIAEGWLSKKITGVNDLDKNKYKIELTVEGKTTVETKELNQPL
FT                   DVVVLLDNSNSMNNERANNSQRALKAGEAVEKLIDKITSNKDNRVALVTYASTIFDGTE
FT                   ATVSKGVADQNGKALNDSVSWDYHKTTFTATTHNYSYLNLTNDANEVNILKSRIPKEAE
FT                   HINGDRTLYQFGATFTQKALMKANEILETQSSNARKKLIFHVTDGVPTMSYAINFNPYI
FT                   STSYQNQFNSFLNKIPDRSGILQEDFIINGDDYQIVKGDGESFKLFSDRKVPVTGGTTQ
FT                   AAYRVPQNQLSVMSNEGYAINSGYIYLYWRDYNWVYPFDPKTKKVSATKQIKTHGEPTT
FT                   LYFNGNIRPKGYDIFTVGIGVNGDPGATPLEAEKFMQSISSKTENYTNVDDTNKIYDEL
FT                   NKYFKTIVEEKHSIVDGNVTDPMGEMIEFQLKNGQSFTHDDYVLVGNDGSQLKNGVALG
FT                   GPNSDGGILKDVTVTYDKTSQTIKINHLNLGSGQKVVLTYDVRLKDNYISNKFYNTNNR
FT                   TTLSPKSEKEPNTIRDFPIPKIRDVREFPVLTISNQKKMGEVEFIKVNKDKHSESLLGA
FT                   KFQLQIEKDFSGYKQFVPEGSDVTTKNDGKIYFKALQDGNYKLYEISSPDGYIEVKTKP
FT                   VVTFTIQNGEVTNLKADPNANKNQIGYLEGNGKHLITNTPKRPPGVFPKTGGIGTIVYI
FT                   LVGSTFMILTICSFRRKQL"
FT   gene            718636..719449
FT                   /pseudo
FT                   /locus_tag="SAK_0781"
FT                   /note="sortase family protein, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to GB:AAC13546.1"
FT   gene            719698..720303
FT                   /locus_tag="SAK_0782"
FT   CDS_pept        719698..720303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0782"
FT                   /product="Cna protein B-type domain"
FT                   /note="identified by match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45467"
FT                   /protein_id="ABA45467.1"
FT                   /translation="MARDPYSDRSRYLDPKVLSSSFGAFFPADNIKVAWSNNSSTLFTP
FT                   PINANYTTQIQAIGTTIKSQIPESILTVTDKKSRKFSINKIDEAKEGLVGATFTLSKRT
FT                   TVAADHQVQGDFIPVSKETTVGRTTLTFDNLKPGFYDLKETKAPNAYVLDPKTYVVVVQ
FT                   NSGKTTIVDEANFKEADYPMADNTSHVECVALLQRSKG"
FT   gene            720824..720916
FT                   /pseudo
FT                   /locus_tag="SAK_0783"
FT                   /note="Tn5252, Orf28, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAN00159.1"
FT   gene            721133..721803
FT                   /pseudo
FT                   /locus_tag="SAK_0784"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to PIR:C98090"
FT   gene            722922..723191
FT                   /locus_tag="SAK_0785"
FT   CDS_pept        722922..723191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0785"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44976"
FT                   /protein_id="ABA44976.1"
FT                   /translation="MVSLLLLKVKQEELIEFHNVFYREAISSYLETENFEKAKVTEDNY
FT                   QVFLGIRTYQKSYNYQDHSENLKGNIEVAMIGVENNISDEHIFC"
FT   gene            723252..724403
FT                   /locus_tag="SAK_0786"
FT   CDS_pept        723252..724403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0786"
FT                   /product="beta-lactamase, putative"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45638"
FT                   /protein_id="ABA45638.1"
FT                   /translation="MVRKFLKSLLSLFLIAVIATGISVACFFFIPENKGNITPILLHRF
FT                   MRKNNVNGMMIVSDNTGKPITISHGINRGEVETDIENNKLFPMASLQKLMTGIIIQRLI
FT                   DQDVLSEDDRLSQFFPQVKGSNSITIHQLLTHTSGLREKGVKVSPYLKNEREQLQFCLK
FT                   HYNFVNKKSWYYSNINFSFLTGIATQVTGRTYAELVDDVIKNPLRLDDTQSYQSVVNHD
FT                   LVSPMRKNGKLNKINIFNQVSTAYGAGDFFTTPLNFWVLMRSFSKGYFFPTDEYTKHQN
FT                   DAISHYYGGLYMHGRIVNSNGAFFQYSSFGYADLKTHDTMVLFMNNKVYSDASHVAPKA
FT                   FEYYQKFMFLNKIFHLVFYFVFSFFLMLLIRHSFRKRRYKKRL"
FT   gene            724603..725595
FT                   /locus_tag="SAK_0787"
FT   CDS_pept        724603..725595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0787"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45485"
FT                   /protein_id="ABA45485.1"
FT                   /translation="MSMIEVSHLQKNFIKTVKAPGLKGAFQSFLRPEKHTFEAVKDLTF
FT                   DVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRIDGKLPQENRQNYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPDKEFRKRMAFLNEVLELNDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCHRIFMIDRGQEIFDGTVSQLKETFGKMKTLSFDLRPGQEHISSSLIGKSEINIKRND
FT                   LVLDIQYDSSRYQTADIIQQTLADFSVRDLKMTDADIEDIIRRFYRNEL"
FT   gene            725598..726416
FT                   /locus_tag="SAK_0788"
FT   CDS_pept        725598..726416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0788"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GB:BAB79887.1; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44480"
FT                   /protein_id="ABA44480.1"
FT                   /translation="MNRIWRRYKPFISTGIQGLITYRVDFILYRIGDVIGAFVAFYLWK
FT                   AVFDSSSQSLIQGFQLSDMILYIIMSFVTNLLTRTDSSFMIGDEVKDGSIIMRLLRPVH
FT                   FAASYLFMEIGSRWLIFLSIGVPFLLVITGVRLFLGTDLIQAIVLVVFYIISIILAFLI
FT                   NFFFNICFGFSAFVFKNLWGSNLLKNSLVAFMSGSLIPLTFFPKIVADILGFLPFSSLI
FT                   YTPVMIIIGKYDGSQIVQALLLQIFWLIVMVALSQLIWKKVQSHITIQGG"
FT   gene            726418..727203
FT                   /locus_tag="SAK_0789"
FT   CDS_pept        726418..727203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0789"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46143"
FT                   /protein_id="ABA46143.1"
FT                   /translation="MTKYQRMHFIFIKQYMKQIMEYKIDFFVGVLGVFLTQGLNLLFLN
FT                   VLFQHIPSLEGWTFQQIAFIYGFSLLPKGIDHLFFDNLWALGQRLIRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGFILLSTTVSSISWTVPKVLLFIFIIPFATLIYTSLKI
FT                   ATSSIAFWTKQSGAVIYIFYMFNDFAKYPVAIYNNLLRWIISFVIPFAFTAYYPAAYFL
FT                   QDRNVYFNIGGVILISLISFMVSLILWHKGVEVYESAGS"
FT   gene            727828..728133
FT                   /gene="cylX"
FT                   /locus_tag="SAK_0790"
FT   CDS_pept        727828..728133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylX"
FT                   /locus_tag="SAK_0790"
FT                   /product="cylX protein"
FT                   /note="identified by similarity to GB:CAD46288.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45472"
FT                   /protein_id="ABA45472.1"
FT                   /translation="MGRSNILSRCEQCSDNQCGLYKTRLKDKLLLVVQLVGNIRYSEFL
FT                   TEGGVYHKGETLLEVITLGISYEYKSYGDIKVIKKYCADGSVVDYNMPILLMERIE"
FT   gene            728133..728981
FT                   /gene="cylD"
FT                   /locus_tag="SAK_0791"
FT   CDS_pept        728133..728981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylD"
FT                   /locus_tag="SAK_0791"
FT                   /product="CylD protein"
FT                   /note="identified by similarity to GB:CAD46289.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45020"
FT                   /protein_id="ABA45020.1"
FT                   /translation="MKTVIIYGGQGNVQSKHLCQLVKTPKGEILFSKLQATDLESYQLM
FT                   MDVINHKVSLDNVHASMLANFLYNDWLTNDEKIVSGIGFSAHSAGIFNVLYASGSTSFE
FT                   NIIHFIKRRAQLIENCHVSEELWLLMVENIDMFSKDVLKEQSEKVKLAIITDDRAGVIA
FT                   MDQVNRSFFDDVMTNKGYFYKLKQLGVKAPYHTDFLNESKEQYKQLIESLDISQNDDYD
FT                   YIFHCDQLVDEILYQWTNLFNWRAIKETIIEKDAEIIDISPNRFISSQLQKMKKRGRKQ
FT                   L"
FT   gene            728978..729700
FT                   /gene="cylG"
FT                   /locus_tag="SAK_0792"
FT   CDS_pept        728978..729700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylG"
FT                   /locus_tag="SAK_0792"
FT                   /product="cylG protein"
FT                   /note="identified by similarity to GB:AAD32035.1; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45623"
FT                   /protein_id="ABA45623.1"
FT                   /translation="MKVAIVTGGTRGIGRAITKELYKEGYKVIAIYNSNDAKARALQEE
FT                   LPKLDVYKCNISDAKAVQKLVTKIFREYGGIDCLVNNAGIVRDGFFLMMSKEKWMDVIN
FT                   INIMGLVNMSKAVLKIMKAKRIQGKVINISSTSGIAGQIGQANYSATKGAIISITKTLA
FT                   KEFASDGITINCVSPGFIETDMTNELQNKEELKEHLIPLKRFGQPEEVAWLVSFLASEK
FT                   ANYITGKNIVIDGGMIND"
FT   gene            729693..729998
FT                   /locus_tag="SAK_0793"
FT   CDS_pept        729693..729998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0793"
FT                   /product="acyl carrier protein"
FT                   /note="identified by similarity to GB:AAD32036.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45241"
FT                   /protein_id="ABA45241.1"
FT                   /translation="MINWAEERKIIKTRQEVVDEIKGILIDSLMLDIDKDLIMNDQPLF
FT                   GRGLELDSIDALELSIGISTTFGVELNDDDISILSSVNRLADFVIENSEDIDDQAK"
FT   gene            729982..730458
FT                   /gene="cylZ"
FT                   /locus_tag="SAK_0794"
FT   CDS_pept        729982..730458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylZ"
FT                   /locus_tag="SAK_0794"
FT                   /product="cylZ protein"
FT                   /note="identified by similarity to GB:AAD32037.1; match to
FT                   protein family HMM PF03061; match to protein family HMM
FT                   PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44582"
FT                   /protein_id="ABA44582.1"
FT                   /translation="MTKLSSEEIIKMLPHRYPFLMVDRVQSYKKGIIECRKNITINEPY
FT                   FQGHFPQRPIVPGVLMIEMAAQSAALLYILDALDGSLPSLDELTAEKIAEKVGYLASVK
FT                   NFKFKKIVTPGDQLNITCKSQSKLGHLLEIQVVIRDENKKEVASGRMLVSENGN"
FT   gene            730448..731377
FT                   /gene="cylA"
FT                   /locus_tag="SAK_0795"
FT   CDS_pept        730448..731377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylA"
FT                   /locus_tag="SAK_0795"
FT                   /product="ABC transporter, ATP-binding protein CylA"
FT                   /note="identified by similarity to GB:AAD32038.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45762"
FT                   /protein_id="ABA45762.1"
FT                   /translation="MEIKLKNIGKKYGSFEALRDINLIFEEGKFYGLLGPNGAGKTTLF
FT                   NLLIQNFKQTSGDIKWEVDGKPLSIKDFYRHIGIVFQSNRLDDNLTVEENLISRGALYG
FT                   LSKSQVRNRLKDLQTYLDITAIKKQKYGSLSGGQKRKVDIARALLPQPSLLLLDEPTTG
FT                   LDPQSRRDLWDAIAQLNQQSQMTVVLITHYLEEMSACDVLNVLIEGNIYYSGDIKSFIE
FT                   QHSTTNLNVVLKPEKSLDQLSIADFVNKCQVLSEREIVFKDISVEEMMQVISDNQDKSI
FT                   IETFNVEYSNLEAAYLNLLREKERKNNV"
FT   gene            731370..732248
FT                   /gene="cylB"
FT                   /locus_tag="SAK_0796"
FT   CDS_pept        731370..732248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylB"
FT                   /locus_tag="SAK_0796"
FT                   /product="ABC transporter, permease protein CylB"
FT                   /note="identified by similarity to GB:AAD32039.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44658"
FT                   /protein_id="ABA44658.1"
FT                   /translation="MFELISRNRKVYTRDRLAFFMSFLSVIILILVYQIFLGKIQLDAI
FT                   KAALRSNTVSSDTIHMVNYWLIAGLTTIISMTSTLGAFGVMVSDKEKKLNEDFKVSPIS
FT                   NIKIELSYAIFAVLFGIVMTMFSCIFAIGIFNGFNSLLEYSAMDYLTILGIVSLGTVLS
FT                   AAMILPILAFIHTSSAFTTLSTIVGTFIGFISGVYLSIGSVGKALQQVMTWFPLTQINS
FT                   LLKQVLMKGSIAKVFDKANEATVSNYKESYGVVLRNADGERLSNHFMLIYIIALILILL
FT                   AIHFIIKKVKK"
FT   gene            732245..734248
FT                   /gene="cylE"
FT                   /locus_tag="SAK_0797"
FT   CDS_pept        732245..734248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylE"
FT                   /locus_tag="SAK_0797"
FT                   /product="CylE protein"
FT                   /note="identified by similarity to GB:AAD32040.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46071"
FT                   /protein_id="ABA46071.1"
FT                   /translation="MKDDNKLKISEASLEDYSEVVHLFNRNHVYQFPDGRPLTVDDLDL
FT                   TLKVKEVTHLFLLKNHGVLIGTSAFFKFITYGCLDWNSSFSGFLLIDSKSRSGQAITYL
FT                   YKTILKKITKLKFSNIYTEISNYNKPSLALSKLNGFKEYDKTYEDILHCRSLRSHLPKI
FT                   LNTFRISNYYGKTYDISTFQIMEEIENPLEEETEIRTKVSDEEILFKAEDSASLPYYLK
FT                   MSLFQMEIARLDNRYVLQVDFLSEQVKRVRVKTGKYHLANLTRAHPSLTLSRFANYYYI
FT                   QATVETLYGNIDVQLERRKKHYRDATICLKRTFQGYDLLISPNGSLIFEKQKRKILEDS
FT                   FLIFSQPLDKKLVVKEEENHITIKCFYQGALIEKIMTFTSDEEITCVYKCNQKAKEMFP
FT                   KLLKQTFKLHCQEQLIRDSEGYLVNVPGSYPIEHDDFLRADKFEDRQFHYYLPNEDKMI
FT                   SYSPPGKASNQMQFRPLCLIDTDSLSFPLTYHFRISQASSEEALINLKKQPIWDSNYQA
FT                   SATDLLKHISNLTLEEEKDYGIKRMIANRKHYPSHKLVLAYNQIVLPKNEIPRDSELYS
FT                   ISFDYRIRGKFVQIRQGEHVKYDNKSYVLENSQQLVLYVASDDKYILISAKNGIFYSYK
FT                   ENNHLKIRCMFKRNSPYATNVSITEYRKCEEK"
FT   gene            734245..735198
FT                   /gene="cylF"
FT                   /locus_tag="SAK_0798"
FT   CDS_pept        734245..735198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylF"
FT                   /locus_tag="SAK_0798"
FT                   /product="cylF protein"
FT                   /note="identified by similarity to GB:AAF89494.1; match to
FT                   protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44717"
FT                   /protein_id="ABA44717.1"
FT                   /translation="MNTIYNTLRTDKGYKVYEGYLYEITGEECEEALDLVIPKNIVFAD
FT                   TDTCGYTFLLNEDGTVYDDVTFYKFDDKYWLASHKALDSYLDNINFDYTVTDISDEYKM
FT                   LQIEGRYSGEIAQSFYEYDISTLNFRTLIEMTYKGEKGYLARFGFSGEFGYQFFLPSSI
FT                   FATFVSDVCEGIAEYGDELDRYLRFEVGQPITDIYQQEEYSLYEIGYSWNLDFTKEEFR
FT                   GRDSLLEHIRSATVKSVGFSTKEKLASGTPVLFDDQIVGKIFWIADEKDSSENYLGLMI
FT                   VNQTYAHSGVTFVTEDGQILKTQSSPYCIPESWNKE"
FT   gene            735195..737390
FT                   /gene="cylI"
FT                   /locus_tag="SAK_0799"
FT   CDS_pept        735195..737390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylI"
FT                   /locus_tag="SAK_0799"
FT                   /product="cylI protein"
FT                   /note="identified by similarity to GB:AAM99561.1; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45831"
FT                   /protein_id="ABA45831.1"
FT                   /translation="MSVYVSGIGIISSLGKNYSEHKQHLFDLKEGISKHLYKNHDSILE
FT                   SYTGSITSDPEVPEQYKDETRNFKFAFTAFEEALASSGVNLKAYHNIAVCLGTSLGGKS
FT                   AGQNALYQFEEGERQVDASLLEKASVYHIADELMAYHDIVGASYVISTACSASNNAVIL
FT                   GTQLLQDGDCDLAICGGCDELSDISLAGFTSLGAINTEMACQPYSSGKGINLGEGAGFV
FT                   VLVKDQSLAKYGKIIGGLITSDGYHITAPKPTGEGAAQIAKQLVTQAGIDYSEIDYING
FT                   HGTGTQANDKMEKNMYGKFFPTTTLISSTKGQTGHTLGAAGIIELINCLAAIEEQTVPA
FT                   TKNEIGIEGFPENFVYHQKREYPIRNALNFSFAFGGNNSGVLLSSLDSPLETLPARENL
FT                   KMAILSSVASISKNESLSITYEKVASNFNDFEALRFKGARPPKTVNPAQFRKMDDFSKM
FT                   VAVTTAQALIESNINLKKQDTSKVGIVFTTLSGPVEVVEGIEKQITTEGYAHVSASRFP
FT                   FTVMNAAAGMLSIIFKITGPLSVISTNSGALDGIQYAKEMMRNDNLDYVILVSANQWTD
FT                   MSFMWWQQLNYDSQMFVGSDYCSAQVLSRQALDNSPIILGSKQLKYSHKTFTDVMTIFD
FT                   AALQNLLSDLGLTIKDIKGFVWNERKKAVSSDYDFLANLSEYYNMPNLASGQFGFSSNG
FT                   AGEELDYTVNESIEKGYYLVLSYSIFGGISFAIIEKR"
FT   gene            737395..738606
FT                   /gene="cylJ"
FT                   /locus_tag="SAK_0800"
FT   CDS_pept        737395..738606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylJ"
FT                   /locus_tag="SAK_0800"
FT                   /product="CylJ protein"
FT                   /note="identified by similarity to GB:AAM99562.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44423"
FT                   /protein_id="ABA44423.1"
FT                   /translation="MSKFLFAPFMMNLGESQRLSKLANCLYEQGHDIHILGDNYYPFLF
FT                   NNDAYRYHHCVEDKSVYNSKRYDAFFSLSTDFNFLSEEEIERICSIERDLLRQEKFDAV
FT                   LTGYRLSIVTSCRLESIPLIWIISGATHISEIVENSEGILPNGKISKASKPQTKDFIKR
FT                   VITTYSTNVKTWNNYIKKYGGKPFNNALELFTGDLNLVTDYSLFYEFDKDSSYKTIGPI
FT                   LIDNVGFSKCSQINQDNKTVLLSFGTSFKRDWVESFLKTLPRHYHYLLTSCGEAINIPG
FT                   SYIEIVDFIDFKTIDKEIYFAIIHGGQGTVYAMAAQGIPFIGIPFFNEQFWNIKKFSKE
FT                   KCAYLVKKPDVREIRKAISCLERDYDIYKSYMIRLSQGIKEEAEASLQKAEAEIESFIR
FT                   KRQS"
FT   gene            738614..739150
FT                   /gene="cylK"
FT                   /locus_tag="SAK_0801"
FT   CDS_pept        738614..739150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cylK"
FT                   /locus_tag="SAK_0801"
FT                   /product="CylK protein"
FT                   /note="identified by similarity to GB:AAF01071.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45435"
FT                   /protein_id="ABA45435.1"
FT                   /translation="MIYKNRQSTLENNLSGDRLMRYQQANRQVSKDKLLTGSYFVYQCL
FT                   KKLGFTNKICQESFSSVSSYLIGLPKGKISYSNSGDYHILTYAPSGSTGVDIEKYKDRS
FT                   EQTYQNYLGESVSSDMDSKLLFYKAWLQKEISYKCGKSIDITYQTMIDGYIYGYAFDNT
FT                   FKVEAVYLKELLPDN"
FT   gene            739493..739834
FT                   /locus_tag="SAK_0802"
FT   CDS_pept        739493..739834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0802"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44655"
FT                   /protein_id="ABA44655.1"
FT                   /translation="MSEFLSAKPIGHNDSSNTILRIIENTKYIHHYDGKVVVEIPPQKE
FT                   PIKVFFMDSRLHYLEFSDICRYVTVVLKNSTVDNITNLGLDNHIVYDNGDDMVDPLPSI
FT                   QHGLFLNDD"
FT   gene            739868..740383
FT                   /locus_tag="SAK_0803"
FT   CDS_pept        739868..740383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0803"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:P11657"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46210"
FT                   /protein_id="ABA46210.1"
FT                   /translation="MTFYKKTDKFGFRKSKVCRSLCGALLGTVAVVSLATASTEIHADE
FT                   ATTSPTTVTKVPQPVQADTTALNTSKTHSTQATTTPVEAKENKVVKSETVQSESRVMPR
FT                   DKVVERPETVKASVNSDVSQPITTTPPTINEKTVEIPNLAQDTKKVAPKVTVTPEVVNQ
FT                   PKQLPKYE"
FT   gene            740435..743092
FT                   /locus_tag="SAK_0804"
FT   CDS_pept        740435..743092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0804"
FT                   /product="peptidase, S8 (subtilisin) family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by similarity to GB:AAK27981.1; match to
FT                   protein family HMM PF00082; match to protein family HMM
FT                   PF06280"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44403"
FT                   /protein_id="ABA44403.1"
FT                   /translation="MTKPQGAVAEKATPAVPKPQKVRVIVEFNKESILDYATEQKKTVA
FT                   QLNQADVEKKLQSIKQEQDKVLKNIEKSVHFDSSKVKRYDAIINGVALDIQAQEIEKLK
FT                   TIADVRRVYVSQEYVQTKPLLSSSGQLIGLPEVWNNSQYKGEGTVVAVIDSGVDFKHQA
FT                   LKIKEPNRAKYNKTSIEKLIHEKNLKGKFYSEKVPYGYNYYDYNDNLKDSYGVMHGMHV
FT                   TGIVGANDDNQKLYGVAPNAQILAMKVFSDDQQNPTTFTDVWLKALDDAILLKADVVNM
FT                   SLGTPAGFVHEGKDYPELEVIARACKAGIVIAVAAGNEGNITDGNTYGVKPLAENYDTA
FT                   LIANPALDDNTLAVASMENLKKHAHVLKFKDKKSGTEVTEVINLHVAPNASKTIIGLAV
FT                   DLGAGAPSELSKHFDLSGKIAMLEIPEDNKSNGFLEKVQAITKLNPAAILLYNNAKVKD
FT                   DLGSQLLVESEAAKFNIARITRSTYNNIKNNSNKIITILTERQAIDNSLAGQLSSYSSW
FT                   GPTPDLRLKPEITAPGGHIFSTVEDNQYADKSGTSMAAPQVAGAAAVLKQYITDKKIPV
FT                   DNAADFIKLLLMNTAQPIINKQSKDGKTPYFVRQQGSGAMNLAKALVTTVVATVTGTND
FT                   NNADGKLELRELKEKKFKARILLRNFGKTNKTYIISSEAIADPVDEKGFRTQNSEHLVS
FT                   KKADAVTRKVTVEAGKTLAVDLDVDYSDAEALTRNNFLEGYLNLKDTEGVADLHLPFLG
FT                   FYGSWTEQKAIDAFEGISEIGNGDKKRRVQFYVNKETNKTSSTFTTNGMLSLPIYNNTV
FT                   FFSPNSPFYDKAGVRIAALRNMEYVQYSIIDPDTNKEVRVLGRSHDVRKLYRLDYRNSF
FT                   AMMPDSIWDGKIKD"
FT   gene            743195..746419
FT                   /locus_tag="SAK_0805"
FT   CDS_pept        743195..746419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0805"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45897"
FT                   /protein_id="ABA45897.1"
FT                   /translation="MDNNKPYLSPKDKTTVEKLEDRWKKITFKVQDTGIGLKDVYLQSV
FT                   KYVGGGNNNLDLITPPGFKKEDKKVEKPKLDRPPGIDLPPPTSMRSFDYSTPPGTKPSK
FT                   PKDSLSTPPGFPDLNTPPDEALKDSKKDAIEDKSGAIKYAKSLQLSFVDDPILASKVNG
FT                   KILQVESDGKLVIPRNALSANQFDDTSLKIYRNNNRNKEITITTDYFADTKYVNITAVD
FT                   YLSNTTFEQLATGETVDYHAIVFSSFAAIKDKGGKIYVNDKLQETSRIALKDKSVKIGI
FT                   ELPNDVRHIDSLSVRRLNEVKTVDNILKNDEQDINLSKTYQLKYNPTNRRLEFTINNIN
FT                   SSSEIMTTFKDGKMPELVEQKDVSLDINDMDMSKFKTIRLGRKDSEFKGQLIAKTGTVE
FT                   LDMFFKQSQDPASIIKKIYLIQNGVPNELKKFDSSFGLTESQIDGYYIYKDAINLKFKL
FT                   TSGASLKVVYKGQEDPYSHQKEDMTKKGEQLSHSTQANENTAKVTFANIDWSHYSKVTV
FT                   NGKEVGKGSELPLTKGWTTFVLHKTENSLNVKSLIMETGSVSKKVQQLPLSPRLSKNKH
FT                   MRDMLLTMQKDSAYYETSDSLVLRINLTADTKLNFNAVKGASALTENMMMRQFAVAGPQ
FT                   DDPVSEHKYPSVFLLTPALLETASEATLNGKEITASGIIGHIKDGDKSKHVEVKMVNEN
FT                   GDMLGTPVIIQGKDLTNRTKPLMSGRRVLYAGKQYEFRAKLPLSRFNTWIRVEVVTEAG
FT                   EKASIVRRMFFDQSVPELNTAVAKRDLTSDTALIHIVAKDDSLKLKLYQDDSLLESVDK
FT                   TGLYSFRNGVEITKDMTVPLEFGDNIIKLSAVDLSNYRRNETLHIYRNRFDVKASQMTA
FT                   DKGAKVTVDMLMKHLVVPEMAGAYTLTIDEDPNTNESGMLTNAKVSIHYVNGGVDKVDV
FT                   PIKVVDLEAIRKAEEAHKADEARKAEEARKAEEARKAEEARKAEEGHKTQEAPIVEEGY
FT                   KVNNVHQTDTTVKASDLPKTKTVSAVHMARTDNKQITSHQTHVEKQIKNTLPSTGDSKR
FT                   GYYITGMAIVMLSVLFSLAKKFKSKY"
FT   gene            746690..748634
FT                   /pseudo
FT                   /locus_tag="SAK_0806"
FT                   /note="endopeptidase O, degenerate; this region contains
FT                   one or more premature stops and/or frameshifts which are
FT                   not the result of sequencing error"
FT   gene            748666..749697
FT                   /locus_tag="SAK_0807"
FT   CDS_pept        748666..749697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0807"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT32184.2"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46273"
FT                   /protein_id="ABA46273.1"
FT                   /translation="MKNITKLSTVALSLLLCTACAASNTSTSKTQSHHPKQTKLTDKQK
FT                   EEPKNKEAADQEMHPQGAVDLTKYKAKPVKDYGKKIDVGDGKKMNIYETGQGKIPIVFI
FT                   PGQAEISPRYAYKNLIERLSKKYKIYTVEPLGYGLSDIPTKPRTLENITKEIHTGLNKI
FT                   GVKNFYLAAHSLGGMYSLNYAKNYPEEVRGFIGMDTSTPWMEGEQKTKYDPESAKWAMK
FT                   LPDVDDKTNEQYLSIAKKINGNKSQRDEDERLGDNLGKLKNVKFPKGMPTKYFLADQSV
FT                   EGIKLRQADFKGLKNWDQQHIDLSEDPKDASVEILKGSHNIFQTQYEHMAKAIDGFIQS
FT                   HQK"
FT   gene            749732..750751
FT                   /locus_tag="SAK_0808"
FT   CDS_pept        749732..750751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0808"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:D69747"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45577"
FT                   /protein_id="ABA45577.1"
FT                   /translation="MNKITKLSTVALALMLCVGCSANKDNQKTKTEQPKQEKSIAKQKQ
FT                   EREAEKAMIAKGAIDLTKYKAKPIEDYGQKIDVGDGKKMNIYTMGQGKIPLVVFPGQAE
FT                   ISPRYAYKNLLDRLGKKYKIYTVEPLGYGLSDMTDKPRTIENITKEIHTALEKVGVKNF
FT                   YLMAHSLGGIYGLNYAKTYSNDVKGFIGMDTSTPNMEGDGTTGESSASTLKWAESIPEV
FT                   DKKTNEQYLSIGAKKSGNKTERDEDRRVSDNLHKMEKVKFPKGMPAKYFLANESAEDIK
FT                   MRKKIFPKLKSWEQQHIDLSEDPKDVSVETLDASHLIYHTQYKHMAKAIDEWIQSHKK"
FT   gene            750786..751847
FT                   /locus_tag="SAK_0809"
FT   CDS_pept        750786..751847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0809"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D69747"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45346"
FT                   /protein_id="ABA45346.1"
FT                   /translation="MNKITTLSTIALTLMLCVGCSANKDNQKTKTEDPKQENVTANPKE
FT                   DKATAAKRMKLTKELEKYNKGTESFISNKQYQKYIKTPIKEYGQKVKVKGKKMNVYTVG
FT                   EGKVPIVFIPGQGTVTAKHQYHNLISNLSKTHKVVVVEPFGSGLSDVIDQPRNLANITS
FT                   DIHEALQKVGITGKYVIASHSIGGVYALKYISTYPKEVLGLIGLDTSTPGMEGGKQVDF
FT                   AAPVLKELPKIPKVSDDINAQFFAIGHKILNNSNMKEEAKNSSNMINESANYKIPKGIP
FT                   AMYLLARESDLGLQLRSLDIPIKGSWQEQHKELSEDPKEVSIHTLDGTHQIYDTNLKEV
FT                   IDYTNQFMKTFEK"
FT   gene            751971..753200
FT                   /locus_tag="SAK_0810"
FT   CDS_pept        751971..753200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0810"
FT                   /product="permease, putative"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45947"
FT                   /protein_id="ABA45947.1"
FT                   /translation="MNLWTLSLAYLKRQKMKTVTLFLVFLTIGTCLISLMSIQHSLEKN
FT                   ILTKQGKSIYLTSKEKAYWPEQAYEALKKAKMVESVEASLSIDVGSRLKSVSPYNSSKE
FT                   ENQVTLAGYQSTEDLRAFQTKALVLKKGSHLAADNTKQVLVSLKLAQKNHLSVGNKLRL
FT                   GKENVTIAGIYDANSAKSKNTFNPNIDNTLIAQATLVRKISKQKGYQTVAVRLSDKRLV
FT                   DTVIQNIKQWPLDFGKLDVQTAKEFYGDSYRNIETLHRLVGRIILIVSLVAMAILVVML
FT                   TFWINNRIKETGILLAIGKTKFEIIGHYLIEVLLVAGAAFTLSIIGGVFLGKTFAAGLL
FT                   SQVNGGVSSQIVQNSSLIIDRIDNLAVSVGVMDVFRLYAQGALICLFAVVLSSYSILKL
FT                   QPKQILSRMS"
FT   gene            753210..754436
FT                   /pseudo
FT                   /locus_tag="SAK_0811"
FT                   /note="transport protein, putative, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to GB:AAN24110.1"
FT   gene            754648..755319
FT                   /locus_tag="SAK_0812"
FT   CDS_pept        754648..755319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0812"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to PIR:G95069; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45391"
FT                   /protein_id="ABA45391.1"
FT                   /translation="MFELKNIAYRYKGNDNKTLENINYSFQSGVFYTILGNSDSGKTTL
FT                   LSLMAGLDSPTEGQVLFNKKDIKEAGYAQHRKKNIALVFQNYNLLDYLTPLENVQLVKP
FT                   TADKQLLLDLGLKEDMLTRNILRLSGGQQQRVAIARALVAGTPAILLDEPTGNLDFDIA
FT                   RDITMRLKDFAHKEKRCVIMVTHSREIAHMADTALQLTGDNLKELSKESIAQSILQQRN
FT                   L"
FT   gene            complement(755376..756794)
FT                   /locus_tag="SAK_0813"
FT   CDS_pept        complement(755376..756794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0813"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO05041.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45063"
FT                   /protein_id="ABA45063.1"
FT                   /translation="MGVSGLAVLLALSRKKEKELKQLAIFCFDDTVHFGRGIPFQEDVD
FT                   SALINSPINDISFDYRHMSDFMDWLEENYYDTNLTYVSRTLYGQYLSERTKLLLDKLPV
FT                   TVIKTRVDKLNYLSDKQQWQVYIQDKLFPVTFDELHLACGALPVIDPYHLEGKTDYIKD
FT                   PYPIKHLAQENWKGKTVAIIGTGLAAIDVIKWLLLNTQSSVKAFSRTNYFPSVRIVNDL
FT                   PLTWHFFTNDNLKAFLSHPSKTFTIADFNDLMSGELEHLGFKNWKNTTETFLSPGIDGL
FT                   KRAFKYPKQLYLLQQLASRITVWLTDLWPLMSLSDKKEYKALYGKAIINLRNPMPDESA
FT                   KVILKAAQKGTFSLINNVKTIAKNDEGFSIEKEKQNHISVDRVINATGYQLNTKNWTKA
FT                   NPLLKSLINQEFCQIDDQGGITILTENAQVLSPKYGPMPGLYAHGALVNGVVYQNNSTI
FT                   KIQQMAERAFSDNK"
FT   gene            757082..757867
FT                   /locus_tag="SAK_0814"
FT   CDS_pept        757082..757867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0814"
FT                   /product="DNA-entry nuclease, putative"
FT                   /note="identified by similarity to SP:Q03158"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45170"
FT                   /protein_id="ABA45170.1"
FT                   /translation="MKRLHKLFITVIATLGMLGVMTFGLPTQPQNVTPIVHADVNSSVD
FT                   TSQEFQNNLKNAIGNLPFQYVNGIYELNNNQTNLNADVNVKAYVQNTIDNQQRPSTANA
FT                   MLDRTIRQYQNRRDTTLPDANWKPLGWHQVATNDHYGHAVDKGHLIAYALAGNFKGWDA
FT                   SVSNPQNVVTQTAHSNQSNQKINRGQNYYESLVRKAVDQNKRVRYRVTPLYRNDTDLVP
FT                   FAMHLEAKSQDGTLEFNVAIPNTQASYTMDYATGEITLN"
FT   gene            complement(757945..758583)
FT                   /locus_tag="SAK_0815"
FT   CDS_pept        complement(757945..758583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0815"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45743"
FT                   /protein_id="ABA45743.1"
FT                   /translation="MFLIDFILHIDTHIYAMANTVGNWTYLLLFLVIFVETGAVIFPFL
FT                   PGDSLLFAAGALAANPKMSFNIVTFLIIFFIAAFIGDSCNFLIGRTFGYRFIKHPFFRR
FT                   FIKEKNIRDAELYFEKKGTAAIILGRYIPIIRTFVPFVAGISQLPPKVFIKRAFIAALS
FT                   WSVIATGSGFLFGNIPFVKQHFSLIILGIVFVTLIPVLISGVKSYRNTK"
FT   gene            758800..759456
FT                   /locus_tag="SAK_0816"
FT   CDS_pept        758800..759456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0816"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GB:AAS08546.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45312"
FT                   /protein_id="ABA45312.1"
FT                   /translation="MSYLTFKHVDFKTDDKLVLNDINFAIDEGDFVSIVGPSGSGKSTV
FT                   LKLASGLMSPTAGHIFFDGKDLNQLEPIESRKMISYCFQTPHLFGNTVEDNISFPYHIR
FT                   HEKVDYRRVDDLFQRFEMDQSYLKQDVKKLSGGEKQRIALIRQLLFEPKVLLLDEVTSA
FT                   LDNHNKAIVEKVIKSLHDKGITILWITHDEEQSRRFANKVLKVVNGSIEAMEVIK"
FT   gene            759453..760226
FT                   /locus_tag="SAK_0817"
FT   CDS_pept        759453..760226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0817"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03649;
FT                   match to protein family HMM TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46235"
FT                   /protein_id="ABA46235.1"
FT                   /translation="MSGANSISLMSLLMASSLVLITLFFSYWQKLNLEKEVIISAIRAV
FT                   IQLLAVGFLLDYIFGYQNPIFTALLMLFMIINASYNAAKRGKGINKGFVISFIAIGSGT
FT                   IITLSVLIFSGILKFVPNQMIPVGGMIISNSMVAIGLCYKQLLSEFRSKQEEVETKLAL
FT                   GADILPASIDIIRDVIKTGMVPTIDSAKTLGIVSLPGMMTGLILAGTSPIQAVKYQMMV
FT                   TFMLLATTSIASFVATYLAYKIFFNNRKQLVVTKD"
FT   gene            760390..761208
FT                   /locus_tag="SAK_0818"
FT   CDS_pept        760390..761208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0818"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E95095"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46240"
FT                   /protein_id="ABA46240.1"
FT                   /translation="MILKICRAAYSLQWGGVYQLALLDYPRIKAFELERIGAFIAYEKQ
FT                   YKRKIEIQCDDKHLLTKIVHFLKYNSFTFPYIPKYREAAATFNEDGISLTSDFLSHTCT
FT                   IETAKLIFKEGKILSAVKAFNKPAEVLVNDKRNAAGDPKDYFDYVMLNWSNTNSGYRLV
FT                   MERLLGKAPSEQELTVAFKPGVSFHFNYQDIINHPDSIFDGYHPAKIKNQLSLAEHLVA
FT                   CVIPKHYQEDYQSLVPNDLKHRVYYLDYCNETLYEWNQKVYDFLCHLENK"
FT   gene            complement(761245..762129)
FT                   /locus_tag="SAK_0819"
FT   CDS_pept        complement(761245..762129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0819"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45189"
FT                   /protein_id="ABA45189.1"
FT                   /translation="MDIRQLTYFIAVAEAKNYSHAAKSLFVTQPTLSQSIKKLEAELNT
FT                   ILFLQNGRQLALTEAGEILYEKGQLLMTNFNQMVTEIQQLNQEKKEGIRVGLTSLFAIQ
FT                   FMKQISTFMATHSNVEVSLIQDGSRKLQELLAKGKIDIGLLSFPSTRNDITIEPLQTST
FT                   KGYKVSIVMPKSHPLATLPEIELNDLRDYKVASLNEHYMLGEMLPRKCRALGFDPHIVF
FT                   KHNDWEVLIHSLQDLNAVTILPSEFESISQVQDLCWVPLKDKNNFYPIGIAYRNDTSFS
FT                   PMIEEFLSLLKTN"
FT   gene            762322..763380
FT                   /locus_tag="SAK_0820"
FT   CDS_pept        762322..763380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0820"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45502"
FT                   /protein_id="ABA45502.1"
FT                   /translation="MSDVVEKQTAKSFIMNVLNGLALGTVIVLIPGAILGELMKALLPM
FT                   WSGFATLIAATAVATSMMGLVIGIMVGLNFKFNPIQSASLGLAVMFAGGAATFLKGAIM
FT                   LKGTGDIINMGITAALGVLLIQFLSDKTKSFTLIVIPTVTLLLVGGVGHVLLPYVKMIT
FT                   TMIGQGIASLLGLQPVLMSILIAMIFCFLIVSPITTVGIALAISLSGIGSGAANLGICA
FT                   ASFGLCMAGWSVNSKGTALAHVLGSPKISMANVLAKPKIMLPMISSAAILGILGALFNI
FT                   QGTPASAGFGISGLIGPINALNLAKGGWSVMNMLLIIIIFVAAPIILNFIFNYLFIKVL
FT                   KIIDPMDYKLDI"
FT   gene            763394..764386
FT                   /gene="ldhA"
FT                   /locus_tag="SAK_0821"
FT   CDS_pept        763394..764386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="SAK_0821"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /note="identified by similarity to SP:P26298; match to
FT                   protein family HMM PF00389; match to protein family HMM
FT                   PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44449"
FT                   /protein_id="ABA44449.1"
FT                   /translation="MKLKVFNVREEEATLAQDWANRNHVELSMSEGPLTLETVNEVEGF
FT                   DGIANAQIGPLDDAIYPLLKEMGIKQIAQRSAGVDMYNLELAKQHGIIISNVPSYSPES
FT                   IAEFTVTIALNLIRKVELIRANVREQNFSWTLPIRGRVLGNMTVAIIGTGRIGLATAKI
FT                   FKGFGCRVIGYDIYHNPMADGILEYVNSVEEAVEKADLVSLHMPPTAENTHLFNLDMFK
FT                   QFKKGAILMNMARGALVETKDLLEALDQGLLEGAGIDTYEFEGPYIPKNCQGQDISDKD
FT                   FLRLINHPKVIYTPHAAYYTDEAVKNLVEGALNACVEVVETGTTTTRVN"
FT   gene            764592..766142
FT                   /locus_tag="SAK_0822"
FT   CDS_pept        764592..766142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0822"
FT                   /product="sugar transporter, putative"
FT                   /note="identified by similarity to GB:AAD11508.1"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45774"
FT                   /protein_id="ABA45774.1"
FT                   /translation="MEKTMDMEQREEVVSYNRAKVWQLVMFAMNNASTNIYLFTFMFVT
FT                   YFSTGVLGLAAIFVSQIMGYIRIFDGFIDPAIGIMIDKTDTKFGKYRPILIIGNVITAL
FT                   SLIFLLALRGVDENIRFLLFVLVLIIHKIGYSMQQTITKAGQTALTNDPKQRPIFNIVD
FT                   AVMTTSLMTGGQFVVSGFLVPKFGNFTPQFFNVLIFGTILISAILAIVAIIGIWAKDRK
FT                   EFFGLGENTQKTALKDYWKVLKGNKPLQILSIAAALVKFAIQFFGDSVVMVLLFGILFG
FT                   NYALSGQFSLLFIVPGVIINILFSTIARKKGLRFSYVRAIQIGMIGLLAFGAVLYVGKP
FT                   GDLSLTSLNLYTILFIVTNIIARYASQAPASLVLTMGADISDYETSESGRYVSGMIGTI
FT                   FSLTDSIASSFAPMVVGFVLAGIGFSKSFPTIETPLTPDLKMAAISLLVAIPFIALSIA
FT                   LLLIKFYKLDKEEMVRIQEKIQVMKAATTKERAKDIARNVPLTDMDYVDVTKYPIDKD"
FT   gene            766209..767234
FT                   /locus_tag="SAK_0823"
FT   CDS_pept        766209..767234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0823"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44809"
FT                   /protein_id="ABA44809.1"
FT                   /translation="MAKIISLGEVLLRLSPPQYHTLMQANHLKCQFGGSELNVLASLAQ
FT                   LGHHVGLVSALPDNDLGKMARQFILSQQISPAAIIKKEGRLGIYYYEQGFSVRTNKVIY
FT                   DRNYSSFWESTLSDYDFTSIFKGVDWFHVSGITPALTKDLYEVTRFLMTKAKEGGVKVS
FT                   IDLNFRESLWSSFQEAREQLSPLLGLSDVCFGLEPIYLAGESEDLKDELGLSRPYLDIE
FT                   LLEKITQKIVQEYGLDYIAFTQREMGYTNQYMLKSYLYHNNMLYQTDKTGVEVLDRVGT
FT                   GDAFAAGLIHALLEKETPQRALEIAMTTFKYKHTIQGDINIMTRDDIAYLIEKETNDIK
FT                   R"
FT   gene            767251..769050
FT                   /locus_tag="SAK_0824"
FT   CDS_pept        767251..769050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0824"
FT                   /product="beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="identified by similarity to SP:P05804; match to
FT                   protein family HMM PF00703; match to protein family HMM
FT                   PF02836; match to protein family HMM PF02837"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ABA46008"
FT                   /protein_id="ABA46008.1"
FT                   /translation="MLYPLLTKTRNTYDLGGIWNFKLGEHNPNELLPSDEVMVIPTSFN
FT                   DLMVSKEKRDYIGDFWYEKVIEVPKVSEGEEMVLRFGSVTHQAKIYVDGILVGEHKGGF
FT                   TPFEVLVPECKYNNEKIKVSICANNVLDYTTLPVGNYSEIIQEDGSIKKKVRENFDFFN
FT                   YAGVHRPLKLMIRPKNHISDITITSRLSDDLQSADLHFLVETNQKVDEVRISVFDEDNK
FT                   LVGETKDSRLFLSDVHLWEVLNAYLYTARVEIFVDNQLQDVYEENFGLREIEETNGQFL
FT                   LNRKPIYFKGFGKHEDTFINGRGLNEAANLMDLNLLKDIGANSFRTSHYPYSEEMMRLA
FT                   DRMGVLVIDEVPAVGLFQNFNASLDLSPKDNGTWSLMQTKAAHEQAIQELVKRDKNHPS
FT                   VVMWVVANEPASHEAGAHDYFEPLVKLYKDLDPQKRPVTLVNILMATPDRDQVMDLVDV
FT                   VCLNRYYGWYVDHGDLTNAEVGLRKELLEWQDKFPDKPIIITEYGADTLPGLHSTWNIP
FT                   YTEEFQCDFYEMSHRVFDGIPNLVGEQVWNFADFETNLMILRVQGNHKGLFSRNRQPKQ
FT                   VVKEFKKRWMTIPHYHNKKNSVK"
FT   gene            769079..769750
FT                   /locus_tag="SAK_0825"
FT   CDS_pept        769079..769750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAK_0825"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44822"
FT                   /protein_id="ABA44822.1"
FT                   /translation="MARPLVEQTADRLLHLILEREYPVGAKLPNEYELAEDLDVGRSTI
FT                   REAVRSLATRNILEVRQGSGTYISSKKGVSEDPLGFSLIKDTDRLTSDLFELRLLLEPR
FT                   IAELVAYRITDDQLQLLEKLVGDIEDAVHAGDPKHLLLDVEFHSMLAKYSGNIAMDSLL
FT                   PVINQSIHLINANYTNRQMKSDSLEAHREIIKAIREKNPVAAHDAMLMHIMSVRRSALK
FT                   A"
FT   gene            769867..770484
FT                   /gene="eda"
FT                   /locus_tag="SAK_0826"
FT   CDS_pept        769867..770484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="SAK_0826"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45517"
FT                   /protein_id="ABA45517.1"
FT                   /translation="MLNQLKNNYFFAVIRGKSSEDALEIAKHAILGGIRNIEVTFSTPE
FT                   ASKVIKQLSDDFKNNKEIIVGAGTVMTTELAKEAIDAGAKFLVSPHFDSDIANLANENK
FT                   VYYFPGCATATEIVVARKYKCQIIKLFPGGVVGPGFIKDIHGPIPDVDLMPSGGVSVSN
FT                   VAEWRKAGAVAVGVGSALSSKVATEGYDSVTKIAKQFVSALN"
FT   gene            770501..771901
FT                   /gene="uxaC"
FT                   /locus_tag="SAK_0827"
FT   CDS_pept        770501..771901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="SAK_0827"
FT                   /product="glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="identified by similarity to SP:P42607; match to
FT                   protein family HMM PF02614"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ABA44392"
FT                   /db_xref="GOA:Q3K204"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K204"
FT                   /protein_id="ABA44392.1"
FT                   /translation="MTFNTETFMLKNQAALQLYEEVKRQPIFDYHCHLDPKDIFEDRIF
FT                   DNIVDLWLGGDHYKWRLMRANGISEAEITGPASNLEKFKAFARTLERAYGNPVYHWSAM
FT                   ELKNVFGVNEILTESNAEEIYHRLNHFLKEHKINPRRLIADSKVMFIGTTDHPLDTLEW
FT                   HKKLAADESFKTVVAPTFRPDEAFIEHRHFVDFITKLGDITQKEITDFSTFIAAMEERI
FT                   AYFAQNGCRASDISFTEIVFEQTDELELNDLFNKVCEGYIPNQSEISKWQTAVFMELCR
FT                   LYKKYGFVTQVHFGALRNNHSTIFEKLGADVGVDSLGDQVALTVNMNSLLDSLVKKDSL
FT                   PKMIWYNLNPAYNIAVANTLANFQANELGVRSYLQFGAGWWFADTKLGMISQMNALAEQ
FT                   GMLANFIGMLTDSRSFLSYQRHDYFRRILCTYLGEWIEEGEVPEDYQALGSMAKDIAYQ
FT                   NAVNYFKN"
FT   gene            771919..772965
FT                   /gene="uxuA"
FT                   /locus_tag="SAK_0828"
FT   CDS_pept        771919..772965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="SAK_0828"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="identified by match to protein family HMM PF03786;
FT                   match to protein family HMM TIGR00695"
FT                   /db_xref="EnsemblGenomes-Gn:SAK_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ABA45816"
FT                   /db_xref="GOA:Q3K203"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3K203"
FT                   /protein_id="ABA45816.1"
FT                   /translation="MEMSFRWYGEDDPVTLENIGQIPTMKGIVTAIYDVPVGEVWSRER
FT                   IQQLKEKVEAAGLKISVIESVPVHEDIKLGRPTRDLLIDNYIQTVKNLAAEGIDTICYN
FT                   FMPVFDWTRTDLAYQYPDGSTALIFDETVSKKMDPVNGELSLPGWDASYSKEEMKAIMD
FT                   AYAEIDEEKLWENLTYFIKRIIPEAEAVGVKMAIHPDDPPYSIFGLPRIITGLEAIERF
FT