(data stored in SCRATCH9089 zone)

EMBL: CP000124

ID   CP000124; SV 1; circular; genomic DNA; STD; PRO; 4126292 BP.
XX
AC   CP000124; AAHT01000000-AAHT01000077;
XX
PR   Project:PRJNA13954;
XX
DT   03-OCT-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Burkholderia pseudomallei 1710b chromosome I, complete sequence.
XX
KW   .
XX
OS   Burkholderia pseudomallei 1710b
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-4126292
RA   Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (28-SEP-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 4f57cd2f6e2e65cd4d07bae71d087eda.
DR   BioSample; SAMN02604036.
DR   EnsemblGenomes-Gn; BURPS1710b_0001.
DR   EnsemblGenomes-Gn; BURPS1710b_0002.
DR   EnsemblGenomes-Gn; BURPS1710b_0003.
DR   EnsemblGenomes-Gn; BURPS1710b_0004.
DR   EnsemblGenomes-Gn; BURPS1710b_0005.
DR   EnsemblGenomes-Gn; BURPS1710b_0037.
DR   EnsemblGenomes-Gn; BURPS1710b_0119.
DR   EnsemblGenomes-Gn; BURPS1710b_0338.
DR   EnsemblGenomes-Gn; BURPS1710b_0354.
DR   EnsemblGenomes-Gn; BURPS1710b_0754.
DR   EnsemblGenomes-Gn; BURPS1710b_0968.
DR   EnsemblGenomes-Gn; BURPS1710b_1164.
DR   EnsemblGenomes-Gn; BURPS1710b_1291.
DR   EnsemblGenomes-Gn; BURPS1710b_1434.
DR   EnsemblGenomes-Gn; BURPS1710b_1473.
DR   EnsemblGenomes-Gn; BURPS1710b_1474.
DR   EnsemblGenomes-Gn; BURPS1710b_1475.
DR   EnsemblGenomes-Gn; BURPS1710b_1476.
DR   EnsemblGenomes-Gn; BURPS1710b_1477.
DR   EnsemblGenomes-Gn; BURPS1710b_1654.
DR   EnsemblGenomes-Gn; BURPS1710b_1702.
DR   EnsemblGenomes-Gn; BURPS1710b_1714.
DR   EnsemblGenomes-Gn; BURPS1710b_1888.
DR   EnsemblGenomes-Gn; BURPS1710b_1901.
DR   EnsemblGenomes-Gn; BURPS1710b_1968.
DR   EnsemblGenomes-Gn; BURPS1710b_1969.
DR   EnsemblGenomes-Gn; BURPS1710b_1982.
DR   EnsemblGenomes-Gn; BURPS1710b_1995.
DR   EnsemblGenomes-Gn; BURPS1710b_2471.
DR   EnsemblGenomes-Gn; BURPS1710b_2476.
DR   EnsemblGenomes-Gn; BURPS1710b_2501.
DR   EnsemblGenomes-Gn; BURPS1710b_2621.
DR   EnsemblGenomes-Gn; BURPS1710b_2622.
DR   EnsemblGenomes-Gn; BURPS1710b_2623.
DR   EnsemblGenomes-Gn; BURPS1710b_2624.
DR   EnsemblGenomes-Gn; BURPS1710b_2625.
DR   EnsemblGenomes-Gn; BURPS1710b_2675.
DR   EnsemblGenomes-Gn; BURPS1710b_2752.
DR   EnsemblGenomes-Gn; BURPS1710b_2783.
DR   EnsemblGenomes-Gn; BURPS1710b_2880.
DR   EnsemblGenomes-Gn; BURPS1710b_2881.
DR   EnsemblGenomes-Gn; BURPS1710b_2882.
DR   EnsemblGenomes-Gn; BURPS1710b_2933.
DR   EnsemblGenomes-Gn; BURPS1710b_2934.
DR   EnsemblGenomes-Gn; BURPS1710b_3032.
DR   EnsemblGenomes-Gn; BURPS1710b_3045.
DR   EnsemblGenomes-Gn; BURPS1710b_3046.
DR   EnsemblGenomes-Gn; BURPS1710b_3054.
DR   EnsemblGenomes-Gn; BURPS1710b_3071.
DR   EnsemblGenomes-Gn; BURPS1710b_3118.
DR   EnsemblGenomes-Gn; BURPS1710b_3259.
DR   EnsemblGenomes-Gn; BURPS1710b_3525.
DR   EnsemblGenomes-Gn; BURPS1710b_3558.
DR   EnsemblGenomes-Gn; BURPS1710b_3559.
DR   EnsemblGenomes-Gn; BURPS1710b_3560.
DR   EnsemblGenomes-Gn; BURPS1710b_3561.
DR   EnsemblGenomes-Gn; BURPS1710b_3562.
DR   EnsemblGenomes-Gn; BURPS1710b_3670.
DR   EnsemblGenomes-Gn; BURPS1710b_3793.
DR   EnsemblGenomes-Gn; BURPS1710b_3795.
DR   EnsemblGenomes-Gn; BURPS1710b_3796.
DR   EnsemblGenomes-Gn; BURPS1710b_3797.
DR   EnsemblGenomes-Gn; EBG00001177325.
DR   EnsemblGenomes-Gn; EBG00001177326.
DR   EnsemblGenomes-Gn; EBG00001177327.
DR   EnsemblGenomes-Gn; EBG00001177328.
DR   EnsemblGenomes-Gn; EBG00001177329.
DR   EnsemblGenomes-Gn; EBG00001177330.
DR   EnsemblGenomes-Gn; EBG00001177331.
DR   EnsemblGenomes-Gn; EBG00001177332.
DR   EnsemblGenomes-Gn; EBG00001177333.
DR   EnsemblGenomes-Gn; EBG00001177334.
DR   EnsemblGenomes-Gn; EBG00001177335.
DR   EnsemblGenomes-Gn; EBG00001177336.
DR   EnsemblGenomes-Gn; EBG00001177337.
DR   EnsemblGenomes-Gn; EBG00001177338.
DR   EnsemblGenomes-Gn; EBG00001177339.
DR   EnsemblGenomes-Gn; EBG00001177340.
DR   EnsemblGenomes-Gn; EBG00001177341.
DR   EnsemblGenomes-Gn; EBG00001177342.
DR   EnsemblGenomes-Gn; EBG00001177343.
DR   EnsemblGenomes-Gn; EBG00001177344.
DR   EnsemblGenomes-Gn; EBG00001177345.
DR   EnsemblGenomes-Gn; EBG00001177346.
DR   EnsemblGenomes-Gn; EBG00001177347.
DR   EnsemblGenomes-Gn; EBG00001177348.
DR   EnsemblGenomes-Gn; EBG00001177349.
DR   EnsemblGenomes-Gn; EBG00001177350.
DR   EnsemblGenomes-Gn; EBG00001177351.
DR   EnsemblGenomes-Gn; EBG00001177352.
DR   EnsemblGenomes-Gn; EBG00001177353.
DR   EnsemblGenomes-Gn; EBG00001177354.
DR   EnsemblGenomes-Gn; EBG00001177355.
DR   EnsemblGenomes-Gn; EBG00001177356.
DR   EnsemblGenomes-Gn; EBG00001177357.
DR   EnsemblGenomes-Gn; EBG00001177358.
DR   EnsemblGenomes-Gn; EBG00001177359.
DR   EnsemblGenomes-Gn; EBG00001177360.
DR   EnsemblGenomes-Gn; EBG00001177361.
DR   EnsemblGenomes-Gn; EBG00001177362.
DR   EnsemblGenomes-Gn; EBG00001177363.
DR   EnsemblGenomes-Gn; EBG00001177364.
DR   EnsemblGenomes-Gn; EBG00001177365.
DR   EnsemblGenomes-Gn; EBG00001177366.
DR   EnsemblGenomes-Gn; EBG00001177367.
DR   EnsemblGenomes-Gn; EBG00001177368.
DR   EnsemblGenomes-Gn; EBG00001177369.
DR   EnsemblGenomes-Gn; EBG00001177370.
DR   EnsemblGenomes-Gn; EBG00001177371.
DR   EnsemblGenomes-Gn; EBG00001177372.
DR   EnsemblGenomes-Gn; EBG00001177373.
DR   EnsemblGenomes-Gn; EBG00001177374.
DR   EnsemblGenomes-Gn; EBG00001177375.
DR   EnsemblGenomes-Gn; EBG00001177376.
DR   EnsemblGenomes-Gn; EBG00001177377.
DR   EnsemblGenomes-Gn; EBG00001177378.
DR   EnsemblGenomes-Gn; EBG00001177379.
DR   EnsemblGenomes-Gn; EBG00001177380.
DR   EnsemblGenomes-Gn; EBG00001177381.
DR   EnsemblGenomes-Gn; EBG00001177382.
DR   EnsemblGenomes-Gn; EBG00001177383.
DR   EnsemblGenomes-Gn; EBG00001177384.
DR   EnsemblGenomes-Gn; EBG00001177385.
DR   EnsemblGenomes-Gn; EBG00001177386.
DR   EnsemblGenomes-Gn; EBG00001177387.
DR   EnsemblGenomes-Gn; EBG00001177388.
DR   EnsemblGenomes-Gn; EBG00001177389.
DR   EnsemblGenomes-Gn; EBG00001177390.
DR   EnsemblGenomes-Gn; EBG00001177391.
DR   EnsemblGenomes-Gn; EBG00001177392.
DR   EnsemblGenomes-Gn; EBG00001177393.
DR   EnsemblGenomes-Gn; EBG00001177394.
DR   EnsemblGenomes-Gn; EBG00001177395.
DR   EnsemblGenomes-Gn; EBG00001177396.
DR   EnsemblGenomes-Gn; EBG00001177397.
DR   EnsemblGenomes-Gn; EBG00001177398.
DR   EnsemblGenomes-Gn; EBG00001177399.
DR   EnsemblGenomes-Gn; EBG00001177400.
DR   EnsemblGenomes-Gn; EBG00001177401.
DR   EnsemblGenomes-Gn; EBG00001177402.
DR   EnsemblGenomes-Gn; EBG00001177403.
DR   EnsemblGenomes-Gn; EBG00001177404.
DR   EnsemblGenomes-Gn; EBG00001177405.
DR   EnsemblGenomes-Gn; EBG00001177406.
DR   EnsemblGenomes-Gn; EBG00001177407.
DR   EnsemblGenomes-Gn; EBG00001177408.
DR   EnsemblGenomes-Tr; BURPS1710b_0001-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0002-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0003-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0004-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0005-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0037-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0119-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0338-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0354-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0754-1.
DR   EnsemblGenomes-Tr; BURPS1710b_0968-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1164-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1291-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1434-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1473-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1474-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1475-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1476-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1477-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1654-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1702-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1714-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1888-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1901-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1968-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1969-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1982-1.
DR   EnsemblGenomes-Tr; BURPS1710b_1995-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2471-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2476-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2501-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2621-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2622-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2623-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2624-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2625-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2675-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2752-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2783-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2880-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2881-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2882-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2933-1.
DR   EnsemblGenomes-Tr; BURPS1710b_2934-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3032-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3045-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3046-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3054-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3071-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3118-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3259-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3525-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3558-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3559-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3560-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3561-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3562-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3670-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3793-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3795-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3796-1.
DR   EnsemblGenomes-Tr; BURPS1710b_3797-1.
DR   EnsemblGenomes-Tr; EBT00001756046.
DR   EnsemblGenomes-Tr; EBT00001756047.
DR   EnsemblGenomes-Tr; EBT00001756048.
DR   EnsemblGenomes-Tr; EBT00001756049.
DR   EnsemblGenomes-Tr; EBT00001756050.
DR   EnsemblGenomes-Tr; EBT00001756051.
DR   EnsemblGenomes-Tr; EBT00001756052.
DR   EnsemblGenomes-Tr; EBT00001756053.
DR   EnsemblGenomes-Tr; EBT00001756054.
DR   EnsemblGenomes-Tr; EBT00001756055.
DR   EnsemblGenomes-Tr; EBT00001756056.
DR   EnsemblGenomes-Tr; EBT00001756057.
DR   EnsemblGenomes-Tr; EBT00001756058.
DR   EnsemblGenomes-Tr; EBT00001756059.
DR   EnsemblGenomes-Tr; EBT00001756060.
DR   EnsemblGenomes-Tr; EBT00001756061.
DR   EnsemblGenomes-Tr; EBT00001756062.
DR   EnsemblGenomes-Tr; EBT00001756063.
DR   EnsemblGenomes-Tr; EBT00001756064.
DR   EnsemblGenomes-Tr; EBT00001756065.
DR   EnsemblGenomes-Tr; EBT00001756066.
DR   EnsemblGenomes-Tr; EBT00001756067.
DR   EnsemblGenomes-Tr; EBT00001756068.
DR   EnsemblGenomes-Tr; EBT00001756069.
DR   EnsemblGenomes-Tr; EBT00001756070.
DR   EnsemblGenomes-Tr; EBT00001756071.
DR   EnsemblGenomes-Tr; EBT00001756072.
DR   EnsemblGenomes-Tr; EBT00001756073.
DR   EnsemblGenomes-Tr; EBT00001756074.
DR   EnsemblGenomes-Tr; EBT00001756075.
DR   EnsemblGenomes-Tr; EBT00001756076.
DR   EnsemblGenomes-Tr; EBT00001756077.
DR   EnsemblGenomes-Tr; EBT00001756078.
DR   EnsemblGenomes-Tr; EBT00001756079.
DR   EnsemblGenomes-Tr; EBT00001756080.
DR   EnsemblGenomes-Tr; EBT00001756081.
DR   EnsemblGenomes-Tr; EBT00001756082.
DR   EnsemblGenomes-Tr; EBT00001756083.
DR   EnsemblGenomes-Tr; EBT00001756084.
DR   EnsemblGenomes-Tr; EBT00001756085.
DR   EnsemblGenomes-Tr; EBT00001756086.
DR   EnsemblGenomes-Tr; EBT00001756087.
DR   EnsemblGenomes-Tr; EBT00001756088.
DR   EnsemblGenomes-Tr; EBT00001756089.
DR   EnsemblGenomes-Tr; EBT00001756090.
DR   EnsemblGenomes-Tr; EBT00001756091.
DR   EnsemblGenomes-Tr; EBT00001756092.
DR   EnsemblGenomes-Tr; EBT00001756093.
DR   EnsemblGenomes-Tr; EBT00001756094.
DR   EnsemblGenomes-Tr; EBT00001756095.
DR   EnsemblGenomes-Tr; EBT00001756096.
DR   EnsemblGenomes-Tr; EBT00001756097.
DR   EnsemblGenomes-Tr; EBT00001756098.
DR   EnsemblGenomes-Tr; EBT00001756099.
DR   EnsemblGenomes-Tr; EBT00001756100.
DR   EnsemblGenomes-Tr; EBT00001756101.
DR   EnsemblGenomes-Tr; EBT00001756102.
DR   EnsemblGenomes-Tr; EBT00001756103.
DR   EnsemblGenomes-Tr; EBT00001756104.
DR   EnsemblGenomes-Tr; EBT00001756105.
DR   EnsemblGenomes-Tr; EBT00001756106.
DR   EnsemblGenomes-Tr; EBT00001756107.
DR   EnsemblGenomes-Tr; EBT00001756108.
DR   EnsemblGenomes-Tr; EBT00001756109.
DR   EnsemblGenomes-Tr; EBT00001756110.
DR   EnsemblGenomes-Tr; EBT00001756111.
DR   EnsemblGenomes-Tr; EBT00001756112.
DR   EnsemblGenomes-Tr; EBT00001756113.
DR   EnsemblGenomes-Tr; EBT00001756114.
DR   EnsemblGenomes-Tr; EBT00001756115.
DR   EnsemblGenomes-Tr; EBT00001756116.
DR   EnsemblGenomes-Tr; EBT00001756117.
DR   EnsemblGenomes-Tr; EBT00001756118.
DR   EnsemblGenomes-Tr; EBT00001756119.
DR   EnsemblGenomes-Tr; EBT00001756120.
DR   EnsemblGenomes-Tr; EBT00001756121.
DR   EnsemblGenomes-Tr; EBT00001756122.
DR   EnsemblGenomes-Tr; EBT00001756123.
DR   EnsemblGenomes-Tr; EBT00001756124.
DR   EnsemblGenomes-Tr; EBT00001756125.
DR   EnsemblGenomes-Tr; EBT00001756126.
DR   EnsemblGenomes-Tr; EBT00001756127.
DR   EnsemblGenomes-Tr; EBT00001756128.
DR   EnsemblGenomes-Tr; EBT00001756129.
DR   EuropePMC; PMC1855645; 17293531.
DR   EuropePMC; PMC2386483; 18439288.
DR   EuropePMC; PMC2612426; 18952798.
DR   EuropePMC; PMC2798625; 19880651.
DR   EuropePMC; PMC3515745; 23227305.
DR   EuropePMC; PMC3680066; 23682954.
DR   EuropePMC; PMC4029289; 24883196.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000124.
DR   SILVA-SSU; CP000124.
XX
CC   Source DNA and bacteria available from Don Woods
CC   (woods@ucalgary.ca).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4126292
FT                   /organism="Burkholderia pseudomallei 1710b"
FT                   /chromosome="I"
FT                   /strain="1710b"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:320372"
FT   gene            complement(533..648)
FT                   /gene="rrfA"
FT                   /locus_tag="BURPS1710b_0001"
FT   rRNA            complement(533..648)
FT                   /gene="rrfA"
FT                   /locus_tag="BURPS1710b_0001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(830..3711)
FT                   /gene="rrlA"
FT                   /locus_tag="BURPS1710b_0002"
FT   rRNA            complement(830..3711)
FT                   /gene="rrlA"
FT                   /locus_tag="BURPS1710b_0002"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(4065..4140)
FT                   /locus_tag="BURPS1710b_0003"
FT   tRNA            complement(4065..4140)
FT                   /locus_tag="BURPS1710b_0003"
FT                   /product="tRNA-Ala"
FT   gene            complement(4175..4251)
FT                   /locus_tag="BURPS1710b_0004"
FT   tRNA            complement(4175..4251)
FT                   /locus_tag="BURPS1710b_0004"
FT                   /product="tRNA-Ile"
FT   gene            complement(4334..5821)
FT                   /gene="rrsA"
FT                   /locus_tag="BURPS1710b_0005"
FT   rRNA            complement(4334..5821)
FT                   /gene="rrsA"
FT                   /locus_tag="BURPS1710b_0005"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(6370..7647)
FT                   /locus_tag="BURPS1710b_0006"
FT   CDS_pept        complement(6370..7647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0006"
FT                   /product="lipase/acylhydrolase, putative"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50064"
FT                   /db_xref="GOA:Q3JYC9"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC9"
FT                   /protein_id="ABA50064.1"
FT                   /translation="MTSRRWFSALSCCLALAASQPGSAAQADAPARWVASWATALQPIP
FT                   DLAAPPPLYRAPDVAGRTVRQIVYPTLAGKAVRIRVSNAYGKTPLAIGEMNIGRSAGGA
FT                   AVAAGSSTAVTFGGRRETEVPPGQERDSDPVAYDVRAGEPYALSLYLGSRQTMTVWHRV
FT                   SNQVNYVSAPGNHTGDASPDAFRTRFTQSAWIAELAVEVQQPGAAAIAAVGDSITDGLR
FT                   SSLNRNRRWPDALAARLERAGAGDIGVANLGISGNRLLSDSRCYGIALERRFERDVLTR
FT                   AGVKVAVLLIGINDINFAAMPARSGLDCDAPHTRVDAQALIAGYRRVIAAAHARGVAVF
FT                   GATLTPASLPPAREAIRREVNEWIRTSGAFDGVVDFDAALRDPAKPSTLLRRYNSGDDI
FT                   HPSDAGYAAMAEAVPLERLAAAAGRR"
FT   gene            8346..9344
FT                   /gene="paaG"
FT                   /locus_tag="BURPS1710b_0007"
FT   CDS_pept        8346..9344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BURPS1710b_0007"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="identified by match to protein family HMM PF05138;
FT                   match to protein family HMM TIGR02156"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49021"
FT                   /db_xref="GOA:Q3JYC8"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC8"
FT                   /protein_id="ABA49021.1"
FT                   /translation="MYTQSLDIPGNIAPIDAAADSPEQAGFDAAIAADGKIEPQDWMPD
FT                   AYRKTLVRQISQHAHSEVVGMLPEGNWITRAPSLKRKAILLAKVQDEAGHGLYLYSAAE
FT                   TLGVSRDALIDALHAGKAKYSSIFNYPTLTWADVGVIGWLVDGAAIMNQVPLCRCTYGP
FT                   YARAMIRVCKEESFHQRQGFDALLAMMKGTDAQRAMVQEAVDRWWWPVLMMFGPPDADS
FT                   VHSNQSAKWGIKRISNDDLRQKFVDATVEQAKVLGVTLPDPDLKWNDARGHFDYGALDW
FT                   DEFWRVVNGDGPCNKERLATRVKAHENGAWVRDAALAHEEKRRRRAQQQAA"
FT   gene            8747..9691
FT                   /gene="paaB"
FT                   /locus_tag="BURPS1710b_0008"
FT   CDS_pept        8747..9691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaB"
FT                   /locus_tag="BURPS1710b_0008"
FT                   /product="phenylacetic acid degradation protein PaaB"
FT                   /note="identified by match to protein family HMM PF06243;
FT                   match to protein family HMM TIGR02157"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47972"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC7"
FT                   /protein_id="ABA47972.1"
FT                   /translation="MGGCRRDRLARRRRGDHEPGSALPLHVRPVCARDDPRLQGGIVPS
FT                   AARLRRAARDDEGHRRAARDGPGSRGPLVVARADDVRAARRRFRAQQPVGQMGDQADFE
FT                   RRPAAEIRRRDGRAGEGARRHAARSGPQVERRPRPFRLRRARLGRILARRQRRRPVQQG
FT                   APRDPREGSRKRRVGSRRRARARGKAPPSRAATSGLTGMTRGKRGAAIRIQEIQEKAMN
FT                   NEWPIWEVFVRSKQGLDHKHCGSLHAADASMALRMARDVYTRRREGVSIWVVPSAAITA
FT                   SDPNEKAEMFEPAGDKIYRHPTFYTLPDEVNHM"
FT   gene            9702..10505
FT                   /gene="paaI"
FT                   /locus_tag="BURPS1710b_0009"
FT   CDS_pept        9702..10505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaI"
FT                   /locus_tag="BURPS1710b_0009"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="identified by match to protein family HMM PF05138;
FT                   match to protein family HMM TIGR02158"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50324"
FT                   /db_xref="GOA:Q3JYC6"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC6"
FT                   /protein_id="ABA50324.1"
FT                   /translation="MTTTPQHLAYVLRLADNALILGQRNAEWCGHGPVLEEDIALTNMS
FT                   LDLIGQARLLYTHAAELERRLTGAARTEDDYAYFRAEREFANYTFVELPHYGPLCGTAH
FT                   AELDYAVTVVRNFLYSTLMLHLWTALEASGDAQLAAIAAKSVKETRYHEHHAREWLIRF
FT                   GDGTDESHRRAQAALDHLMPYTREFFATDAIDDAAAAAGIGPAIASIEPAWRADIEAAL
FT                   AEATLALPTAGQYVPTGKRGEHSEHMGYLLAELQSIARQHPGATW"
FT   gene            10541..11161
FT                   /gene="paaD"
FT                   /locus_tag="BURPS1710b_0010"
FT   CDS_pept        10541..11161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaD"
FT                   /locus_tag="BURPS1710b_0010"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="identified by match to protein family HMM PF01883;
FT                   match to protein family HMM TIGR02159"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49740"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC5"
FT                   /protein_id="ABA49740.1"
FT                   /translation="MPTFPASALGQPTAADAREGRRPVTGRAAAPGDDPLVERAWSALE
FT                   AVPDPEIPIVSIRELGILRDVRRASDGALEVVITPTYSGCPAMQQIAEDIGAALRQAGI
FT                   APHRIATVLAPAWTTDWITADAREKLRAYGIAPPVGQCGEARGAHAAAPRVVRFMPKPP
FT                   AAPLCPRCGSAHTERLAQFASTACKALYRCLDCREPFDYFKPY"
FT   gene            11163..12251
FT                   /gene="paaK"
FT                   /locus_tag="BURPS1710b_0011"
FT   CDS_pept        11163..12251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="BURPS1710b_0011"
FT                   /product="phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970; match to protein family HMM TIGR02160"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48252"
FT                   /db_xref="GOA:Q3JYC4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC4"
FT                   /protein_id="ABA48252.1"
FT                   /translation="MATPQFHPLRIRDVRPETADAVTVSFEVPPELRDAYRFTQGQFVT
FT                   LKAHVDGEETRRSYSICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDTLKPGHTIDVMT
FT                   PDGRFFTHLNAGHGKQYVAFAGGSGITPVLAIVKTTLELEPRSTFTLIYGNRSVDSIMF
FT                   AEELEDLKNRFMQRLALYHVLSDDVQDVELFNGVLDQAKCAAFLDSLVPAATIDEAFIC
FT                   GPAPMMDAAEAALAAAGVPRERVHVERFGTPLPQAGAPAVEITADTPAADLEIVLDGKK
FT                   RKLRLPYEGASLLDVGLRAGLALPYACKGGVCCTCRAKVLEGEVRMEKNYTLEPQEIAD
FT                   GFVLTCQCHPVSEKIVVSYDER"
FT   gene            12373..13203
FT                   /locus_tag="BURPS1710b_0012"
FT   CDS_pept        12373..13203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47676"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC3"
FT                   /protein_id="ABA47676.1"
FT                   /translation="MSTIHVTMGGSAAASLRIALADAGRDEGVVELFDDLSVGPLRGAD
FT                   DSPDVRAAFWERAIGDVQQDWTAGLGGDFAKLETLAADTGQVVVWHAQSVADQLMLRRV
FT                   AYHLRNAPQRLNEVRLSSADIDDPQSWVRLRADQATATGIFSSAQLRAKLPEAAPISVL
FT                   RISRLALEWQEAKQANAELRYWICNTFKSGHYADIDALVLEHAPDEWGPAARTIGAVMA
FT                   FADRGHLFVGDVIAFWRCRELAAAGRIELQGDARSIDDLRTATLRATPAVALPR"
FT   gene            13230..13829
FT                   /gene="paaR"
FT                   /locus_tag="BURPS1710b_0013"
FT   CDS_pept        13230..13829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaR"
FT                   /locus_tag="BURPS1710b_0013"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49986"
FT                   /db_xref="GOA:Q3JYC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC2"
FT                   /protein_id="ABA49986.1"
FT                   /translation="MARTRAPDHESQREQILDLAAAKFAQTSYPSTSMTDLANASGTSK
FT                   ARLYHYYEGKEAILFDLLDRYTKRLMLIIAEVEGASQRRGLTEREAFAELVRAFLAEYE
FT                   TSHSRHVALLNDVKYLEDTQRQIVLDRQRDIVAAFARQLARAYPERISKDNQTPVTMMV
FT                   FGMINWTFTWLKPGGRLGYRDFAEQVIGMIEHGLGG"
FT   gene            13951..14718
FT                   /locus_tag="BURPS1710b_0014"
FT   CDS_pept        13951..14718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0014"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48933"
FT                   /db_xref="GOA:Q3JYC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC1"
FT                   /protein_id="ABA48933.1"
FT                   /translation="MTLELDLDLRIRVFPNLRTAVRLKLRCNAQPLYGLFEEPTMNKPD
FT                   LRPAESVGIAGPAPVLVRELASGDRQQLLTHFLALGEEDRLLRFGQAVPDHVIENYVRT
FT                   MDFGRDTVFGVFDHALELIGVGHLAYLPAEGDKRTAEFGVSVLERARGQGVGTKLFERA
FT                   AIRSRNTHVTTLYMHCLSRNATMMHIAKKSGMRIEYAYGEADAYLSLPPADHSTIIAEM
FT                   MQEQAAVFDYALKRQARRATQIFESLLPAGLTA"
FT   gene            complement(14837..15352)
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0015"
FT   CDS_pept        complement(14837..15352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0015"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48060"
FT                   /db_xref="GOA:Q3JYC0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC0"
FT                   /protein_id="ABA48060.1"
FT                   /translation="MAHVELDAIDRRILSILQENGRLSNQDIAERVNLSPSPCLRRIRR
FT                   LEEMGVITGYVALLDPQKLGLDLLAYVSVRLEKRGGVAPVRGDETSARAGATHAELFRA
FT                   AVQAWPEVVACHAMTGDMDYLLRVQVEDMAHFSRFMQEQLLHHPSVIDVKTSFSLERFK
FT                   ETTALPIR"
FT   gene            15504..16601
FT                   /gene="hppD"
FT                   /locus_tag="BURPS1710b_0016"
FT   CDS_pept        15504..16601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BURPS1710b_0016"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR01263"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50777"
FT                   /db_xref="GOA:Q3JYB9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB9"
FT                   /protein_id="ABA50777.1"
FT                   /translation="MQIPTWDNPVGTDGFEFIEYTAPDPKALGQLFERMGFTAVARHRH
FT                   KDVTLYRQGDINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYRHALELGAWGF
FT                   DNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAKPGAIGDISIYDVDFEPIPGADPNP
FT                   AGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGK
FT                   IRIPINEEGSDTAGQIQEYLDAYRGEGIQHIALGAADIYRAVDGLRAKGVTLLDTIDTY
FT                   YELVDRRVPNHGEPLDELRKRKILIDGAHDDLLLQIFTENQIGPIFFEIIQRKGNQGFG
FT                   EGNFKALFESIELDQIRRGVVQDKA"
FT   gene            complement(16837..17034)
FT                   /locus_tag="BURPS1710b_0017"
FT   CDS_pept        complement(16837..17034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0017"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB8"
FT                   /protein_id="ABA48787.1"
FT                   /translation="MKTRNIQNFLMVSAAFFAMSGPARSEGAGVLATASTQMLQLAAAA
FT                   GADAPTFAGVATNGRGAMQK"
FT   gene            17354..20935
FT                   /locus_tag="BURPS1710b_0018"
FT   CDS_pept        17354..20935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0018"
FT                   /product="2-oxoacid:ferredoxin/flavodoxin oxidoreductases,
FT                   gamma subunit domain protein"
FT                   /note="identified by match to protein family HMM PF01558"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47714"
FT                   /db_xref="GOA:Q3JYB7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB7"
FT                   /protein_id="ABA47714.1"
FT                   /translation="MNAPLDAGQRASLEAALQSVTLDDKYTLERGRAYMSGIQALVRLP
FT                   MLQQERDRAAGLNTAGFISGYRGSPLGGLDLSLWKAKRHLAAHRIVFQPGINEDLAATA
FT                   VWGSQQVNLYPGAKYDGVFSMWYGKGPGVDRTGDVFKHANSAGSAPHGGVLVLAGDDHA
FT                   AKSSTLAHQSEHIFKACGLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVES
FT                   SASVDIDPHRTQIVLPTDFVMPDGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLD
FT                   RIEIDSPHARFGIVTGGKAYLDVRQALVDLGLDDDTCARIGIRLYKVGCVWPLEAQGAQ
FT                   AFARGLDEILVVEEKRQILEYAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNW
FT                   LLPAHYELSPAIIAKAIATRLEKFELPSDVRARIAARIAVIEAKETALAKPHVSAERKP
FT                   WFCSGCPHNTSTTVPEGSRAIAGIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDE
FT                   KHVFANLGDGTYFHSGLLAIRAAIASKANITYKILYNDAVAMTGGQPVDGVLTVPQITH
FT                   QLAAEGAKRIVIVTDEPRKYDGHTSQLAPGVTIHHRDQLDDVQRTLREIEGTTILIYDQ
FT                   TCATEKRRRRKRGAYPDPAKRVVINEAVCEGCGDCSVQSNCLSVEPRETEFGTKRQINQ
FT                   STCNKDFSCVKGFCPSFVTVEGGRLRKPKAVSADASALPPMPEPVLPAIDRAYGVLVTG
FT                   VGGTGVVTIGALLGMAAHLEGKGVTVLDVTGLAQKGGAVMSHVQIAHAPADIHATRIAM
FT                   GEADLVIGCDAIVTAGDECTSRMRHGTTRVVVNSAQTPTAEFIKNPKWTFPGASAELDI
FT                   RAAAGDAVDLVDANHFAVALLGDAIYTNPFVLGYAWQRGWLPLAYASLVRAIELNGVQI
FT                   EQNRAAFEWGRRAAFDPASVRAAAADDAQAGATVIALHTKKAVDALIATRVEHLNAYQN
FT                   AAYAARFSAVVSQARAAERALGADTAQEPLTEAVARNLCKLMAYKDEYEVARLHAAPAF
FT                   VAKLAEQFEGDWKLRFHLAPPLFAKKDARGRPVKQQYGPWLMPVFRVLAKLKFLRGTAF
FT                   DVFGRTEERRTERALIGEYEALVQELTGSRLTRDTLPLAVELASLPDGIRGYGHVKENN
FT                   LRAVRAKWAQLLAQWRSPEGGQTRNVA"
FT   gene            complement(21504..23825)
FT                   /gene="maeB-2"
FT                   /locus_tag="BURPS1710b_0019"
FT   CDS_pept        complement(21504..23825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB-2"
FT                   /locus_tag="BURPS1710b_0019"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF01515; match to protein
FT                   family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47480"
FT                   /db_xref="GOA:Q3JYB6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB6"
FT                   /protein_id="ABA47480.1"
FT                   /translation="MLGTESSKITHVSRRSTMDEQLKQSALAYHQNPKPGKISVTPTKP
FT                   LSNQLDLSLAYSPGVAAACEAIHADPLDAQKYTSRGNLVGVVTNGTAVLGLGNIGPLAA
FT                   KPVMEGKGCLFKKFAGIDVFDIELAESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYI
FT                   EQKLRERMKIPVFHDDQHGTAIIASAAILNGLKVVGKDLSSVKLVCSGAGAAAIACLDL
FT                   LVKLGLSKSNVLVADSKGVIYEGRGNLDPSKQRYAATTGARTLADAIAGADVFLGCSSA
FT                   GVLKQDMVKTMADRPLILALANPEPEIRPEDAKAVRPDAIVATGRSDYPNQVNNVLCFP
FT                   FIFRGALDVGATTITEEMKLACVRAIAELAQETDQSEEVAKAYEGHSLEFGPEYLIPKP
FT                   FDPRLIIKIAPAVAQAAMDSGVATRPIADMDAYREQLGTTVYRTGMVMRPVFATAKTKA
FT                   ARIVFAEGEDERVLRAAQFVLQERIAKPIIVGRPSVVEMRLKKIGSKLVGGVDFEIVNP
FT                   EDDPRYQQCWQAYHEIGARDGVTPEVAKAALRKFNTLIGAMLVHLGDAHGMICGMIDTY
FT                   HSHLKFIEQVLGRAKGAEHFAAMNLLMLPGRNLFMCDTYVNEQPSAEQLADMTIQAAAE
FT                   IERFGITPKAALLSNSNFGSAPSASSRRMAEARKLIVERAPELEVDGEMHGDAALSEVV
FT                   RKAAFPGTTLTGEANLLIMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAAKPVHILTPA
FT                   ATVRRIINMTAVAAANVQVK"
FT   gene            23838..24989
FT                   /gene="pyrE"
FT                   /locus_tag="BURPS1710b_0020"
FT   CDS_pept        23838..24989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BURPS1710b_0020"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50631"
FT                   /db_xref="GOA:Q3JYB5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB5"
FT                   /protein_id="ABA50631.1"
FT                   /translation="MRESKGWSTAASVARRIGAASNLGGWQAGSTKHRANLSGSPSVHL
FT                   AQARQLLRRGSLSFRGTAFRRRAPPEIARRAQRSPGARRPDGRGKPRPPHRRASRKARK
FT                   SGKIAGYARSEAARCRRPRPIGPPPGSHGGNHASCAAGPAPAPRSSSRNAPMTGFDRQT
FT                   ISDTTAKMLLEVQAVHFNADKPFIFTSGWASPVYIDCRKLISFPRVRRGLMEMAEATIL
FT                   RDVGFEQIDAVAGGETAGIPFAAWIADRMMLPMQYVRKKPKGFGRNAQIEGYLEEGSRV
FT                   LLVEDLTTDSRSKINFVNALRTAGAKVNHCFVLFHYDIFKESVSVLKDIDVDLHALATW
FT                   WDVLRVAKASGYFETKTLDEVEKFLHAPAEWSAAHGGATGAQE"
FT   gene            25291..25887
FT                   /locus_tag="BURPS1710b_0021"
FT   CDS_pept        25291..25887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0021"
FT                   /product="Phosphatidylethanolamine-binding protein"
FT                   /note="identified by match to protein family HMM PF01161;
FT                   match to protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50126"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB4"
FT                   /protein_id="ABA50126.1"
FT                   /translation="MRVGRRAVPRGSSRRLLSLALVCACALAPVGGSRALAEDAFMLTS
FT                   DDLHPGGRVGAPHVFNQGDCKGGNRSPQLAWRNPPPGTKGFAITMFDPDAPGRGWWHWA
FT                   VVGIPASVSSVPADASASGFLRKLGAAEARNDFGTDGYGGPCPPPGKPHRYVITVHALK
FT                   ATDLRVATGRPAQMFDHEIGTESIGSAQLVVTYGR"
FT   gene            26055..26849
FT                   /gene="wrbA"
FT                   /locus_tag="BURPS1710b_0022"
FT   CDS_pept        26055..26849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="BURPS1710b_0022"
FT                   /product="flavodoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00258"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48528"
FT                   /db_xref="GOA:Q3JYB3"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB3"
FT                   /protein_id="ABA48528.1"
FT                   /translation="MNLESRACRENGRSLRFASFRKFSRARQRSSTMLRPARLFPPAVR
FT                   APSRARTSFAARAARARAVSSSHLGEKGMSNLVIVYHSGYGHTKKLAESVLAGAREAGA
FT                   NARLVAVGDLDDAGWAALDAADAIVFGAPTYMGGPSADFKKFADATSKAWFGQKWKDKI
FT                   AAGFTNSASMNGDKFSTIQYFVTLAMQHGMVWVGTGLLPANTKAATRDDLNYAGGFTGL
FT                   LAQSPSDASPDEAPAGGDLGTAKAFGARVATATARWLAGNGR"
FT   gene            27002..27946
FT                   /gene="argC"
FT                   /locus_tag="BURPS1710b_0023"
FT   CDS_pept        27002..27946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BURPS1710b_0023"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM TIGR01851"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48897"
FT                   /db_xref="GOA:Q3JYB2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB2"
FT                   /protein_id="ABA48897.1"
FT                   /translation="MSTRVFVDGQEGTTGLKIFEYLLARSDIDILRIDEAKRKDVDERR
FT                   RLINASDVTFLCLPDVASRESATLVENPNTTLIDASTAFRTSADWAYGLPELNRAQRER
FT                   IRGAKRIAVPGCHASAFVLAMRPLVDAGVVAPGFAAHSYSITGYSGGGKKMIADYEAGG
FT                   AKLASPRPYALGLAHKHLPEMAAHTGLTSAPIFTPIVGPFYKGLAVTTYFTPGQLAKRV
FT                   TPQDVQRVLAEHYAGEAFVRVAPYDAAENLDDGFFDVQANNDTNRVDLFVFGTAERFVT
FT                   VARLDNLGKGASGAAIQCMNLNVGAAEGTGLAR"
FT   gene            28421..29794
FT                   /locus_tag="BURPS1710b_0024"
FT   CDS_pept        28421..29794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0024"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48063"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB1"
FT                   /protein_id="ABA48063.1"
FT                   /translation="MAIAVAPLFAACSGGGGGTPAPIAVPQCSGSSCGVQGPPSSTAAN
FT                   TSLCPADANIGSSTYLGGAGGGEIVSLNINATTMTYTLKWLESPVPLATGTVTPTRAGT
FT                   TITGSVAHPPAGTLPTAEQTRCAFVLLPGSGTAPATNSTYSTAADFNQANPPMILIGFG
FT                   VAGGGIPGATIQYSGLTIIPGVLQNIGQVPQRHFDFYPFLGFANTTTDLSKLPGTYNAL
FT                   VYHTVPSGNYAAKAIASNETFDANGACTSTSASGCMTTGNPWTASGNGYFNSTQAPQIL
FT                   PQTQLPLIGATGKSAVAHMVLGQLNGATVPVVVRTGNVNLGTPPLHTDAQVDDESGIAV
FT                   LGLAQAIASGGIDGGYAGADSNFKYTATVIKGTTGTFVNPSTQQAETGFTLDYGQSTPG
FT                   LLGVTTTDTSAPGFVIASGGLYAALVQGTVNGGITQSSAIAGQTPSAPYFGVGAQVSK"
FT   gene            29921..31171
FT                   /locus_tag="BURPS1710b_0025"
FT   CDS_pept        29921..31171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0025"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49782"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB0"
FT                   /protein_id="ABA49782.1"
FT                   /translation="MKQRNLVLAMACAAPFISACSGGGGGSESQPLVEAALCPSSVDYN
FT                   TVYTGGGGDGELVKLQIDTTKMTWQITFVESPVPKTTGTAAPTRAGTTQSGTLTQETLL
FT                   PTQKLNNCAFRLNGASLDPNRPARIFLGMGIVGGTIPGAEIQYGGLLGQGAIPDTTFPY
FT                   YPFIAFSSLETDVTKLAGTYSQLGYGQVGSQNFAPTTIDAKVTINPDGTWVRCDTTGIY
FT                   AGTCRQPGTNIVQSADGTGAFETDHYQGQVKPTLATIPQAKGYIIVGKLRNQLVPIMIR
FT                   TGVANPNPTPDANGVPGLTADDESGISILAPQTAIAVGSQNGEYIGVDSQFDYRTTALV
FT                   NAQATLLDPFQASQASLATPLNLDYTQAVPGTVTSTHVGASSTTPTGKFIFTGGVFGFL
FT                   DMSNSSSPYFTVGAFVQ"
FT   gene            31191..32021
FT                   /gene="ompW"
FT                   /locus_tag="BURPS1710b_0026"
FT   CDS_pept        31191..32021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompW"
FT                   /locus_tag="BURPS1710b_0026"
FT                   /product="outer membrane protein, OmpW family"
FT                   /note="identified by match to protein family HMM PF03922"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50615"
FT                   /db_xref="GOA:Q3JYA9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA9"
FT                   /protein_id="ABA50615.1"
FT                   /translation="MRKALCTALGVAALTPLAAHAQSAGSNVVTLGWFHVMPQQSSTPL
FT                   TTNVAPTPINTPLRLPPSFTSAGTGLSTSGADTVGLTVSHFLTDHIAVTSVAGVPPVFK
FT                   VSGHGTITPPGPAGALGTQNIGLAQVNPIVKSVRQWSPAVVFQYYFAQATAKFRPFVGI
FT                   GVSYNWFSDLQLNTNFIKQTQDNLGAILAAGAGKPGVTQVSAKASSSWQPVFNAGLSYN
FT                   ITDHWGLVASVTYIPLKTTSTVTIKAADGTTLAESKSDLKADPIISYVAVSYKF"
FT   gene            complement(32208..33146)
FT                   /locus_tag="BURPS1710b_0027"
FT   CDS_pept        complement(32208..33146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0027"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48041"
FT                   /db_xref="GOA:Q3JYA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA8"
FT                   /protein_id="ABA48041.1"
FT                   /translation="MNTRDLQAFVAVVDSGSMVAAATRLHLTQPGLTRRVQNLETTLGV
FT                   PLLDRQSKPLKPTAAGREVYALARNVLRSVDELLAVAAPGSEPAGELRIGVPPFLSELA
FT                   LEGPIDRLRDAFPRLTLRITAGWSPALLENVERAVLDAAAVMMPASFPMPETLVSTLLG
FT                   VQPTVLVAARDFALPPGPLSLDALARYPWVLSQDGCGMRSALSRAFSAAGLPFDVAVEA
FT                   FGSDLQLSLVARGAGLGIASASALARSPHRNALRIVETADVEPGINVWLVHGVLPGRLM
FT                   RPVELLRERLAAVLEEERSRRLGGEADMPAN"
FT   gene            33242..34510
FT                   /locus_tag="BURPS1710b_0028"
FT   CDS_pept        33242..34510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0028"
FT                   /product="MFS permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48949"
FT                   /db_xref="GOA:Q3JYA7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA7"
FT                   /protein_id="ABA48949.1"
FT                   /translation="MNCPADLRTGPAAGRPRTAPAPALTPALTMFFSATVGVIVLNLFA
FT                   AQPLTGPIAAELRLPASLTGLVAMLPQLGYAAGLVLLVPLVDLLENRRLIVTTLAVCAA
FT                   TLALPAVTRSGAVYLAAVFAAGAASSVIQMLVPMAASMAPDERRGRAVGNVMSGLMLGI
FT                   LLSRPLASLIAGAAGWRAFYGAAAAADIAIAAVLAAKLPLRAPQLSTRYAALLRSLWTL
FT                   VATERVLQRRALSAALSMAAFSAFWTAIGLRLAAAPFDLGLHGIAMFAFAGATGAIVTP
FT                   FAGLAGDRGRERDALRGAHVAMLAALAALGVAGAGWGGFDTAAHPALALALLVAGAAAL
FT                   DAGVVADQTLGRRAINLLDPAMRGRLNGLFVGLFFVGGSLGAVLAGAAWAWAGWGAVCA
FT                   VGLVFAGAAFALDWIGAHGPAPR"
FT   gene            complement(34601..35269)
FT                   /locus_tag="BURPS1710b_0029"
FT   CDS_pept        complement(34601..35269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0029"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50230"
FT                   /db_xref="GOA:Q3JYA6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA6"
FT                   /protein_id="ABA50230.1"
FT                   /translation="MNLHTWWLFVATVFVVSAIPGPNMLLVMTHGARHGLRRSTATMAG
FT                   CMTALVAMLSVSAAGLGVFLEAWPAMFDALRFAGAAYLIYLGVKAWRARVDEPSDAQSN
FT                   AHAEAAAPRAGRSGSAGQGFRWALFRNGFLVAGSNPKAILFAAALLPQFIDASAPTLPQ
FT                   FGILVATFAVIEVSWYIVYASFGTRIGVTLRSANVAKAFNRLTGGLFVGFGAMMALVRH
FT                   "
FT   gene            complement(35368..37179)
FT                   /locus_tag="BURPS1710b_0030"
FT   CDS_pept        complement(35368..37179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0030"
FT                   /product="dehydrogenase"
FT                   /note="identified by match to protein family HMM PF02826;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49487"
FT                   /db_xref="GOA:Q3JYA5"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA5"
FT                   /protein_id="ABA49487.1"
FT                   /translation="MRLRCASDACRCTRDASVRASARRRLRLRHVLDQRAHAPPVRAFP
FT                   EHAAAYVAGDEARVTLQHALRRAAGSLGGIDAPQRRIARQAQPERPRAAGEVEPIEQLL
FT                   QLRLRLQRAHVAAVRDRAALEQFAIAREDDSRFARGDRLDQLVRVVVVVQRVEAGEPQQ
FT                   LREPAEVRIGDEARDAQRRGAHAQQRADVDRLEARVDGDAVAFFEHVAERCRFAVDEDQ
FT                   LDFGMRHAERFDRMLDARAAHARVREFATAQRPREEIVQLLVEAESHGDHRLSIAPPRA
FT                   CRTSRDARRETANVARLCFTRAFDGLDEYKEHDMDIGFIGAGEMGSAIAGNLLKAGHRV
FT                   RVWNRSAERVAPLVALGAQQVATVADAFAGDAVFSMLADDAAARDVFDAALLEQAPRGL
FT                   IHVNMATISVALAEQLAHAHAQRAIHYVAAPVMGRPHVAAAARLTIIAAGPAEAIDRMQ
FT                   PAFDAIGQRTWRLGSLPQHANAVKIAANFTIASAIETMGEAGALLAAHGVAMNDYLDVI
FT                   TNSVFPGPVYQGYGAMIAESRYEPALFKARLGLKDVRLALEAGDALSVPLPVASVVRDS
FT                   LIEAVAHGHGDKDFAVLGQVAARRAGR"
FT   gene            36364..37119
FT                   /locus_tag="BURPS1710b_0031"
FT   CDS_pept        36364..37119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0031"
FT                   /product="Protein of unknown function family"
FT                   /note="identified by match to protein family HMM PF01927"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50279"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA4"
FT                   /protein_id="ABA50279.1"
FT                   /translation="MVTVTFRFYEELNDFLARPLRRREFAHACMRGASVKHAIEALGVP
FT                   HTEVELILVNGESTPFSHVLEEGDRVAVYPSFEAIDIRPLLRVRAAPLRVTRFIADAHL
FT                   GGLAQLLRLAGFDTLYDNHYPDELIETIAAREARIVLTRDRELLKRRTITHGCYVRALK
FT                   PQAQLQELFDRLDLAGSARPFRLCLSCNAPLRRIDPAEAAGRAPQGVLQRHTRFVTCDV
FT                   CRRVFWEGSHWRRMRALIEHVSQPKPPPG"
FT   gene            complement(37713..38390)
FT                   /locus_tag="BURPS1710b_0032"
FT   CDS_pept        complement(37713..38390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47912"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA3"
FT                   /protein_id="ABA47912.1"
FT                   /translation="MPRSVRYTRSRCAHGMRIEWRVNEIASCIVMSFVAANRFSPASNV
FT                   ARAWHALSRRCVCAASLMGKREWRARTRFAANIGDARHAFVDCVNTGTNDEPVISLHRV
FT                   AFACSFVRRIAAFAEAKCCDSTQRCAVHAIIAARGFESRDFIGMLRERRAPRSTDSLAN
FT                   RPVPVITAPPPARHARLPNQIRPNPECDPTVSNVEMRSASSKNRCITFDRAPENHPLIV
FT                   LSI"
FT   gene            38158..38373
FT                   /locus_tag="BURPS1710b_0033"
FT   CDS_pept        38158..38373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA2"
FT                   /protein_id="ABA48718.1"
FT                   /translation="MFAAKRVRARHSRLPIKDAAHTHRRDKACHARATFDAGENRFAAT
FT                   NDITMHDAISFTRHSIRMPCAHRERV"
FT   gene            38545..38952
FT                   /locus_tag="BURPS1710b_0034"
FT   CDS_pept        38545..38952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0034"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA1"
FT                   /protein_id="ABA49994.1"
FT                   /translation="MRFCRTTHLGSPMKSTQILASCALVGAVAALAGCAGSSANGPQAE
FT                   SPSGRIIYVASPRSPHDVESCLTSRVSQARVAQRNPTTVLIGPYSADSDWTVTLAPTAS
FT                   SGTTIGVYRPRSGDGDPEESELRFHIARCAV"
FT   gene            complement(40161..40478)
FT                   /locus_tag="BURPS1710b_0035"
FT   CDS_pept        complement(40161..40478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0035"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48912"
FT                   /db_xref="GOA:Q3JYA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA0"
FT                   /protein_id="ABA48912.1"
FT                   /translation="MPINSDWVASTGLPAAVYLFCLGYALLRAFGPRHARYPKLMRRYA
FT                   MACAGAVLCGMLATIGAALRTPAAPVLASFGSTVTFAGIVGVLIGCMGEAAVSFGKRWE
FT                   R"
FT   gene            40993..42399
FT                   /locus_tag="BURPS1710b_0036"
FT   CDS_pept        40993..42399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0036"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50182"
FT                   /db_xref="GOA:Q3JY99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY99"
FT                   /protein_id="ABA50182.1"
FT                   /translation="MQKGHSETDLHRGLGQRQMRLIALGAAIGVGLFLGSANAIKMAGP
FT                   GIILSYIIGGAVIFVIMRALGEMAVHEPVAGSFSRYARNYLGPLAGYLTGWNYWFLWLV
FT                   TCIAEITAVGIYMGIWFPDVPRWIWALAALATMGSVNLLTVKAYGEFEFWFALIKVVTI
FT                   VVMIAVGIAMIAFGIGNHGVPMGISNLWAHGGFFPNGAQGVLMSMQMVMFAYLGVEMIG
FT                   LTAGEAANPQKTIPGAINSVFWRILLFYGGALFVILSIYPWNEIGTQGSPFVMTFERLG
FT                   IKTAAGIINFVVLTAALSSCNGGIFSTGRMLYNLAQQGHAPRTFGETTASGVPRRAILV
FT                   SMAALLVGVLLNYLVPEKVFVWVTSISTFGAIWTWGVILVTQMKFRASLAPAEERALRF
FT                   RMPFWPYASWVALAFLVLVIGLMAYFPDTRIALYVGPAWLVLLVVLYFVLKLEPEGGKA
FT                   AGLERRYGRG"
FT   gene            complement(42573..42648)
FT                   /locus_tag="BURPS1710b_0037"
FT   tRNA            complement(42573..42648)
FT                   /locus_tag="BURPS1710b_0037"
FT                   /product="tRNA-Ala"
FT   gene            complement(42713..43399)
FT                   /locus_tag="BURPS1710b_0038"
FT   CDS_pept        complement(42713..43399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0038"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50989"
FT                   /db_xref="GOA:Q3JY98"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY98"
FT                   /protein_id="ABA50989.1"
FT                   /translation="MRARQRLFDGPRDDRRRQPGRGRREPRAGRREGRQGVPVHQAAGC
FT                   AGADGGDARERRVGGRGARDGARRRDGGGGAGFERHRDAAIGAGAGFQFVERASGQSEG
FT                   GDAVTIAKRVKRTMSAAAAAMAVVSCAMAAAPAAHADAGDGLKVARSNACMGCHAVDRK
FT                   LVGPSFQQIAERYKNDKQAEPKLAKKVKDGGSGVWGAIPMPAHPRMSDADVRSVVQWVL
FT                   AGAPSK"
FT   gene            complement(43075..43875)
FT                   /locus_tag="BURPS1710b_0039"
FT   CDS_pept        complement(43075..43875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0039"
FT                   /product="Putative phospholipid-binding domain family"
FT                   /note="identified by match to protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48758"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY97"
FT                   /protein_id="ABA48758.1"
FT                   /translation="MSNSRVRQTLVRTTLVIGLSAGLAATLQGCVLAVAGAAAGGGALV
FT                   ATDRRTLGAQTEDREIQVKALTQMNNGLPDGSHVNVTVFNRRVLLTGEVPSDAAKQRAE
FT                   EIVRAINNVNAIVNELAVGPASSLSDRANDSYLEGRVKTAMIAEKGISANNYKVVCERG
FT                   NVYLMGLVTTDEGSRGADVASRVPGVEKVVKVFQYIKPQDAQALTAATPASGASAAAAP
FT                   ATAPEGATVGAVPDSSVTATPLSAPAPVSNSSNVHPGNPKAGTP"
FT   gene            complement(43894..44472)
FT                   /gene="gmhA"
FT                   /locus_tag="BURPS1710b_0040"
FT   CDS_pept        complement(43894..44472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="BURPS1710b_0040"
FT                   /product="phosphoheptose isomerase"
FT                   /note="identified by match to protein family HMM TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49328"
FT                   /db_xref="GOA:Q3JY96"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY96"
FT                   /protein_id="ABA49328.1"
FT                   /translation="MSVERIQQHIRDSAALVHEALEALSLPIAAAVDAMFMALANGNKI
FT                   VACGDGPSAAAAERLAAALIGGFERERPGLPGLALDTDASRSGTGADGDQIFAQQVRTL
FT                   GQTGDVLLVLDPLGESPRVLAAVEEAREREMIVIALTGNGGGCLGASLADTDIQICVPS
FT                   ERAVRIQEVHLLTIHCLCDGIDAMLLGED"
FT   gene            complement(44595..45077)
FT                   /gene="hemU-1"
FT                   /locus_tag="BURPS1710b_0041"
FT   CDS_pept        complement(44595..45077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemU-1"
FT                   /locus_tag="BURPS1710b_0041"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF02021;
FT                   match to protein family HMM TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50479"
FT                   /db_xref="GOA:Q3JY95"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY95"
FT                   /protein_id="ABA50479.1"
FT                   /translation="MTRKAPARGANGRSSALCHAREASPGTGEPEAAPRDNFPREAGSK
FT                   RGIGAAFETRAQRFLERAGLALVARNVTVRGGEIDLVMRERDGTLVFVEVRARANSRYG
FT                   GAAASIGARKRMRLLLAAHAFWARTGGANACRFDVVAFEGGRLVWLRDAFRADDAG"
FT   gene            45076..45963
FT                   /locus_tag="BURPS1710b_0042"
FT   CDS_pept        45076..45963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0042"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48236"
FT                   /db_xref="GOA:Q3JY94"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY94"
FT                   /protein_id="ABA48236.1"
FT                   /translation="MTSLLDLAQAQHYPAGALYIVATPIGNAADITLRALHVLTLADRI
FT                   AAEDTRNTGQLLVRYGISKPLVAVHEHNERAAAAKLIDHLRAGERIAYVSDAGTPGISD
FT                   PGAKLVDAVRAAGFGVIPLPGANAAAAAVSVAGDWAGAFTFAGFLPPKPKQRDAALQPL
FT                   KTHPYALVFYEAPHRIVETVEALAAALGGERRLLIARELTKLHEELFEGTLADGPTWLR
FT                   ADANRQRGEFVLVVEGAPQGAQDEDERAHDALLELLLDEVPVKSAAKLAAALTGAPRNA
FT                   LYARALALKKKEEE"
FT   gene            complement(46058..46693)
FT                   /locus_tag="BURPS1710b_0043"
FT   CDS_pept        complement(46058..46693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0043"
FT                   /product="rare lipoprotein A family protein"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49285"
FT                   /db_xref="GOA:Q3JY93"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY93"
FT                   /protein_id="ABA49285.1"
FT                   /translation="MKFRLPRHLGTLAVFFALTGCAVPPNAPTSEQAKSAASKDALRTA
FT                   ASGAASNNKESAGAPLNFDTALASMPAAGSQDVSRQSLADAKPIDAADISDFRQTGRAS
FT                   WYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGPFSRG
FT                   RILDLSYAAAKVIGLVHAGTARVKIQGLSPEEARVARDEMLASNSTTK"
FT   gene            47294..47938
FT                   /gene="glob1"
FT                   /locus_tag="BURPS1710b_0044"
FT   CDS_pept        47294..47938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glob1"
FT                   /locus_tag="BURPS1710b_0044"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /EC_number="3.-.-.-"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49926"
FT                   /db_xref="GOA:Q3JY92"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY92"
FT                   /protein_id="ABA49926.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQ
FT                   HVQVEKVLLTHGHVDHCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPAAEA
FT                   FEPDRWLADGDTLAFGEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDF
FT                   PRGNHADLIRSIREKLWPLGDDVTFVPGHGPVSTFGDERRTNPFVADEVAG"
FT   gene            48132..49508
FT                   /locus_tag="BURPS1710b_0045"
FT   CDS_pept        48132..49508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50887"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY91"
FT                   /protein_id="ABA50887.1"
FT                   /translation="MVEDAARSVGRMPARFAGARGRARRVRRMGRGAARQARVRRDAGG
FT                   LRFHVHVLVHDALHRALPVFVVGARHQDARVRDHRPAVPEGDQAALPEALVRRLSAHAR
FT                   RARRCDRARRALLQHARRPARAADGEGVGAARRRSGRISTKCRRRPEKLANIARFNGSR
FT                   LPFFSPASTIAKCCSRFGGAGDPRYLFAKNPSPVAARRAPLRAGDLRSGRPLQHAVLAP
FT                   HQGHGAVRRDPALHRAARPREARAPYLRARARPPDPAQRRRRRAVRAGDRDLPRGDRVL
FT                   QHDGRSRLHPQDRRAGHQGLRHLPARTDLQDSRRLASPHERRAARDQVRHAVAALTRGR
FT                   VRRRLRLVAPGYVGWAGSCRAASAIAPARARRPGARRAPRHAQRRAALFCIALAPDQDS
FT                   RPTAAASLDASARDMPRRRAPNCRFNASISKRAAGSWPPCRSRLASGASVMSISSPVLR
FT                   "
FT   gene            48682..49140
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0046"
FT   CDS_pept        48682..49140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0046"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47733"
FT                   /db_xref="GOA:Q3JY90"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY90"
FT                   /protein_id="ABA47733.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGVIQRYTALLDREKLGLHICALAHVHLTRHNEGGVEQFEREIATCPEVTECYSTTGEA
FT                   DYILKIVAPDIKAYDIFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
FT   gene            complement(49319..50509)
FT                   /locus_tag="BURPS1710b_0047"
FT   CDS_pept        complement(49319..50509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0047"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48166"
FT                   /db_xref="GOA:Q3JY89"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY89"
FT                   /protein_id="ABA48166.1"
FT                   /translation="MSTFSNDDLASEKQVVARQSTFVSIVLNVILATLQVVVGVIAHSQ
FT                   ALIADGVHSLSDLVSDFVVLLANRHSGAKPDADHNYGHSRYETVASFFLGAILIAVGVG
FT                   MLWRAGDRLVHLEDIPPVHASALAVAVVVLLSKEGLFRYMLREAQRVRSAMLVANAWHA
FT                   RSDAASSLVVAIGIIGSLAGVRLLDPIAAAIVGFMVARMGWTFGWDALQDLSDRALDES
FT                   ASAEIRALIVSTPGVRDVHDLRTRKMGDSALVDAHILVDPMMSVSEGHYIAEAARSRAL
FT                   TDRRVLDALIHVDPEHDVARRTVLDLPPRDQLEGQIEATLEKAGLRASAINLHYLSTGL
FT                   EIDITLAPDASRDRQGGHDPAARLDIEALKRQFGARRLGMSRALASSDAAAVGRLS"
FT   gene            complement(50749..51126)
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0048"
FT   CDS_pept        complement(50749..51126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0048"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49808"
FT                   /db_xref="GOA:Q3JY88"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY88"
FT                   /protein_id="ABA49808.1"
FT                   /translation="MTQLSEASLVKMASRPKIGAIWSDKREFMSSYKDLLAQREKLEKQ
FT                   IEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRPRAGVAAKYRDPESGAT
FT                   WSGRGKPPRWIAGKNREQFAI"
FT   gene            complement(51427..52293)
FT                   /locus_tag="BURPS1710b_0049"
FT   CDS_pept        complement(51427..52293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0049"
FT                   /product="Pyridoxamine 5'-phosphate oxidase family"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48610"
FT                   /db_xref="GOA:Q3JY87"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY87"
FT                   /protein_id="ABA48610.1"
FT                   /translation="MRRQAHAWGRPIRVGPGRHGLAGHALPPGAPSHAACPGAAQRAAH
FT                   SRGDAADVSLPQARISHVNISAALPLHLLHRNVLGTLATHSRAPEGYPYPTVVPYAVDA
FT                   RHRPIVLVSGLAEHTRNLAADPRAGFLVVDGLGDAAGASDSVLEAERATLVGRFEPAGA
FT                   DPHVVARYLRYHPDGERYLALGDFTFWALACERLRYIGGFGRMGWLDATELDALAPVGY
FT                   DDERALWDEYGASRERRAGLELLGVDRYGADWRLNGLKRRTPFDAPKMDVESLLAALRE
FT                   AAAVSLM"
FT   gene            52510..53628
FT                   /locus_tag="BURPS1710b_0050"
FT   CDS_pept        52510..53628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0050"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50894"
FT                   /db_xref="GOA:Q3JY86"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY86"
FT                   /protein_id="ABA50894.1"
FT                   /translation="MALFFVAGMMYASWGVHVPTVRDKFALSPALLSFALLAVAIGSIV
FT                   AMTTNARWIARVGSRTACLAGGLAMSASGALILVVPTYPLLLAVLALFGFSMATLDVAM
FT                   NAEASAVESAFGKPIMSMLHGMFSVGGMAGAAAGGALLSAGMASAVHLGLAALASALVL
FT                   ALACPAVLPHVPHTAAADGAPRVNRWRSPALWALGAIALVALIAEGAMYDWATVYMRDV
FT                   VLASPAFSSAAYAAFSGGMAAARFAGDAVRARFGAPQLVCASATLACVGMIAALALPSP
FT                   FVALAGFTLMGLGLANMMPVLFAAAARIDGIHAAEGLAHVAGLAYFGLLFGPVAIGAVT
FT                   QAANLSVGLSIVALCAALVAIVAPKVLSRLKI"
FT   gene            complement(53819..54961)
FT                   /locus_tag="BURPS1710b_0051"
FT   CDS_pept        complement(53819..54961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0051"
FT                   /product="putative extracellular ligand binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50497"
FT                   /db_xref="GOA:Q3JY85"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY85"
FT                   /protein_id="ABA50497.1"
FT                   /translation="MNIKMQKLLPISAAAMLLAAAATNAAADQVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKVTLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   RSKGVKSVAVVDDSTAYGQGLANEFEKKAKALGLKVVSHDATNDKAVDFRAILTKIKGE
FT                   NPDAVMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDATDNVVCSEAGA
FT                   SLEKMPGGAAFKAKYEKRFGQPIQIYAPFTYDAVYIIVDAMKRANSTDPAKIVAAMPKT
FT                   NYTGVIGTTTFDSKGDLQHGVISLYDYKGGKKTFLDEVKM"
FT   gene            complement(55417..56517)
FT                   /gene="fabK"
FT                   /locus_tag="BURPS1710b_0052"
FT   CDS_pept        complement(55417..56517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="BURPS1710b_0052"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /EC_number="1.13.12.16"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49704"
FT                   /db_xref="GOA:Q3JY84"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY84"
FT                   /protein_id="ABA49704.1"
FT                   /translation="MTSRIAPTPFAARFDLRLPLVQAPMVGATTPALVAAASNAGALGS
FT                   LGGASFAPEKLAAEIAAVRAATRRAFAVNLFVLPDAQPDDAAVRRALDAIDPLRARFGL
FT                   PPGAPLPRYAPDFRAQLDALVDARVPVASFTFGVLDKKDVVRLQAAGTYVIGTATHVAE
FT                   GLAWQAAGADAICAQGAEAGGHRGTFIGSAEDALVGTIALVPQLVDATNLPVLAAGGIM
FT                   DGRGIAAALALGAQAAQLGTAFLTCAESAIPACWKARLLASDDTSTSVTRAITGRHARG
FT                   IRNALMTQLAGRPDSVAPYPVQNALTQELRQTAARAGDAEYLSLWSGQGAPLGKHRDGA
FT                   QTTAQLIDALDAEWRAALSRSVISLV"
FT   gene            56844..57536
FT                   /locus_tag="BURPS1710b_0053"
FT   CDS_pept        56844..57536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0053"
FT                   /product="dienelactone hydrolase"
FT                   /EC_number="3.1.1.45"
FT                   /note="identified by match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48279"
FT                   /db_xref="GOA:Q3JY83"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY83"
FT                   /protein_id="ABA48279.1"
FT                   /translation="MASQWIDIPAGNDTFGGYLALPKRGKGPAIVIIQEIFGVNGHIRS
FT                   VADQYAADGYVALAPDVFWRTQPRIELGYEGADRDKGIELLQKTDVAQAVADIGAAAAA
FT                   LRARPEVAGKLAAIGYCFGGRLAYLAAARQHVDAAVAYYGGGIQNHVDVAAQIAQPILF
FT                   HYAGHDQSIPLDAVDKVKAAFAGRANAEFHLYPDAQHGFNCSERASYDQRAAALAHGRT
FT                   LTFLAERL"
FT   gene            57631..59121
FT                   /gene="nylA"
FT                   /locus_tag="BURPS1710b_0054"
FT   CDS_pept        57631..59121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nylA"
FT                   /locus_tag="BURPS1710b_0054"
FT                   /product="6-aminohexanoate-cyclic-dimer hydrolase"
FT                   /EC_number="3.5.2.12"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50489"
FT                   /db_xref="GOA:Q3JY82"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY82"
FT                   /protein_id="ABA50489.1"
FT                   /translation="MTVLSDYLCHDAIGLAQLVAQREVSARELLDAAIGRAQALNPAIN
FT                   AIVLNDYAAARERAASGTLAGPLAGVPYLVKDLGSAVAGLPLSLGSRHYRHHVPAEDSP
FT                   LIVRTKAAGLNIFGKTNTPELGQMPYTESALLGVCRNPWNLDHTPGGSSGGAAAAVAAG
FT                   IVPLAHASDGGGSIRIPASCCGLFGFKPSRDPALTPWPVPGEIVVEHAVSRSVRDSALL
FT                   LDITTGRTAPGTLEGVGAPGTYLGALDAPPPALKIGYVTDPMLAPALSADVRDALDRAA
FT                   ALAASLGHNVEPATLNLDFAQIGEVFLTIWAAIADELVLGAERITGRKPARAEFEPATW
FT                   AMAQVGRRLVRERLPHALELQRQITARVAGLVSRYDVLLCATLAAPPIKIGEMQPTPLE
FT                   TRQMELLGVLPIKPLLKRMLAEVSHQAFAWAGCTELFNLTGQPAMSVPLHWSARGLPVG
FT                   VQFVARHGDDARLFALARQLELAQPWFDKRPPLARAQA"
FT   gene            complement(59305..60135)
FT                   /gene="metF"
FT                   /locus_tag="BURPS1710b_0055"
FT   CDS_pept        complement(59305..60135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="BURPS1710b_0055"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49953"
FT                   /db_xref="GOA:Q3JY81"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY81"
FT                   /protein_id="ABA49953.1"
FT                   /translation="MNPIELSFEFFPPKTAEGVDKLRATRAQLAPLKPKFVSVTFGAGG
FT                   STQQGTLDTVLDMQKAGLEAAPHLSCIGSSKDSLRAILDQYRSHGIRHIVALRGDLPSG
FT                   MGEVGELRYASELVSFIRAEHGDWFRIEVAAYPEYHPQARSPKADLENFARKVKAGANA
FT                   AITQYFYNADAYFRFVDDAAKLGVDVPVVPGIMPITNFSQLMRFSEMCGAEVPRWVARR
FT                   LESFGDDKDSIRAFGADVVTGLCRRLIDAGVPGLHFYTLNGAAATKTVCERLGL"
FT   gene            complement(60153..60506)
FT                   /locus_tag="BURPS1710b_0056"
FT   CDS_pept        complement(60153..60506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0056"
FT                   /product="YvlD"
FT                   /note="identified by match to protein family HMM PF04020"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47859"
FT                   /db_xref="GOA:Q3JY80"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY80"
FT                   /protein_id="ABA47859.1"
FT                   /translation="MTVILTWIINALALLIITYLVPSIHIKSFGTALIVAVVLGLINAV
FT                   IRPVLILLTLPVTIVTLGLFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRNIG"
FT   gene            complement(60670..62091)
FT                   /gene="ahcY"
FT                   /locus_tag="BURPS1710b_0057"
FT   CDS_pept        complement(60670..62091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="BURPS1710b_0057"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF02826; match to protein
FT                   family HMM PF05221; match to protein family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47924"
FT                   /db_xref="GOA:Q3JY79"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="PDB:3D64"
FT                   /db_xref="PDB:3GLQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY79"
FT                   /protein_id="ABA47924.1"
FT                   /translation="MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDE
FT                   YKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGT
FT                   PVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIARP
FT                   TNEEEVALFKSIERHLEIDGSWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFN
FT                   VNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGAT
FT                   VWVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNYHVINHDHMKAMRHNAIVC
FT                   NIGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVM
FT                   SNSFTNQTLAQIELFTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQAAYI
FT                   GVSKAGPFKPDHYRY"
FT   gene            complement(62445..63176)
FT                   /gene="fliA"
FT                   /locus_tag="BURPS1710b_0058"
FT   CDS_pept        complement(62445..63176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="BURPS1710b_0058"
FT                   /product="RNA polymerase sigma factor for flagellar operon
FT                   FliA"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM PF04545; match to protein family HMM TIGR02479"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50876"
FT                   /db_xref="GOA:Q3JY78"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY78"
FT                   /protein_id="ABA50876.1"
FT                   /translation="MYNAQGKISQDEVLTQYAPLVRRLGLQLVAKMPASVDLDDLIQAG
FT                   MIGLLDAASRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVEHAVHQV
FT                   EQRLGRSANETEIAAHLQMPLDEYQSMLQDLHGSQLVYYEDFDRSADDEPFLDRYRADH
FT                   SDPLSALLDEHLRSALVDAIERLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQLH
FT                   SQAVARLRAKLREQAWVGTES"
FT   gene            62511..64133
FT                   /locus_tag="BURPS1710b_0059"
FT   CDS_pept        62511..64133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY77"
FT                   /protein_id="ABA47901.1"
FT                   /translation="MQLAHARLAHLEHRADLAQVQPALVVQRHQQLLALRQALDRIDER
FT                   AAQMLVEQRRQRIAVIGAVAVEKRLVVGRAVEVLVVDELAAVQILQHRLVFVERHLQVR
FT                   GDLRLVRRAAEPLLDLMHRMFDFARGLAQAARQPIVAAQLVEHRAADALRRVGLELRAL
FT                   IFLVAARRVEQADHARLDQIVEVHARRHLRDELQAETTHERRVLRQHFVLGNLALSVIH
FT                   HAPSSSWRSGGMSRAAFKRRTSRPDPADARTRTHRPIQQIGGDLPVVARRRRRRERVHH
FT                   RVREPARALDQRIGGDATCVRQRHAQIPARDAREVLVGGSRVGRALHVVGQHAKLRARV
FT                   RVVQPLHARVRLGDRRGRHARDHEHVVRVARERGERAVRVELRVDQHDVRRAVAERVEL
FT                   RVAVADAREPRRLAHREAELVPHRLAVAQPRAAQRRRDRADVRALVDDEHVLAERGERR
FT                   GEIGDRRRAADARRPARHRDDARRASGEQAPQPFGLIGDALIQSGPRAVRCRCACSTRT
FT                   ASPAGHRHGARTANPRAARRTRS"
FT   gene            complement(63201..64013)
FT                   /gene="flhG"
FT                   /locus_tag="BURPS1710b_0060"
FT   CDS_pept        complement(63201..64013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhG"
FT                   /locus_tag="BURPS1710b_0060"
FT                   /product="flagellar biosynthesis protein FlhG"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50077"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY76"
FT                   /protein_id="ABA50077.1"
FT                   /translation="MDKRITDQAEGLRRLLAGRASRVVAVTGGPSGVGCTSTVANLAAA
FT                   LTALGKDVLVVDERANVRSIAATLCGSWLRDGEPVRHELGFAVCEASRLARVGYSDAQL
FT                   DALGDGAADIVLIDAQLDANGALSALARDAHDVLVVTRVSASAITEAYACMKRLHYAHA
FT                   RAQFRVLTNHVQSAADARAAYENLAGVASRYLRVSLSNAGCVAADSLIERARGLAHTVV
FT                   DAFPSAAAARDYRQIAADLLYWPMRPGPGIGRVRTGSSAFERGAAHAA"
FT   gene            complement(64006..65757)
FT                   /gene="flhF"
FT                   /locus_tag="BURPS1710b_0061"
FT   CDS_pept        complement(64006..65757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="BURPS1710b_0061"
FT                   /product="flagellar biosynthesis protein FlhF"
FT                   /note="identified by match to protein family HMM PF00448"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49221"
FT                   /db_xref="GOA:Q3JY75"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY75"
FT                   /protein_id="ABA49221.1"
FT                   /translation="MNIRKFIGPTSRDALRLVREAMGADAAVLSNRTLEDGRVEIVALP
FT                   AAELAEISTRRAADAAHGAAQPHAPRQGAQHAPSGPSFASPAASVVVPSAASGASAPAS
FT                   RAAANPYAAGGMPDVFSSVFGASVDASADDDARPAVSPPVPPALPPAAPSEPAPWLVEH
FT                   AKRLTKQHEELIARPRATAALPAQNAPQAPRERASADEAPEWARDIVRNAARRLPADEP
FT                   AAAKPALRLPEDTAAAVADAVKARIERIVNDTVMQELGSLRELMEEQFAGLMWNERQRR
FT                   NPVHGALTKYLFAAGFSAQLVRMIVDNLPEGEGYDTLDAAADWAQSVLAANLPVLDSED
FT                   ALMERGGVFALMGPTGVGKTTTTAKLAARCVMRFGASKVALLTTDSYRIGGHEQLRIFG
FT                   KILGVPVHAVKDGGDLQLALAELRNKHMVLIDTIGMSQRDRTVSDQIAMLHGADTPVQR
FT                   LLLLNATSHGDTLNEVVQAYRSAAGQPKAALPDLAGCILTKLDEASNLGGVLDTVIRYK
FT                   LPVHYVSTGQKVPENLYVATKKFLLKSAFCAPREDSPFVPHDDDLPAMLSALSTRTGNE
FT                   LHEVRFG"
FT   gene            complement(65754..67856)
FT                   /gene="flhA"
FT                   /locus_tag="BURPS1710b_0062"
FT   CDS_pept        complement(65754..67856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BURPS1710b_0062"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01398"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50390"
FT                   /db_xref="GOA:Q3JY74"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY74"
FT                   /protein_id="ABA50390.1"
FT                   /translation="MNMPAGLLGKRAQLFAGTNLRALAGPILICMILGMMILPLPPLLL
FT                   DLFFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEGHTG
FT                   PDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFMVITKGAGRIAEVSARFTLDAMPG
FT                   KQMAIDADLNAGLINEEQAKKRRQSVAQEAEFYGSMDGASKFVRGDAIAGLIIMAINVI
FT                   GGLIVGMAQHDMSFAAAGKNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATDEDIGTQ
FT                   LTTQLFTNPRVLMITGSIIVLMGLIPNMPHFAFLLLGGGAIWLSRTMTKREAAKKAAGM
FT                   VAEIAPPAALPADSHEATWEDVTLIDPLGLEVGYRLIPLVDKNADGELLKRIKSIRKKF
FT                   AQEIGFLPPVIHIRDNLELRPNAYRIALKGVEVGTGEAYPGQWLAINPGQVTAALPGAP
FT                   TQDPAFGLPAVWIDTALREQAQVYGYTVVDASTVVATHLNHLVVQHAAELLGRQEVQAL
FT                   IERTGKDAPSLVEDLVPKTISLTTLQKVLQNLLDEGVPIRDMRTIIEAVSEQAGRITDP
FT                   YDLTAAVRLSLGRAITQQWYPGAGEMQVMGLDANLERVLSQALATGANPGLEPGLAHSL
FT                   LIGTQDAMLRQQNMGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYAEVPDTRTIKVVN
FT                   VIGGTA"
FT   gene            complement(67853..69265)
FT                   /gene="flhB"
FT                   /locus_tag="BURPS1710b_0063"
FT   CDS_pept        complement(67853..69265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BURPS1710b_0063"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR00328"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50940"
FT                   /db_xref="GOA:Q3JY73"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY73"
FT                   /protein_id="ABA50940.1"
FT                   /translation="MLRVSLFPPAACAAHRAPKIPPPPPFACATDSEKYPGFPAFLDRS
FT                   PVDRRGNNRCHWKAASRRAHMEARVAEDSDLDRTEAATPKRREKAREEGQVARSRELAS
FT                   FALLSAGFYGAWMLSGPIGEHLRTMLHTAFSFDRAAAFDTNRMLSHAGTLSLEGLYALA
FT                   PVLALTGVAALAAPMAMGGWLVSTKTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKT
FT                   LVVGGIGGIAIWRSKDELLGLATQPLHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQ
FT                   LWQYNKKLRMTKEEIKREHRENEGDPHVKGRIRQQQRAMARRRMMANVPTADVVVTNPT
FT                   HFAVALKYTDGEMRAPKVVAKGVNLVAARIRELAAEHHVPLLEAPPLARALYHNVELER
FT                   EIPGTLYSAVAEVLAWVYQLKRFRAEAGIAPETPVDLDVPAELDKGAHVAPQDEREEAE
FT                   DALGGRAAGGAA"
FT   gene            complement(69766..70266)
FT                   /locus_tag="BURPS1710b_0064"
FT   CDS_pept        complement(69766..70266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0064"
FT                   /product="DNA binding protein"
FT                   /note="identified by match to protein family HMM PF06983"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48733"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY72"
FT                   /protein_id="ABA48733.1"
FT                   /translation="MTARVQRITPFLWFDGNAEEAATFYVSVFDNARLTRVARYGKEGA
FT                   QASGQGEGAVMTVAFELDGQSFVALNGGPVFQFNPAVSFVVNCATQDEIDYYWGRLSEG
FT                   GDASAQQCGWLRDRFGLSWQIVPVQLPELLAGDDPAKASRTMQALMQMKKIDLGALRRA
FT                   AAD"
FT   gene            complement(70304..71680)
FT                   /locus_tag="BURPS1710b_0065"
FT   CDS_pept        complement(70304..71680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49133"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY71"
FT                   /protein_id="ABA49133.1"
FT                   /translation="MRRRRRRRLERIGKHRHRRRRHVRGRRLERRHRRHRRLGQHAARV
FT                   EPGGDHRQHGRRDHHQHADRQRDDLRARHVRVPDDRQRARRHRVVRAADRQHRRVGRAR
FT                   QPARVERERRHAHRVRQVRDELHVGHRAHRRREDRRRAGEFAADPDHRRSGLLRRAELV
FT                   LERQRAVEHRGRSRRERHSRDRARAVRLRRELHDVDALQQLLRVPERQHELPGHDGAAR
FT                   AAGRQPGAALCDRQQRRDRRNEPAGGRQRDGHADVRDQHPVEQRVAGGRDEAHLDDRGR
FT                   PDGHAARPCDHDGVLRYRLERVLLRYGRQHGGLAARVQQQFVVLLPVEHANDDGHRRRP
FT                   ERRAGLAVDLDRQRERAVFVVQIGGAESRRPVRQHAGARFRLAALFRQDTVLRDGPDWQ
FT                   RRCGAVCRVLTRRARASRSGARVTRIEGRTGARNRARLALVWHSTIEAAEPRGASAYHR
FT                   "
FT   gene            complement(70453..71757)
FT                   /locus_tag="BURPS1710b_0066"
FT   CDS_pept        complement(70453..71757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0066"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49962"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY70"
FT                   /protein_id="ABA49962.1"
FT                   /translation="MRFQHTLTRWLGALSLAAATAALVAACGGGGDGGSNASVNTGTGG
FT                   GDTSAGGGSNGGTGGTGGSGSTPLASNQAAITVSTGVATIINMPTVSVTICAPGTSACQ
FT                   TIGNVLVDTASYGLRIVNTAASGVLGSLPVSSVSGGTLTECGKFVTSYTWGTVRTADVR
FT                   IAGEQASSLPIQIIGDLGSSGVPSSCSNGNAPSNTAADLGANGILGIGPAPYDCGANCT
FT                   TSTLYSNYYACPNGNTSCQVTTVPLAQQVANPVPRFATDNNGVIVAMNPPAGGSATGTL
FT                   TFGINTQSNNALPAGVTKLTSTTAGDLTGTLLGRAITTAFFDTGSNAYFFDTGGSTAVS
FT                   LPVCSNNSSFYCPSSTQTTTATVVGLNGAQASQSISIGNASALFSSYKSAVPNLGGPFG
FT                   NTRVLDFGLPHFFGKTLYFGMDLTGSGGAAPYVAF"
FT   gene            70687..72237
FT                   /locus_tag="BURPS1710b_0067"
FT   CDS_pept        70687..72237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY69"
FT                   /protein_id="ABA48249.1"
FT                   /translation="MRARRAVERRIVAAHGQRDRRAAARIEEVRVRAGIEERRRDRTAE
FT                   QRARQVARGRRGELRHARRQRVVRLGVDPERQRARRAAARRRVHCDDHAVVVGRKARHR
FT                   VGDLLRERHRRDLAARVAVRARVVVAVERRRRAVRAAVVRRGPDPENAVRAEIGRGVRR
FT                   RVAVRARARHAGGAQIADDLDRQRTRLLAGDPHVGGAHGAPRVARHELAALGERAAAHA
FT                   RHGQAAEHARRGGVDDPQPVRRGVDEHVADRLARGRAGRADRHADGRHVDDGRDARADG
FT                   DRRLVRRERRAARAAGAAGAAVRAAARGRVASAGAGVYRCVRAAVAAAAARGDERGRGC
FT                   GETQRAEPASQSVLEAQDLSPPGAITGCRWWRSRPAAPAAAMPDRNTSPCGRPCGRRAR
FT                   PCRSRRARAARARRATPSRPPRIAENRRRADRTDSARRGLATTARTRYPPSTRIRARPC
FT                   PSRASFRAPYSRRRPSTRRPPHGCFAVSSAPSRRYPRRAGSSARRRGLRGPARRATRT"
FT   gene            complement(71780..72283)
FT                   /locus_tag="BURPS1710b_0068"
FT   CDS_pept        complement(71780..72283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51174"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY68"
FT                   /protein_id="ABA51174.1"
FT                   /translation="MRSSRFRRLAATAAGFMCAWLAAPAHAGLGGAPMTPPAADTAATV
FT                   RSIQRSIRAAGGASTAAVGYTVRETTLGSGTVVREYVSTAGTVFALSWQGPVAPNLSDL
FT                   LGAYFPQYEAGVKASRAAHGPRAPAAIDTGGLVVHTGGHMGSYSGQAWLPQALPAGFST
FT                   NDIQ"
FT   gene            complement(72481..73209)
FT                   /gene="cheZ"
FT                   /locus_tag="BURPS1710b_0069"
FT   CDS_pept        complement(72481..73209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="BURPS1710b_0069"
FT                   /product="chemotaxis protein CheZ"
FT                   /note="identified by match to protein family HMM PF04344"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49620"
FT                   /db_xref="GOA:Q3JY67"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY67"
FT                   /protein_id="ABA49620.1"
FT                   /translation="MNEPIDVAVAGANAGERLADAADLASDRILARIGQLTRTLRDSMR
FT                   ELGLDKHVEKAAEVVPDARDRLRYVVAMTEQAAERVLTAIEVAKPVQERLQQEAAALDA
FT                   RWAKWYETPIERAEVRGLMDDTRAFLRALPDATGATNAQLLEIMLAQDFQDLTGQVIKK
FT                   IMDMVYLIEQQLLNVLVENIAPERREQFAATAAALAAEQAGGAMTPESLLNGPQINPEG
FT                   KTDVVQDQAQVDDLLASLGF"
FT   gene            complement(73211..73777)
FT                   /gene="cheY"
FT                   /locus_tag="BURPS1710b_0070"
FT   CDS_pept        complement(73211..73777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BURPS1710b_0070"
FT                   /product="chemotaxis protein CheY"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47469"
FT                   /db_xref="GOA:Q3JY66"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY66"
FT                   /protein_id="ABA47469.1"
FT                   /translation="MRRPAGTRAGRRASPVWLGQTARLARCTTAGIARSRARDREPGLA
FT                   TVTEHESGKEQTMDKSMKILVVDDFPTMRRIVRNLLKELGYSNVDEAEDGLAGLARLRG
FT                   GGYDFVISDWNMPNLDGLAMLKEIRADASLTHLPVLMVTAESKKENIIAAAQAGASGYV
FT                   VKPFTAATLDEKLNKILEKMAKAGS"
FT   gene            complement(73955..75049)
FT                   /gene="cheB"
FT                   /locus_tag="BURPS1710b_0071"
FT   CDS_pept        complement(73955..75049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="BURPS1710b_0071"
FT                   /product="chemotaxis protein-glutamate methylesterase
FT                   protein CheB"
FT                   /EC_number="3.1.1.61"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48480"
FT                   /db_xref="GOA:Q3JY65"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY65"
FT                   /protein_id="ABA48480.1"
FT                   /translation="MQKKIKVLCVDDSALIRSLMTEIINSQPDMEVCATAPDPLVAREL
FT                   IKQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVD
FT                   FVTKPRVGIRDGMLDYSEKLADKVRAASRARVRQNPQPHAAAAAAAHGHAGAAAPLINN
FT                   PLVSTEKLIIVGASTGGTEAIREVLTPLPPDAPAVLIAQHMPPGFTRSFAQRLNGLCRI
FT                   SVKEAEHGERVLPGHAYIAPGHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAA
FT                   QHAGKNALGVILTGMGRDGAAGLLEMKKAGAYTFAQDEASCVVFGMPREAIAMGGVDDV
FT                   APLSDMSRRIMARLASMGDRVQRV"
FT   gene            complement(75055..75759)
FT                   /gene="cheD"
FT                   /locus_tag="BURPS1710b_0072"
FT   CDS_pept        complement(75055..75759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="BURPS1710b_0072"
FT                   /product="chemotaxis protein CheD"
FT                   /note="identified by match to protein family HMM PF03975"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49527"
FT                   /db_xref="GOA:Q3JY64"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY64"
FT                   /protein_id="ABA49527.1"
FT                   /translation="MSGLPIATNLYFDAHFHRHGVKLLPNEFYTTREDMVLVTVLGSCV
FT                   AACLHDPIGRIGGMNHFMLPDDGADPSAAASESMRYGAYAMEVLINELIKAGGRRERFE
FT                   AKVFGGAAVLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGQA
FT                   MVKKLRVQAPDVAAREAALAREAVDPHGERAPRVRPRVELFGTPAPKAQAKPRIELFGM
FT                   RAMQPATRKQEA"
FT   gene            complement(75756..76700)
FT                   /gene="cheR"
FT                   /locus_tag="BURPS1710b_0073"
FT   CDS_pept        complement(75756..76700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="BURPS1710b_0073"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by match to protein family HMM PF01739;
FT                   match to protein family HMM PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51141"
FT                   /db_xref="GOA:Q3JY63"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY63"
FT                   /protein_id="ABA51141.1"
FT                   /translation="MPARAASRLDAPEPQERSGDAARDFEFTSADFTKIRALIHRRAGI
FT                   SLSEHKRDMAYSRLARRLRARGLNRFCDYLELLERENDPSEWEAFTNSLTTNLTAFFRE
FT                   SHHFPILAEFVKRREQPVSVWCSAASTGEEPYSIAMTLVEALGESAARSASVIATDLDT
FT                   QVLAKADAGVYAFEQVKHLSPERLKRFFLKGTGAQAGRVKVRPELRAMIRFAQLNLTDA
FT                   DYGLTKPFDAIFCRNVMIYFDKPTQSQVLARFEPLMKPGGLLFAGHSENFTYVTQAFRL
FT                   RGQTVYELTRDGQSAAPRVRARIAAAAAEEELR"
FT   gene            complement(76707..78728)
FT                   /gene="tsr"
FT                   /locus_tag="BURPS1710b_0074"
FT   CDS_pept        complement(76707..78728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /locus_tag="BURPS1710b_0074"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51094"
FT                   /db_xref="GOA:Q3JY62"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY62"
FT                   /protein_id="ABA51094.1"
FT                   /translation="MLHNWSIRTTLTAVGFMLVLVAALVGGLGLYALNHASRSLDAIAH
FT                   GDLPTIHTLDDASSYLLRSRVALDRFKTLSEAGNADEAKKVLARAQELYAKSTQNWQAY
FT                   MAASKEGIDSALTDELAARYATLAKEGVEPEFAAAGAGDLAAYHAIADTKISPMFVAYD
FT                   KAAAAVIAAYSKRAESRFDATQARISLMIALIAAGIAAAFLMVIGIRFALRGLIVQPLN
FT                   VAIAQFERIAAGDLTQATRIAGNNEIGRLFQGIGRMQTAVGDMVKAVHRGAEAVDLGAR
FT                   EISSGNADLSARTESQAASLQETASSMEQLTGTVRQNAENARQASQLAVNASDIATQGG
FT                   EVVGQVVTTMQDIATSSSKVADIIGTIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRSLAQRSATAAKEIKQLIGDSAHKVQSGSALVERAGATMAEIVQAVRRVTDIMGEI
FT                   SAASEEQSTGIVQVNRAVSQMDAVTQQNAALVEQAAAAAASLEDQTRQMKQIVSAWRIE
FT                   GASAAATPAASTSAAASVRSNVNARASASSEPHAVAHAVASATHAADATAGGAGSPRSP
FT                   AAAPASHGEQRGTHAAPHGAKPAAAPKPAAAPAAAGYAPKLAKPGAAARPAASPADAAA
FT                   PQAAPAPASSFALKRPALSGEPKPAAASASSDDDWETF"
FT   gene            78745..81768
FT                   /locus_tag="BURPS1710b_0076"
FT   CDS_pept        78745..81768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50236"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY61"
FT                   /protein_id="ABA50236.1"
FT                   /translation="MRCVRRARLCAERLDQRHLLARHQLLDVHQDQHPAVDRAEARQVL
FT                   GRQHAAEFRRGHDLLGRQREHVGHAVDDHPDDAVRDVQDDHDRLMVVLDAAEVELDPHV
FT                   DDRHDDAAQVDHALDEIGRVRDPRDAVVAADFLYFQNVDAVFLVAEREDEKLLARGVAL
FT                   FGVAAAGRVRRGRMIRLDFGHVSPLIDGSRKLGRGERGARMRAVRRAGLAIERRDVDDQ
FT                   RDAAVAENRRGRNAVHLAVVRLEVLDDHLLLAHQLVDQHREAAAFRLHDRDDALRRIGA
FT                   RVVHREHLVQRDERQVLAAHAHDALAVADRVDVVGRGLQRLHHEVQRQDEDLVADLHRH
FT                   PVENRERERQHDARRRAAAGLRRNLDVPAHRLDVALDDVHPDAAARHVGHDFGGREARR
FT                   EDQVPHFVVADVLGDLHPLLGRLREDPLAVQARAVVADLDHDVAAVVRGRQHELADRVL
FT                   ARRAARLDGLDAVIEAVAHEVRQRIDDPFDEALVELGRLAERDELDLLAELAREIAHEP
FT                   RKAAEHVIHRHHPDRHHGFLQIARVALELRHPVVQAVVQRRIERARRLGEHRLRDHELA
FT                   DQVDQLVDLLDADANRAALRARGGGRARLAIVLVLRGGGRRGLRGRRRGGCGRARRGGR
FT                   RGRARVGDGRRRRLRRGRFRRGLLGSGFGRGFARLPRRRRGLRVARARRGAAADRDLAF
FT                   VDHEAAHGDDVVRRHVGLEPQRECVARLRAADDPAEIAELLGQQFLILVVDARERDLQM
FT                   RAIAAGRGLGRAGHRMRGLDRLLDDVLGRAEEAHRGRGRRSRRRRHGLSRRNGRRRRGG
FT                   SSGRSGRGRGCRRRLRAARRRLQPLELRADRGRGGRIGLGARAVVGELVGQHVLRLEER
FT                   IDHLLRQRELMIACAIEQRFEDVRRFRERGEAERRGAALDRVRGAKDRRQILGIGRGDV
FT                   QVQQQLLHLREQLVGFVEERLVELCDIESHAGSPPKNVVFVTKGSTTPKAPRRARSARP
FT                   GRSAFRSSRSRPPRAPHP"
FT   gene            complement(78769..79296)
FT                   /gene="cheW-2"
FT                   /locus_tag="BURPS1710b_0075"
FT   CDS_pept        complement(78769..79296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-2"
FT                   /locus_tag="BURPS1710b_0075"
FT                   /product="chemotaxis protein CheW"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47949"
FT                   /db_xref="GOA:Q3JY60"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY60"
FT                   /protein_id="ABA47949.1"
FT                   /translation="MSEVQTNHPAAPNAASRRDAEQGDAAGQEFLVFTLGDEEYGIDIL
FT                   KVQEIRGYDSVTRIANAPDFIKGVINLRGIIVPIVDMRIKFHLGRVEYDHQTVVIILNV
FT                   AHRVVGMVVDGVSDVLTLSTEQIMPAPEFGGVLTTEYLTGLGTVDGRMLILMDIEKLMT
FT                   SKEMALIETLGA"
FT   gene            complement(79327..81624)
FT                   /gene="cheA"
FT                   /locus_tag="BURPS1710b_0077"
FT   CDS_pept        complement(79327..81624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BURPS1710b_0077"
FT                   /product="chemotaxis protein CheA"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF01584;
FT                   match to protein family HMM PF01627; match to protein
FT                   family HMM PF02518; match to protein family HMM PF02895"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48031"
FT                   /db_xref="GOA:Q3JY59"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY59"
FT                   /protein_id="ABA48031.1"
FT                   /translation="MTLDITQFYQTFFDEADELLAQMEQLLLNLDVASPDPEDLAAIFR
FT                   AAHSIKGGAATFGFTALTETTHILESLLDRARNHELTLTKEMVDAFLETKDVLSDQLAD
FT                   YRASAEPDAAAAAAICAKLERLKASASGAQAATAAAAAPAAPAAPAAPAAPVAAAEPVP
FT                   AATAAPATSAMGLFGAPEHVVEQAVEAAHPVAGAPEAAAGGDGPHLKITLTGVDDKDQE
FT                   LLTEELGNLGRIVGSTKTGDALALWLETDVSSDDIVAVCCFVIDESQIAIGRGTAPGAG
FT                   DAQAAPAARQPGEAAPEPAAEQAAPEPAAAQPAAAPVADARPAAPAAAPSAPAPAAAPA
FT                   AQAAASAAAQHQDDRKPRPAAAASAEGSSIRVGVEKVDQLINLVGELVITQAMLAETTS
FT                   AFDPALHDRLYNGMAQLERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDLAGKLGKQVE
FT                   LVTFGQATELDKSLIERIIDPLTHLVRNSLDHGIETVEARRAAGKDAVGQLVLSAAHHG
FT                   GNIVIEVSDDGAGLNRERILAKAAKQGMQISENISDDEVWNLIFAPGFSTAEVVTDVSG
FT                   RGVGMDVVKRNIQSMGGHVEISSQAGRGTTTRIVLPLTLAILDGMSVKVGNEIFILPLN
FT                   FVMESLQPAADDIYTIGNGERVVRVRGEYLPLVALHEVFSVDDARTDPTQGIVTIMQTE
FT                   GRRFAMLIDELVGQQQVVVKNLETNYRKVYGISAATILGDGSVALIVDVAALNRETRAA
FT                   HGAHSSAALAAS"
FT   gene            complement(81656..82036)
FT                   /gene="cheY1"
FT                   /locus_tag="BURPS1710b_0078"
FT   CDS_pept        complement(81656..82036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY1"
FT                   /locus_tag="BURPS1710b_0078"
FT                   /product="chemotaxis two-component response regulator
FT                   CheY1"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50550"
FT                   /db_xref="GOA:Q3JY58"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY58"
FT                   /protein_id="ABA50550.1"
FT                   /translation="MIRTILAIDDSATMRTLLSATLGEAGYDVTVASDGEVGLDVALAT
FT                   RFDLVLTDHHMPRKNGLELIVALRRQLGYEATPILVLTTENGDAFKDAARAAGATGWIE
FT                   KPIDPDALIELVAALSASSSLS"
FT   gene            complement(82067..83089)
FT                   /gene="motB"
FT                   /locus_tag="BURPS1710b_0079"
FT   CDS_pept        complement(82067..83089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BURPS1710b_0079"
FT                   /product="MotB"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48892"
FT                   /db_xref="GOA:Q3JY57"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY57"
FT                   /protein_id="ABA48892.1"
FT                   /translation="MSKGKDQAIIVKRVNQQKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSAVTPVQLKGIAEYFNTPLKAAIFGSGDRSADDASIIKGGGRDISSLDAGTTRRTDG
FT                   STHLAERVAKKSEDDALAQAQGSLERREQVRLHDLQVKLMAAIEANPTLRQFKQQIRID
FT                   STLMGLRIEIVDTQKRPMFAMSSDAVEPYMRDILREIGKTLNDVPNRIIVQGHTDAVPY
FT                   AGGEKGYSNWELSADRANASRRELIAGGMDEAKVLRVLGLASTQNLNKADPLDPENRRI
FT                   SIIVLNRKSELALMRDDATTTTLSSDAAGSARLAQQITPPGAAAMPALPGASGLAVQKP
FT                   "
FT   gene            complement(83106..83966)
FT                   /gene="motA"
FT                   /locus_tag="BURPS1710b_0080"
FT   CDS_pept        complement(83106..83966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BURPS1710b_0080"
FT                   /product="chemotaxis MotA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49857"
FT                   /db_xref="GOA:Q3JY56"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY56"
FT                   /protein_id="ABA49857.1"
FT                   /translation="MLIFVGTLVTLLSVFGGYALAGGHLGALVQPVEILMIVGAGVGAF
FT                   IIGNGIKTIKATLRVLPTLFKGSKYNKDIYMELMALLYVLLAKARKEGTLTLEADIDDP
FT                   EKSPIFTQYPKILADHHIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAH
FT                   ALMRVGDAMPAFGIVAAVMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGP
FT                   LASLAEQRVAESTKMFQCIKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVR
FT                   RVKAK"
FT   gene            complement(84160..84711)
FT                   /gene="flhC"
FT                   /locus_tag="BURPS1710b_0081"
FT   CDS_pept        complement(84160..84711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhC"
FT                   /locus_tag="BURPS1710b_0081"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="identified by match to protein family HMM PF05280"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49236"
FT                   /db_xref="GOA:Q3JY55"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY55"
FT                   /protein_id="ABA49236.1"
FT                   /translation="MASKSVVVEVKEITLAIELIELGARLQLLEAETNLSRDRLIKLYK
FT                   ELKGVSPPKGMLPFSTDWFMTWQPNIHSSLFYNIYRFMREHGGCDSIQSIVKAYRLYLE
FT                   HVGLSDDEAVLSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAHDPHHGYVCGLCQPP
FT                   SRAGKTRKAAAQGDQAAIAA"
FT   gene            complement(84805..85473)
FT                   /gene="flhD"
FT                   /locus_tag="BURPS1710b_0082"
FT   CDS_pept        complement(84805..85473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhD"
FT                   /locus_tag="BURPS1710b_0082"
FT                   /product="FlhD"
FT                   /note="identified by match to protein family HMM PF05247"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48191"
FT                   /db_xref="GOA:Q3JY54"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY54"
FT                   /protein_id="ABA48191.1"
FT                   /translation="MAEKECESRAPQWRALRPHAVLAPEGDVFPALIGGAFGRPGVRRR
FT                   FPPFVGKIPTRFTDNSGKAHSPSLIAAPPSIGQNARKNINKPIAPFAVGRSSKRFHWHY
FT                   RLAKDFLRGNRIMSATSEMLAEINEVNLSYLLLAQRLLREDKAMGMFRMGISEELADVL
FT                   ANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSSAVSHAHSAILMAGQPVESLR
FT                   "
FT   gene            85581..86783
FT                   /locus_tag="BURPS1710b_0083"
FT   CDS_pept        85581..86783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0083"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47574"
FT                   /db_xref="GOA:Q3JY53"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY53"
FT                   /protein_id="ABA47574.1"
FT                   /translation="MNRNARSGDVRRVPPRLPAGRRSPLTGAKLAPPLGEFLPLRNGET
FT                   LMRIAQIAPLYEAVPPKLYGGTERVVSYLTEALVEMGHDVTLFASGDSVTSARLEAAWP
FT                   RALRLDPSIRDAMAPHMRLLEQVARAAHTFDILHFHLDYLPFPLLSRLDAPFVTTLHGR
FT                   LDLPELQPVFDAFPNAPVVSISDSQRTPLPQAGWAGTVYHGLPDTLLTPQAGRKPEYLA
FT                   FLGRICPEKRVDTAIRIAAQSGLPLKIAAKVDKVDEDYFKAEIEPLLDSAHVEFIGEIN
FT                   EAQKPAFLSGAKALLFPIDWPEPFGLVMIEAMACGTPVVAFNRGSVPEVIDDGLTGFIV
FT                   EDVQGAVGALHRIDELSRDAIRAQFEQRFSSHAMARRYIDIYETLRGATKQPQWQRVAA
FT                   G"
FT   gene            complement(86887..87183)
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0084"
FT   CDS_pept        complement(86887..87183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0084"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50703"
FT                   /db_xref="GOA:Q3JY52"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY52"
FT                   /protein_id="ABA50703.1"
FT                   /translation="MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQ
FT                   DLGFAERARRGRPPKKGPLPAKYRDPKSGNTWSGRGKPPHWIVGKNRERFLIG"
FT   gene            87489..88193
FT                   /gene="aqpZ"
FT                   /locus_tag="BURPS1710b_0085"
FT   CDS_pept        87489..88193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="BURPS1710b_0085"
FT                   /product="aquaporin Z"
FT                   /note="identified by match to protein family HMM PF00230;
FT                   match to protein family HMM TIGR00861"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49443"
FT                   /db_xref="GOA:Q3JY51"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY51"
FT                   /protein_id="ABA49443.1"
FT                   /translation="MKLPQRLAAEVFGTFWLVLGGCGSAVLAAAFPGLGIGFAGVALAF
FT                   GLTVLTMAFAIGHVSGCHLNPAVSVGLTVAGRFPARDLVPYVIAQVIGATLGAFVLYLI
FT                   ATGKPGFDVAGSGFATNGYDARSPGHYSLAAAFICEVVLTGFFLFVILGSTDKRAPAGF
FT                   APIAIGLCLTLIHLISIPVTNTSVNPARSTGPALFVGGEAIGQLWLFWVAPIIGAAIAG
FT                   VVYPLVAGRDES"
FT   gene            complement(88382..89224)
FT                   /gene="cof"
FT                   /locus_tag="BURPS1710b_0086"
FT   CDS_pept        complement(88382..89224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="BURPS1710b_0086"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48689"
FT                   /db_xref="GOA:Q3JY50"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY50"
FT                   /protein_id="ABA48689.1"
FT                   /translation="MHPPMSAMYKAIATDLDGTLLNSDHQLDPYTIDTVRRLAGSGVPF
FT                   VIATGRHYADVAGIRDLLGIRPYLITSNGARVHGPDDTRIHAQDVPADAVRQLVRPELV
FT                   GTHGRVIVNLFTNDGWLIDRDAPQLLAFHQDSGFRYEIVDTLAHDGADIAKVLYIGEPE
FT                   DLAVVSGNLARRFGDALYVTYSLPDCLEVMTANVSKGRALRVVLERLGVDPAHCVAFGD
FT                   NMNDIDLLETAGYPFMMNNANPDLALRLPKVPRIGNNFEAGVARHLRALFALEDSIAH"
FT   gene            complement(89321..90211)
FT                   /locus_tag="BURPS1710b_0087"
FT   CDS_pept        complement(89321..90211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0087"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family superfamily"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47871"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY49"
FT                   /protein_id="ABA47871.1"
FT                   /translation="MGNDIFLIGIDGGGTGTRAVLADARGRELAQGSAGPSGLALGIEA
FT                   AWRSIEAASAEACARAGVAFDWRHCVLGCGLAGVNHRAWLNAFRASAPLAALAIESDAY
FT                   TTVVGAHGGAPGVIVALGTGSIAAALDASGACRIAGGYGFPSGDEASGAWLGLRALSYA
FT                   QQALDGRAPLDALARALVAHTGAPDRDALIVWSCEANQTAYAQLAPIVLAHRDHPAAAH
FT                   WIEQAGIEIGRMIDALDPAAALPVALCGGLAQALASAVPEPHGARLVAPQADSAHGALR
FT                   LAEREAARLGLTAPR"
FT   gene            90362..90970
FT                   /gene="tag"
FT                   /locus_tag="BURPS1710b_0088"
FT   CDS_pept        90362..90970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="BURPS1710b_0088"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by match to protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50355"
FT                   /db_xref="GOA:Q3JY48"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY48"
FT                   /protein_id="ABA50355.1"
FT                   /translation="MPKQGRCSWVKTEADAHYHDTEWGVPSRDDRHLFEMLVLEGAQAG
FT                   LSWSTILNKRAGYRAAFAGFDIDEVARFTPKRIDELMLDASIVRNRAKIEAAVANARAV
FT                   QQIRAEHGSLAAFLWSFVDHSPLQNAWASYRDAPASTERSDALSQALKRYGCKFVGSTI
FT                   CYALMQATGMVNDHESTCPCHARCAALGEKARRRKKPAA"
FT   gene            complement(91357..91728)
FT                   /locus_tag="BURPS1710b_0089"
FT   CDS_pept        complement(91357..91728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0089"
FT                   /product="30S ribosomal protein S21.-related protein"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48583"
FT                   /db_xref="GOA:Q3JY47"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY47"
FT                   /protein_id="ABA48583.1"
FT                   /translation="MLVAERFAVHSASLFRPPRPLPARFACSWKRPEGRCVALGRYVFD
FT                   RIKQIRNDMTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAA
FT                   AVKRLHKRLRSQMLPKKLH"
FT   gene            91845..93293
FT                   /gene="fliC"
FT                   /locus_tag="BURPS1710b_0090"
FT   CDS_pept        91845..93293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="BURPS1710b_0090"
FT                   /product="flagellin"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48561"
FT                   /db_xref="GOA:Q3JY46"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR022578"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY46"
FT                   /protein_id="ABA48561.1"
FT                   /translation="MVYRFSARAIRVHARSRRLAGRRTARRSHARFVRIQRWLTERSTQ
FT                   KIRAESRPAPSSFFGVRRNPAQGGRQRTSASARANSGIDGLIQLNLEIFMLGINSNINS
FT                   LVAQQNLNGSQGALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGLNQGVSNAND
FT                   GVSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQISEVNRIASQ
FT                   TNYNGKNILDGSAGTLSFQVGANVGQTVSVDLTQSMSAAKIGGGMVQTGQTLGTIKVAI
FT                   DSSGAAWSSGSTGQETTQINVVSDGKGGFTFTDQNNQALSSTAVTAVFGSSTAGTGTAA
FT                   SPSFQTLALSTSATSALSATDQANATAMVAQINAVNKPQTVSNLDISTQTGAYQAMVSI
FT                   DNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSADFAQETANLSRAQV
FT                   LQQAGISVLAQANSLPQQVLKLLQ"
FT   gene            93337..95010
FT                   /locus_tag="BURPS1710b_0091"
FT   CDS_pept        93337..95010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY45"
FT                   /protein_id="ABA50732.1"
FT                   /translation="MRRSNTLVAAARFCFLILPNSAKFAGRLRRRREPPDVHARHQHDA
FT                   AANQLGAAASSAVDHQRLDGQFVDGRQLARHRARQREDGRPERGAVDFDRDRPDDAFRA
FT                   RHAEGRAHRAASGDRLAQRRHADPEIHRHGNGHRAHRDDGRGCGGRQLLGRRHADRHVA
FT                   DAVFRRIQCDAAARHRHADAERRRQIDVDLDRFDEQHAFRHRRRDQLRVEQPRRDGDDR
FT                   HGHRRRAPRAALGKHGRGQRDQRRREQPVRRQRAVEPRRHVDGEHDGRPVDDPLGRQRR
FT                   MDAKHLRSGRRIHGGRHRRVEREQRSVGCDRRRHAEPHASRRRRHADAERDHRHHRAGH
FT                   RDHERRQPVQHGDHDDVVAVVAIRRGHQLAKRGAAPRRLHAQHDPQLARARGGRGRDDG
FT                   RLDHVARVDRHQVRRRLVVVADGRRTDHRYGQAQRRAAKQPVDRRRALQFDERHRRAAE
FT                   HHDPELCADGRRLRYALERAEPGPEEPRAAADAARVVRVATHVAIQRAVHRAQHADGAD
FT                   EQQLELPDAAVRRQQQLGRDGEQQVTNRTRWRSLKWIRCR"
FT   gene            93443..94963
FT                   /gene="fliD"
FT                   /locus_tag="BURPS1710b_0092"
FT   CDS_pept        93443..94963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="BURPS1710b_0092"
FT                   /product="flagellar hook-associated protein"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47553"
FT                   /db_xref="GOA:Q3JY44"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY44"
FT                   /protein_id="ABA47553.1"
FT                   /translation="MSTPVTSTTQQQTNSALQQAAQSIISGSTGNSSMDVNSLVTALVN
FT                   AKTAGQSAALSTSIATDQTTLSALGTLKAALTALQAGIGSLSDGTLTQKFTATATGTGL
FT                   TATTGAGAVAGSYSVAVTQIATSQTLSSGAFNATQQLGTGTLTLSVGGKSTSISIDSTN
FT                   NTLSGIAAAINSASNNPGVTATIVTGTDGAHLVLRSASTGAANVINVGVSNLSGDNGLS
FT                   SLAVTSTASTTGGQSTIRSGGSVAWTQSTSAQDAEFTVGGIAASSASNAVSGAIAGVTL
FT                   NLTQAAVGATQTLNVTTDTTAQATAITNVVNLYNTVITTMSSLSSLSGAGTSSQSAGPL
FT                   LGDSTLNMIRNSLARVVGAGVTTGGSTTSLASIGIKFADGSSSSQTDGALTIDTAKLNA
FT                   ALQNSPSTVAALFNSTNGIGAQLNTTIQNYVQTGGVFDTRSNALNQDLKSLAQQQTRLA
FT                   SYASQLTSQYNAQFTALNTLMAQMNSNSNYLTQLFGGSNSSGAMANNK"
FT   gene            94977..95291
FT                   /locus_tag="BURPS1710b_0093"
FT   CDS_pept        94977..95291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49005"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY43"
FT                   /protein_id="ABA49005.1"
FT                   /translation="MEKPEMDQMSLIEHVLSITREIDHAVQMADWTEAVRLTEERSPYL
FT                   MSITAEQTPASLALVRQLQAIDTALLANAKAAQAELQVEYRTAMDRLSQAGAYQAAAQL
FT                   "
FT   gene            95379..97844
FT                   /locus_tag="BURPS1710b_0094"
FT   CDS_pept        95379..97844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0094"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51108"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY42"
FT                   /protein_id="ABA51108.1"
FT                   /translation="MSGRRRRPGADDSPNWRLFPVQFAALARSARPDNFHHCTLRPANP
FT                   MSESTTSDTLTPEQQFEEDIALVLKNAIELHHQGDFENARALYEAIVDAKPDHADAQYD
FT                   LGVLKVQIGRAADALPHFEIALGGAPNNGQYWVSYVNALIDAGQIAAAWTALGLCQQRG
FT                   VRGPAVDGLILRLAHSEEGKPAYIGTAAAAPEAAAPADAAANAAEPARADARKPSEQDV
FT                   RRFATLYNKRRMAEAIKFARALAQRYPGSGVAWKSLGFALHRDGQYGPACEALTKGAAM
FT                   LPDDAECNTLYADTLRVLNRLADAEAQVRRVLDGTPDYAEAHRVLNMTLSARGRYQEAI
FT                   EAGRRSVELAPNSVNAHGSLAVTLSDYGQTDEAEIHFRRAHELNPKDPMAYSNLLFCQS
FT                   HKIDVSIRELFDAHRAFGELYEAPLRGATPKHANSRDPERRLRIGFVSGDLFLHAVSSY
FT                   LLPLVDELAKDPSVSLHFYYTFAREDSVTERIRSYAQGWHMVMPLSDEQFAERVRHDRI
FT                   DILVDLSGHSGRNRLPMFARKPAPIQVSWIGYPGTTGLEAIDYYLADPYAVPFGPMQAQ
FT                   FTEKIVHLSSGATFSPDGNAPPVNMLPALHNGHVSFGSFNRLNKLRGDVIAVWARIMRA
FT                   VPGSRIVLGSIPKDGGGAAMIEWFEQEGIARERLSFQPRSVTAVYLQQHHHVDVCLDTF
FT                   PYTGSTTVLNALWMGVPTLTMRGETLPSRAGLTWMSHVGLESFIADDIDDFVAKGIALA
FT                   SDIPALARIRGELRERCMRSPAFQPQRVAQDVSDAFRIMWRRWCDGQPPAPFAVPPRDA
FT                   TTTVAGDRS"
FT   gene            97841..98989
FT                   /gene="vioA"
FT                   /locus_tag="BURPS1710b_0095"
FT   CDS_pept        97841..98989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vioA"
FT                   /locus_tag="BURPS1710b_0095"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50137"
FT                   /db_xref="GOA:Q3JY41"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY41"
FT                   /protein_id="ABA50137.1"
FT                   /translation="MSALPLRAVEPWIDERIFVTQPHLAPLAEFLPYLEAIWESKVLTN
FT                   GGPFHQQLEKALCDYLGVRHLALFTNGTLALVTALQALRITGEVITTPYSFVATAHSLL
FT                   WNGIKPVFVDIDPSTLNLDPAKIEAAITPQTTAIMPVHCYGRPCDVAAIQKIADNYNLK
FT                   VIYDAAHAFGVKTPDGSVLEHGDMSILSFHATKVFNTFEGGAIVCPDAKTKQHIDHLKN
FT                   FGFVDEVTVVAAGINGKMSEINAAFGLLQLKHIDDALARRAKIDAAYRDALARVPGIRC
FT                   LPPVDAPVANHSYFPILVGDDYPMSRDALYQRLRDHQIYARRYFYPLISDFPMYRGLPS
FT                   AQRGNLPVAADAAARVLCLPIYPALSDASLERIVSLMAGAHA"
FT   gene            98986..100020
FT                   /gene="fabH"
FT                   /locus_tag="BURPS1710b_0096"
FT   CDS_pept        98986..100020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="BURPS1710b_0096"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48957"
FT                   /db_xref="GOA:Q3JY40"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="PDB:3GWA"
FT                   /db_xref="PDB:3GWE"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY40"
FT                   /protein_id="ABA48957.1"
FT                   /translation="MTPAAHPPRAAIADIAGHLPEQVLTNDVLAQLYPDWPAEKILAKT
FT                   GIRERRIAAPRETAADLAYEAARKLFAQGAVGADQVDFVILCTQAPDYVLPTSACMLQH
FT                   RLGIPTHAGALDVNLGCSGYVYGLSLAKGLVETGAARCVLLLTADTYSKYLHPLDKSVR
FT                   TLFGDGASATAVIAEHGELERIGPFVFGTDGRGAPNLIVKAGLFREPKSADSAREHEDA
FT                   SGNVRTDEHLYMNGAEVMAFSLAEVPRAADRLLALAGEPRENIDCFVLHQANRFMLDAL
FT                   RKKMKIPEHKFPVLMEHCGNTVSSTLPLALETMRANGTLARGMRLMLLGFGVGYSWAGC
FT                   LVNF"
FT   gene            100029..100253
FT                   /locus_tag="BURPS1710b_0097"
FT   CDS_pept        100029..100253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50351"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY39"
FT                   /protein_id="ABA50351.1"
FT                   /translation="MMNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADD
FT                   CFGVLLNGQALGNCKTVADIDALVAAQKG"
FT   gene            complement(100043..100270)
FT                   /locus_tag="BURPS1710b_0098"
FT   CDS_pept        complement(100043..100270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0098"
FT                   /product="cell wall surface anchor family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49581"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY38"
FT                   /protein_id="ABA49581.1"
FT                   /translation="MRRAHDQPFCAATSASISATVLQLPSAWPLSSTPKQSSASAIVDT
FT                   IASESQLCSPSASAGVTSLASISKISARPS"
FT   gene            100256..101320
FT                   /gene="fabH"
FT                   /locus_tag="BURPS1710b_0099"
FT   CDS_pept        100256..101320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="BURPS1710b_0099"
FT                   /product="3-oxoacyl-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47852"
FT                   /db_xref="GOA:Q3JY37"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY37"
FT                   /protein_id="ABA47852.1"
FT                   /translation="MSTPHAVAGREIRLGGARLAGIVSCLPSREIDNDAFVARFGEGPV
FT                   RDVVKMIGVERRRWAAEHETTSDLCRAAGAHLLRELDWRPDSVDAVIFVSQTPDYRLPG
FT                   TSFVLQAAWGLPQASIALDVNLGCSGYPQALWLGTNLIATGAARRVLLAVGDTISKLVD
FT                   PNDRSTSLLFGDAGTVTALEADGAAGDAHFVIGADGRGARNLIVPSGACRPYDAQADAR
FT                   LAQRSPGHLFMDGGEIFNFTLQGIPPLVAHTLAFANTSVDQYDAFLFHQANLFMLKHLA
FT                   KKAGLPAERVPINIGTYGNTSCASIPLLMTTALQAQLAARPMRLAMFGFGVGYSWASAS
FT                   LAVEPLSVIDNIEL"
FT   gene            101260..102081
FT                   /locus_tag="BURPS1710b_0100"
FT   CDS_pept        101260..102081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0100"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47689"
FT                   /db_xref="GOA:Q3JY36"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY36"
FT                   /protein_id="ABA47689.1"
FT                   /translation="MGVGIARRRTAFRHRQHRAMTMFSERCLAGGTYLVTGASSGIGRA
FT                   AAIAIAQLGGRLVLGGRDPARLADTLAALPGDGHASHAAALDDADAAADWVGALAETHG
FT                   PLAGVFHAAGVELIRPARMTAQAQLEQVFGASLYAAFGIARAAAKKNVIADGGSVVYMS
FT                   SVAGSTGQVGMTAYSAAKAGIEGLVRSLACELAPRRIRANAIAAGAVKTEMHARLTRGT
FT                   PEDALAAYEASHLLGFGEPGDVAAAAIFLLSGASRWITGTSLVVDGGYKVR"
FT   gene            102081..102713
FT                   /locus_tag="BURPS1710b_0101"
FT   CDS_pept        102081..102713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0101"
FT                   /product="hexapeptide transferase family protein"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48789"
FT                   /db_xref="GOA:Q3JY35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY35"
FT                   /protein_id="ABA48789.1"
FT                   /translation="MTPRLIVAGCGAFARELINWADDAAHAGIGQRITGFLDANPAALA
FT                   GFPYRAEWLGDIDAYTPEDGDELIVAIGDPNAKRDVVERLRARGARFGSLRHPSAVVAR
FT                   SASLGAGVVLCPHAVVSADAQIGDFVAVNVLSSIGHDVKIGAYSTLSSHVDLMGHVETG
FT                   ERVFFGSGAKILPKVRIGAGAKIGAGATVMRSAPENAVLYTMPAKKL"
FT   gene            102715..103779
FT                   /locus_tag="BURPS1710b_0102"
FT   CDS_pept        102715..103779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0102"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51166"
FT                   /db_xref="GOA:Q3JY34"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY34"
FT                   /protein_id="ABA51166.1"
FT                   /translation="MNFDTDLLHRHWHLGCHRRELPNDGDFVRFDTAIGEIVIFNDAGE
FT                   LVAFDNRCPHRGARMYVDDSGNQPASCPYHGWTYREGRLLIPGRERFDGCALERAKLRT
FT                   FAVDWCGDFLFFAVHPQTDLYTQLGRFAEAVENISFNIDRRLDLNRYDFECYWPLAIEN
FT                   ALEPYHIGAVHPQTLATLGLEDGENVFDGVNCAWYAPVGASRQRNQLARLKRFFNLDYQ
FT                   YEGYASIYLFPFTMISSTYGYSYSLQHFLPAGVGGDRTRFTSRLYAAPAASEQAAQALG
FT                   AFFESTRDVNRRVFEEDHAICKRMPRNAWSMAPLACAADTEAKIDHFRRACRTFAASRA
FT                   ALPVVDATREAAAG"
FT   gene            complement(103859..104776)
FT                   /locus_tag="BURPS1710b_0103"
FT   CDS_pept        complement(103859..104776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48269"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY33"
FT                   /protein_id="ABA48269.1"
FT                   /translation="MHRRSSAHSPPRSARPHDTNVLNANIMEAHRCIICETKTSYFFSK
FT                   DYPTYPGSPFEDTLTVDFWKCPHCGFVVSKTHQEMTQDQWSQLNSSWHHNFENNRESRT
FT                   TNQPPYADQALVLAILKENDILDLDDGLDYAAGYGTFSKCLKKYFNIGIRIFDRYVHSS
FT                   DEGMRYVAQKELSRYKLVINSAMFEHVLNRHALDEVNGLVKDDGVLMLHTVVCERIPKD
FT                   PGWFYIDTMVHTALHTNKSMSILMDQWGYGASIYSPQAKSWFLFKRDNPLIDDLEAKVA
FT                   GINHELQTTYLHYKRGFVDYWKGF"
FT   gene            105889..106512
FT                   /locus_tag="BURPS1710b_0104"
FT   CDS_pept        105889..106512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0104"
FT                   /product="LysE family protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49800"
FT                   /db_xref="GOA:Q3JY32"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY32"
FT                   /protein_id="ABA49800.1"
FT                   /translation="MSVETWLAFAGASIVLLMIPGPTILLVIGDSLANRHRSSWSTVAG
FT                   VAAGDTTAMTISLAGAGALLAMSAAAFTALKLVGGGYLVYLGIRSTLHARRIGAMDVRI
FT                   ERRSAKRRFLSAWAVTALNPKSIVFFVAFVPQFISPHETFARQCAILLPTFVCLAAINA
FT                   ACYARIARFAAARLTGAAAQRRFGYGGGAALIGAGALTLGMSRS"
FT   gene            complement(106813..108546)
FT                   /gene="acpA"
FT                   /locus_tag="BURPS1710b_0105"
FT   CDS_pept        complement(106813..108546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="BURPS1710b_0105"
FT                   /product="acid phosphatase"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50516"
FT                   /db_xref="GOA:Q3JY31"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017768"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY31"
FT                   /protein_id="ABA50516.1"
FT                   /translation="MRASPVRAPTRGGPSNQPEDRGAEVTDKHPPSTDLPEDPDRRRVL
FT                   GGIAALGASVALAGCETAVPAAPRSAAELRLDAALRREVRNIVVIYAENRSFANLFGDF
FT                   PGVQQPLGAVSPERYAQLDRDGKTPLATLPKIWGGLVPQAQVVDGKRYMIGEHDIVGLP
FT                   NAPFVIPDTQGKPLPNGVITRDLWHRFYQNQMQINGGRNDQFAAWADSGGLVMGHYRNS
FT                   AETLRLWNLARGYTLCDNFFMAAFGGSWLNHIFLISAQAPLYPDVHQSPAKHLVSVVEG
FT                   DDPAGTRLKLAADSPASALDGPPKFENDGLFTPDGYAVNTMAPPYQPSSVRPPVEGNPA
FT                   YADPSNPRVLPPQHYATIGDRLSEKGVDWAWYGGAWQYALEHRDTGSVPDFQYHHQPFN
FT                   YFASYAPGTEARRRHLRDAGLGDDPSTNHLIADIDAGRLPTVTFYKPQGNLNMHAGYAD
FT                   VASGDRHIATVIEHIMRGPQWAHTVVILTVDENGGWWDPVSPPKGDRWGPGSRIPAMVI
FT                   SPFAKKGYVDHTLYDTNSILRFISRVHGLAPLDGVLARERAFAARGAQPPGDLTEALDL
FT                   G"
FT   gene            complement(108829..108975)
FT                   /locus_tag="BURPS1710b_0106"
FT   CDS_pept        complement(108829..108975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48219"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY30"
FT                   /protein_id="ABA48219.1"
FT                   /translation="MAEPFLLGAAAPACAALAADRASAMRAPERGAGRGESRIRHASRS
FT                   RRR"
FT   gene            complement(109019..109705)
FT                   /locus_tag="BURPS1710b_0107"
FT   CDS_pept        complement(109019..109705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0107"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF05643"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50717"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY29"
FT                   /protein_id="ABA50717.1"
FT                   /translation="MRAAMFKFITARRLAAASVLALLAACAAPAKHVDYTAFKKSQPRA
FT                   ILLLPPQNDTSDVKATYGLLSQMTRPVAEAGYYVVPVAVMEETFKQNGLTNAADIQTVS
FT                   PAKLRDIFGADAALYTTVTQYGSVYTVLDSTTVVSASAKLVDLRTGDLLWQGSGRATGK
FT                   ELGSNVDFSGFGLIATLAQAAVKQIAHTLSDDAVDVAGLTSGRMLSAGQPNGLLYGPRS
FT                   PKYGTD"
FT   gene            complement(109702..110130)
FT                   /locus_tag="BURPS1710b_0108"
FT   CDS_pept        complement(109702..110130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0108"
FT                   /product="unnamed protein product"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49861"
FT                   /db_xref="GOA:Q3JY28"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY28"
FT                   /protein_id="ABA49861.1"
FT                   /translation="MKKTFKTGAWLPVAAAGVLLAGCAANQPKPLYQWDGYQPQVYEYF
FT                   KGQKSPEDQIDALEKALQQIRAKGNRPPPGFEAHLGMLYASVGKEQQAEQSFQAEKASF
FT                   PESSPFMDFLLKKKAAAPQAKPSAPAQPQTQTQTQAQQ"
FT   gene            complement(110190..110867)
FT                   /locus_tag="BURPS1710b_0109"
FT   CDS_pept        complement(110190..110867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0109"
FT                   /product="CsgG family protein"
FT                   /note="identified by match to protein family HMM PF03783"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49268"
FT                   /db_xref="GOA:Q3JY27"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY27"
FT                   /protein_id="ABA49268.1"
FT                   /translation="MKTSKTVLACLAASAIVALSGCATEASRTLPVPPSASAQKPFAGK
FT                   PVGIAVGKFDNRSSYMRGIFTDGVDRLGSQAKTILVTQLQQSRRFNVLDRENLDEIKQE
FT                   AAFMKKAQAVKGANYVVTGDVTEFGRKEVGDQQLFGILGRGKSQIAYAKVNLNIVDTTT
FT                   SEVVLSSQGAGEYSLSNREIIGFGGTAGYDSTLNGKVLDLAIQDAVNHLVEQVDAGALA
FT                   SGK"
FT   gene            110701..110895
FT                   /locus_tag="BURPS1710b_0110"
FT   CDS_pept        110701..110895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48456"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY26"
FT                   /protein_id="ABA48456.1"
FT                   /translation="MSNLPTAMPTGLPANGFCALADGGTGSVRDASVAQPDNATMADAA
FT                   RHARTVFEVFKRWSLLGDR"
FT   gene            111607..112725
FT                   /gene="pcaD"
FT                   /locus_tag="BURPS1710b_0111"
FT   CDS_pept        111607..112725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="BURPS1710b_0111"
FT                   /product="3-oxoadipate enol-lactone hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50971"
FT                   /db_xref="GOA:Q3JY25"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY25"
FT                   /protein_id="ABA50971.1"
FT                   /translation="MHRCVSIPYISRCRLYRRVRRACGTPGFACCTCRIRHVPRWQARL
FT                   ISRYVGDNVARRFHRSARESGNHDDCRRLLRHAHRFRAFARTPLTDSLPSDLIDMPFVT
FT                   IDGQPLHYQIRGAGAPVLFGHSYLWDSSMWEPQLDALSKSYRVIAPDLWGHGRSGPLPD
FT                   GTRSLDDLARQMSELLDHLDIDTCSIVGLSVGGMWAVPLAHRAPQRIDRLVLMDTYVGV
FT                   EPDATRNQYFQMLEAIDAQGAIPAPLLDAIVPIFFRPGIDPASELPTGFRRALQAFTTE
FT                   RLRDSVIPLGKITFGREDARAQLSALPADRTLVMCGANDVARPPEEADEIAALIGCEKA
FT                   FVPNAGHISNLENPAFVTQALSDWLGRGAARA"
FT   gene            complement(112778..114595)
FT                   /locus_tag="BURPS1710b_0112"
FT   CDS_pept        complement(112778..114595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0112"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50171"
FT                   /db_xref="GOA:Q3JY24"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY24"
FT                   /protein_id="ABA50171.1"
FT                   /translation="MSPFMLSSIRSRILVACLAIVIGSLVINTALNYFVANRYNRESIS
FT                   QNLSAVLTGHEAGIADWVASKTQMIVSVEDAAISPDPIPALKQIAAAGGFTNVYVGYAD
FT                   KTAKFSDPTGIPPDYDPTGRPWYKQAAQAGKPVVTPPYVDVGTGKLVVAFAAPIMRDGA
FT                   LKGVVSGDVAMDSVIANVKAIHPTPGSFGMLVDRSGHIVAHADSKLTLKPVTDLSDDLS
FT                   LDALAAASADENAAPIDAHVAGAAKLMRARAVPGTDWLTVVALDKSDATAGMHSLLLVS
FT                   IGTLVALAAVAALIVGAITGVAFRGLARIRDAMESIGSGTGDLTQRLPDSGRDEVAQIA
FT                   RSFNAFVSKLQEVMRVIRDASESVRHAAGEIASGNHDLSRRTESAAASLQQTAASIEEI
FT                   TSTVTQSAGAARQANDIATNAASVASRGGTVVSDVVSTMHEIEGASGKIADIIGVIDGI
FT                   AFQTNILALNAAVEAARAGEEGRGFAVVAGEVRSLAQRSAQAAKEIKALIDSSVTSVST
FT                   GATLVQQAGQTMSDIVGTVSNVTTIMREISNAADEQTRGIQEVNRAVAQLDEMVQQNAA
FT                   LVEQSAAAASALQTQAVELADAVGQFKVA"
FT   gene            complement(114864..116525)
FT                   /gene="glcD1"
FT                   /locus_tag="BURPS1710b_0113"
FT   CDS_pept        complement(114864..116525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD1"
FT                   /locus_tag="BURPS1710b_0113"
FT                   /product="hexose oxidase"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF08031"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49675"
FT                   /db_xref="GOA:Q3JY23"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY23"
FT                   /protein_id="ABA49675.1"
FT                   /translation="MSYVYVDGADPRHSTLQKGFNLRWPPTAEAGAAAIYVCRTADDVI
FT                   AASRDALAKGCRITVRSGGHCYEGFVANRLPDDHGRPLAIIDLGLMSGFDIDDRGQIAS
FT                   PFDAAGAPRYRVRVAAGRQNWDGYVGLYKTMGKTLPGGSCYSVGAGGHIVGGGYGLLSR
FT                   LHGLTVDWLTGVDILAPAAGGALGAKHVHSGSTDPADRALFIACRGGGGGNFGVILNYY
FT                   FNALPNAPRTAYWLTLAYDWSHFTQASFGHFLQTYWDWFSRNDANWNAADPALANGGLF
FT                   TLLKLQHRSAGPIVLAIQYTGKDGTVGGPEDAPFIDFVDTMNAAANRLPVVWDRFVAPN
FT                   LPALGHPLAGLRIAHAARSALKMDWLYLTQTINTSGANRRGKYKSAYQIGNFGETEVDA
FT                   LWRYLNGADDPRLSQTLVQIDSYGGCVNANDESANPTSVYQRRSLLKSQYQTYWTNPAD
FT                   DAFHVEWLHDLFSAVHADQGGKPYRDASGRYEGCYINYPDIDMKYLGSDPAQIDPRWLD
FT                   LYYGDKAASLIATKRSVDPSNLFMHEMSIPLTPPLG"
FT   gene            complement(116708..117352)
FT                   /locus_tag="BURPS1710b_0114"
FT   CDS_pept        complement(116708..117352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0114"
FT                   /product="Chitin binding domain"
FT                   /note="identified by match to protein family HMM PF03067"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49030"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="PDB:3UAM"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY22"
FT                   /protein_id="ABA49030.1"
FT                   /translation="MSTTDSRSATKSSSISPRHGRVITPESRAVYLYEAGRLDFGQVNE
FT                   LEGGKFFPATQSGLRDPDAPDDVANGMPPRDGEIASGGRTADARAQLNEPDSVAHWQKH
FT                   AVRSGQSLQISWSYSMPHKTRRWTYWITKPGWDTQARLARAHFEPDPLKVYLNTYQPYW
FT                   GPDADKELIPQGETIHEFNLPTRTGYHVLLAVWDVADTANAFYQVIDLNFA"
FT   gene            complement(118253..118501)
FT                   /locus_tag="BURPS1710b_0115"
FT   CDS_pept        complement(118253..118501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47454"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY21"
FT                   /protein_id="ABA47454.1"
FT                   /translation="MTVSKRAMHTDWVDPDDAPELTDEFFERADEYVGDRLVRRGPGRP
FT                   LGSHKTATTIRLDDDVLDAFKATGRGWQTRVNAALKE"
FT   gene            complement(118658..119878)
FT                   /locus_tag="BURPS1710b_0116"
FT   CDS_pept        complement(118658..119878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0116"
FT                   /product="gp30"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49066"
FT                   /db_xref="InterPro:IPR021815"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY20"
FT                   /protein_id="ABA49066.1"
FT                   /translation="MRPRQDGAAVRTVRSLDIWRVFLWGGPRRVSAQPSATSGASSCIC
FT                   ALMMNDDEIQAWVADPKRAGTLPFAAFEPRYPHKGVGAALAVRGVLYFKGGYSRDVRRE
FT                   ISACFDQYKEVASGALRWFFLEGKRAVSIAKAPSLATLAASLSEDQPFTFAFTSGDSTR
FT                   EASMYGFDAFCLEKWQAALGTRGLDVLSFSLPVPVVKADPDLLPRLFAEFARRLNAIHG
FT                   HAGYAVNLPPTAREENESSEYFMSNRLGPGLDVGDPFATEVRSLMDNIKTVDWLTLISA
FT                   SMVDRVGGVSVLKSELPMDWYRLTQCSEGLLIRAGVLPAAGVNAGSGDKPVGPPPAYVV
FT                   LNAALRHLIPDTVSILQRGTVNGDAPVFNSKTSSNAWLRRLDVSSDELLAAKAAVLDTP
FT                   RLSDSSS"
FT   gene            complement(122160..122477)
FT                   /locus_tag="BURPS1710b_0117"
FT   CDS_pept        complement(122160..122477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0117"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49498"
FT                   /db_xref="GOA:Q3JY19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY19"
FT                   /protein_id="ABA49498.1"
FT                   /translation="MKRASAEGFNLIQHTVDDTEHLLAKPGVRAAYDALEDEYMALRAI
FT                   LAIRHEAGLTQAQVAERMGTTASAVSRLEASLSSEKHSPSFATLRKYAAAFGKRLVISF
FT                   A"
FT   gene            complement(122485..122805)
FT                   /locus_tag="BURPS1710b_0118"
FT   CDS_pept        complement(122485..122805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0118"
FT                   /product="putative bacteriophage protein"
FT                   /note="identified by match to protein family HMM PF05973"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50322"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY18"
FT                   /protein_id="ABA50322.1"
FT                   /translation="MDSRLLQRARQTRRLRAAGRDSGRLSAAPGLDAGVRRGFAYAALA
FT                   SNGGGLFELRPKGREGIGRVFYCTHVGQRVVVLHSFVKKTQETPQNELRTARVRLSEVR
FT                   NG"
FT   gene            complement(124275..124350)
FT                   /locus_tag="BURPS1710b_0119"
FT   tRNA            complement(124275..124350)
FT                   /locus_tag="BURPS1710b_0119"
FT                   /product="tRNA-Arg"
FT   gene            124626..125525
FT                   /locus_tag="BURPS1710b_0120"
FT   CDS_pept        124626..125525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0120"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48618"
FT                   /db_xref="GOA:Q3JY17"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY17"
FT                   /protein_id="ABA48618.1"
FT                   /translation="MSEAPHGAPIKTPGQLIAVVIASFVIPIAIIVLFATYANHAFRTG
FT                   AGTDGLSDEAVAKRIAPLAQVDIKDANAPRVYKTGEEVYKAVCVTCHGTGAAGAPKFGD
FT                   AAAWAPRIAAGYDEVLHLALTGKGAMPPRGGTNPDDYSDYEIARAVVYMANQGGAKFAE
FT                   PAQPAANAAPASGAAAASAPGASDAAANSQAAAAMAAIAALPKAGEAPAAGANAESSAS
FT                   AGKALYESTCQACHATGVLNAPKFGNKADWAPRLKDSMDTVYNFALHGKGAMPPKGGSN
FT                   ASDADVKAAVDYMVNAAK"
FT   gene            125791..127956
FT                   /locus_tag="BURPS1710b_0121"
FT   CDS_pept        125791..127956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0121"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY16"
FT                   /protein_id="ABA50306.1"
FT                   /translation="MGRAGRRRPARSRGPRPASLLQQRLQAREAILRRHRRLFRRRRRR
FT                   LVEPHLRDEARLFADDRLARPLALLAPVQMQAALRARDRDVHQPALFLDPLVVDRAVVA
FT                   AAAVRHDPFLDADQEHVRILEPLRRMHGRQPHRVRILFLALEHRHQRDRLDQPEQVLAG
FT                   IGEAVRVVEPFGLAVHRLLGLRLRSLALQPFKEFEHVLPLRLRLPFVVCVVQVRFVVDR
FT                   LHHVVEDDGRGLLVRAIGQALDEIAEDPQRLDLPRGQPRFDPAHVDRLEQRHLRLPRER
FT                   AERLERRVADPAARRGDRADERGIVVGVRDQPQVRAQILDLGLVEERLAARQHVGNPLA
FT                   PQHLLEDARLEVAAIQDRVVAKLRASLELVRGQAKHDGFGLVLFVVARRDGDRIAHAVF
FT                   GPQLLLEQLRVVRDHVVRGGQNAHRRPVILLELDHVQLREVLAELREVLERRAAPAVDR
FT                   LIVVAHGRERRARPREQLQQLVLARIGVLIFIDQQIAQPVLPAVAHRLVSREQLGRQAD
FT                   QVVEVDRLIRVQRRDVVPVDERRLVLVLVRGDRHRLLGRDEAVLPQRNDRLDLADQALV
FT                   GRADLLLDHPEAVVRIHDRELRLQADVLGFLPQNLHAERMERAHRQLIDGHLAAFLAGR
FT                   RERLALEELAHALAHFGGRLVRERDGGDVARLEAFCLDQVRDLLRDDAGLAAARAGEHE
FT                   AGTVEIAHRFALSGIQACGHDGGWCCG"
FT   gene            complement(125845..128046)
FT                   /gene="rep"
FT                   /locus_tag="BURPS1710b_0122"
FT   CDS_pept        complement(125845..128046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="BURPS1710b_0122"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48005"
FT                   /db_xref="GOA:Q3JY15"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY15"
FT                   /protein_id="ABA48005.1"
FT                   /translation="MLTCASREPFAAAYHAPAARRSQRLPASSPSTATPSAIMSAGLNS
FT                   AQSEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIEAKGFEPRHIAAVTFTNKAAAEMR
FT                   ERVGKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLGVQILRQEAEHVGLKPQFSIMDSD
FT                   DCFGMIQEQIGTTDKGLIRKIQTIISLWKNGLVAPEEAMTIAANEDEHQAALVYRNYVA
FT                   TLHAYQAVDFDDLIRLPTELFARNEPVRDRWQNRLRYLLIDEYQDTNACQYELLKLLAG
FT                   PRAAFTAVGDDDQAIYGWRGATLENLAQLGKDFPKLHVIKLEQNYRSTVRILTAANNVI
FT                   ANNPKLFEKKLWSEHGMGDSITVTPCNDEEHEAESVVFRLSAHKFERRTQFRDYAILYR
FT                   GNFQARVFEQVLRRERIPYVLSGGQSFFDKAEIKDLCAYLRLIANADDDPAFIRAVTTP
FT                   RRGIGNTTLEALGAFAGQAKVSLFEAVYMGGIEARLSARQVEPLRIFCDFIQRLTDRAD
FT                   KEPATVVLDDMMEAIHYEAYLYDAYDERQAQTKWQNVLEFLEWLKRKGTKPEAEQAVDG
FT                   EAEGFHNADGLADTGKNLLGLIQTVALMSMLEGKEEDPDAVRLSTVHASKGLEYPHVFL
FT                   VGVEEGIMPHSGGSDDGPIDDERIEEERRLMYVAITRAQRSLHLNWCKKRKRARETIVC
FT                   EQSRFIAEMGLDEAPPPTPEEAPMTPKDRLASLKALLQK"
FT   gene            128182..129024
FT                   /locus_tag="BURPS1710b_0123"
FT   CDS_pept        128182..129024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0123"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49730"
FT                   /db_xref="GOA:Q3JY14"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY14"
FT                   /protein_id="ABA49730.1"
FT                   /translation="MARRSDSMPLLPDAPAMLALKLTLVPLFLLLVSIAGRRWGPSIAG
FT                   WLAGLPVVAGPILFLVAVERGPAFGAHAALLSLSAIAASEAFSFAYAWTCRRHRWPLAL
FT                   AAGLAAWAAAASALARLPATPPAATAVAFAATCFGQSCLPRGATLAPRAPLSHADLAGR
FT                   LAAGAALALAVTSLAGALGPAWSGLLAVFPLLGSVLAVSSHRAHGPDFVVPLLRGMVFG
FT                   RFSFAAFCLCVALTLPRQPALQAFAEAAALSVAVQGATKRLAERGPRPTALAQTATPD"
FT   gene            129021..129824
FT                   /locus_tag="BURPS1710b_0124"
FT   CDS_pept        129021..129824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0124"
FT                   /product="GDSL-like Lipase/Acylhydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48190"
FT                   /db_xref="GOA:Q3JY13"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY13"
FT                   /protein_id="ABA48190.1"
FT                   /translation="MTRARRYHERTLSISTPVTMERHMGYHFATAALGPLLLAQGRHVR
FT                   RVTPRLAEADGPRGGADGAGPPLRLLVLGDSAAAGVGVASQSDALAGQLVRALAPFHRV
FT                   EWRLLARTGATTQDLLDWLDAEPDARFDAVVTSLGVNDVTDGVPPARWLDAQAALVERL
FT                   TARFGAAHVVLTAVPPMHRFPALPQPLRWYLGLRAARLNAALSRWAAGRPACEFLRVDM
FT                   PLTRDAMASDGFHPGTQACAAWAGQAAAAIRRRVAAATRLQAAVG"
FT   gene            130346..131398
FT                   /locus_tag="BURPS1710b_0125"
FT   CDS_pept        130346..131398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0125"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47618"
FT                   /db_xref="GOA:Q3JY12"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY12"
FT                   /protein_id="ABA47618.1"
FT                   /translation="MSSTLKIGLMGFGFAGATFHAPVITHSGRTRLAAIATGQPERATA
FT                   AYPEAAVVPDLDALAARDDVECVVIATPNDTHVDLAKRALEAGKHVVVDKPVALSAADA
FT                   LVLARLAAARGRVFAPFHNRRWDGDFLTVRQLVESGELGRIVCFESHFDRFRPHVRTRW
FT                   REEAARGGGLLFDLGPHLIDQALALFGPPETVSATVKTRRDGGDAPDFVHLQLGYPDKD
FT                   VVLHASALAAIEPARFTVLGTQGGYQKHGLDTQEDQLKAGLTPDDVEFGGGNPPGVLRG
FT                   LDGELEVERPVPTLDGQYAEFYRALAASIHDGAPFPVAPQDAVDVMTIIETAMRSEREG
FT                   RRLPFVREAV"
FT   gene            131570..131929
FT                   /locus_tag="BURPS1710b_0126"
FT   CDS_pept        131570..131929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0126"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49912"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY11"
FT                   /protein_id="ABA49912.1"
FT                   /translation="MQRLIRAAACCVLVSSLAACVVTPPRPAPAPAPRPSPQVVGYERM
FT                   QQIQGRIDNLSHRIDARVNAGYYPPPQGAALHRRLDVIRQESTDMAAQHGGGLSGDEQR
FT                   VLNQELDVAARAIGE"
FT   gene            132728..133924
FT                   /gene="gcvT"
FT                   /locus_tag="BURPS1710b_0127"
FT   CDS_pept        132728..133924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BURPS1710b_0127"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50545"
FT                   /db_xref="GOA:Q3JY10"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY10"
FT                   /protein_id="ABA50545.1"
FT                   /translation="MRRRFAELPFCFRARAQGPAALPGTPMTVLKTTPLHAAHRALNAR
FT                   MVDFGGWDMPVNYGSQIEEHQAVRTDAGMFDVSHMCVVDFTGPRVRAFFEHAIANNVAK
FT                   LQTPGKALYSCLLNPQGGVIDDLIVYYFTEEFFRVVVNAGTAEKDIAWFNQLNEQGGFG
FT                   LTIAPRRDFAIVAAQGPNARAKVWDTVPCARAATSELKPFNAAQVAGTPFGDLTVARTG
FT                   YTGEDGFEIIVPATHVEALWNALAERGVRPCGLGARDTLRLEAGMNLYGQDMDESVSPL
FT                   DAGLAWTVDLSAPRAFVGRDALEAHGSRAAFVGLILQKENGRAGGVLRAHQKVATPHGE
FT                   GEITSGTFSPSMQESIAFARVPKDVAIGDTVHVQIRDKQLPARVVKLPFVRNGKVLAA"
FT   gene            134018..134398
FT                   /gene="gcvH"
FT                   /locus_tag="BURPS1710b_0128"
FT   CDS_pept        134018..134398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BURPS1710b_0128"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM PF01597; match to protein
FT                   family HMM TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47583"
FT                   /db_xref="GOA:Q3JY09"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY09"
FT                   /protein_id="ABA47583.1"
FT                   /translation="MSNVPAELKYTDEHEWIRTEADGTLTIGITDHAQTTLGDIVFLEL
FT                   PKVGSQVKAGDAVGVVESVKAASDIYSPVTGEVIAINTDVADAPEEVNGDAYGAWLFKI
FT                   KLAADASTDSLLDAAAYEKLVG"
FT   gene            134948..137875
FT                   /gene="gcvP"
FT                   /locus_tag="BURPS1710b_0129"
FT   CDS_pept        134948..137875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BURPS1710b_0129"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by match to protein family HMM PF01212;
FT                   match to protein family HMM PF02347; match to protein
FT                   family HMM TIGR00461"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48266"
FT                   /db_xref="GOA:Q3JY08"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY08"
FT                   /protein_id="ABA48266.1"
FT                   /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFATRAALIDAVIPASIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGY
FT                   YDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLEISNASLL
FT                   DEATAAAEAMTLLQRVGKPQSNVFYVADDVLPQTLEVIKTRAKPIGIEVKSGPAADAAA
FT                   ANAFGVLLQYPGANGDVRDYRALADAIHAAGGHVVVAADILALTVLMPPGEWGADVAVG
FT                   NTQRFGVPMGFGGPHAAYMAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASMYAVYHGPRGLKTIALRVNRIAALLAAGIRHLGYATVNDT
FT                   FFDTLTIDTGARTAQLHAFAQAKRINLRRAGDTRVGVSVDETTTRADLADLLTIFAQAA
FT                   GATAPDIDALDAGLLPAPALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGPHLAKFLPNQR
FT                   STGYARGEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATETAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKDSSGITVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESQEELDRFIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTANEWPHA
FT                   YSREQAAFPVASLVANKYWPPVGRADNAYGDRNLFCSCVPVSDYA"
FT   gene            138027..139145
FT                   /locus_tag="BURPS1710b_0130"
FT   CDS_pept        138027..139145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50162"
FT                   /db_xref="GOA:Q3JY07"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY07"
FT                   /protein_id="ABA50162.1"
FT                   /translation="MVRQTFPGRAQALRQRLSALAPALVAAAALAAAGPARAAMNFCAA
FT                   PALQSSEATHAEPGVQALIKSVDAHLNDEPKALPRVHTEGTLPHEGIYDQSAEALNDME
FT                   LMRNAALAWRVTNQSRYLALVDRFLSTWVNTYRPSFNPIDETRFESLILAYDMTASALP
FT                   VKTRNAAAAFIAALGNGYVQQIDAQKRPLKGTWRNNWQSHRIKLIALAAFTLGDRRMMN
FT                   AAQRLFVEHLADNIEPDGTTYDFLERDALHYAVYDLQPLATAALAARRFNRNWLRERAP
FT                   NGATLAAALDWLAPYARGEKTHEEFVHSPVPFDAKRREAGLPGYSGMWEPKNATELFHL
FT                   AARLDGRYAGIAQQLSPMPPAWLAACLPLPAR"
FT   gene            139179..140567
FT                   /gene="sdaA"
FT                   /locus_tag="BURPS1710b_0131"
FT   CDS_pept        139179..140567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="BURPS1710b_0131"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00720"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50967"
FT                   /db_xref="GOA:Q3JY06"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY06"
FT                   /protein_id="ABA50967.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFAQGLERDALLAATAS
FT                   VKVELYGSLGATGKGHGTDRGVMLGLMGDAPDTVDPSTIAARLDAVRTSKTLALLGTHP
FT                   VPFVPKEHIAFYRQALPEHPNAMKLRAADAAGAVLREATYLSVGGGFVVTSGAPNTKVL
FT                   AAAEQMPHPFRTGAELLALTASTGKSIAQLMWENERAWHTEEETRTGLLKIWDVMQSCV
FT                   ARGCGIGNPDADGNLPGPFQVKRRAPQLYRTLTGHPERALQDPLSMVDWINLYAIAVNE
FT                   ENAAGGRVVTAPTNGAAGIIPAVLHYYTRFTPGANEQGVIDFLMTAAAIGILYKLNASI
FT                   SGAEVGCQGEVGVACSMAAGALAAVLGGTPQQVENAAEIGMEHNLGLTCDPVGGMVQIP
FT                   CIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVN
FT                   IVEC"
FT   gene            complement(140602..141900)
FT                   /locus_tag="BURPS1710b_0132"
FT   CDS_pept        complement(140602..141900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47993"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY05"
FT                   /protein_id="ABA47993.1"
FT                   /translation="MRVPRQKVTERGDAGGATRVEAARRDGRRAGAGGQARDGMTKKRA
FT                   YTSKTGNQTVTAQAVLKERNRFYGGAPTGKSYYSMHPAGERKDVVHVRKGSGYFAYKRG
FT                   DAGHGGAAEGESLNHILFKEALCSVSHTKLVLYRQTPGAPALWRRKVPITVQAARAEEP
FT                   VPRRDGPPYRADVYLEFATDDDLGLKWQRRVYIEIRHAHAVDARKQDELRTLGIPVVEV
FT                   DINHPAYMYPFSDDETTDEREDAHRKRLKHMLEHENGFLQGVVLSNPSSNEYLQKLVGE
FT                   QRRKLDSQQAELDRLAAGIAERDGRLAAAAEAKLQSDQRCRDARAALERVSEQLSAVSD
FT                   ERTRALRKQQALAEQLARVRAGRRVAYGGCAALVALAAVLGYAHWQRPPALSAARPAPL
FT                   AQAPAAAAGGAQRATGRAAASPKHRSRPRSNGG"
FT   gene            142011..143714
FT                   /gene="ilvG"
FT                   /locus_tag="BURPS1710b_0133"
FT   CDS_pept        142011..143714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BURPS1710b_0133"
FT                   /product="acetolactate synthase isozyme II large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48852"
FT                   /db_xref="GOA:Q3JY04"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY04"
FT                   /protein_id="ABA48852.1"
FT                   /translation="MSISPDREQRATTGARLLVDALLANHVERVFCVPGESFLAVLDSL
FT                   ADETERIRTIVCRHEAAAANMAEAVGKLTGRPGIAFATRGPGATHASIGVHTAFQDSTP
FT                   MILFIGQCAREHLDREAFQEIDYRRMFGQLAKWVAQIDDPRRIPEYLSHAFHVAMSGRP
FT                   GPVVLALPEDVLSEPCAAQPVAPAARRVAAAPSAAQMSELRERLARAQRPLVLAGGSGW
FT                   TPDACADLRTFVERWQLPIACAFRYQDTFDNAHPQYAGDVGLGVNPELARRIREADLLF
FT                   ALGPRLGEATTGGYTLIDIPRPKQVLIHVHQGADELGRVYAADLPIASGMPEIAAQLAA
FT                   LEPPASLAWAGSAADAHRAYLDWQAPRPMPGEVQLGDVMRQLRERLPHDAIVTNGAGNY
FT                   AAWLHRHFAYRHFRSQLAPTSGAMGYGVPAALAAKSLYPQRTVVALAGDGCFMMAGNEL
FT                   ATAIQYGLAIIVLVVNNGHFGTIRMHQERHYPGRVHGTGLTNPDFAAYARAFGAHGETV
FT                   ERTADFLPALERALASGAPALIEIRVPQDACTPAATLEQVREQGLRARRA"
FT   gene            143743..144810
FT                   /locus_tag="BURPS1710b_0134"
FT   CDS_pept        143743..144810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY03"
FT                   /protein_id="ABA48530.1"
FT                   /translation="MTPTLDETALPPADALAYPGTLLSPDGRLVAPYDLERPGADARGH
FT                   VGAAARAGLLHAASGPFTLDYATLSTVHVINGMGVALGDSVIGLTALAAIKARHPHVHF
FT                   VLYRPAHAPAYVDALYRLAADAIAPIRALPWPAAELPARDTRIDLGNHLYWPAFAARPM
FT                   IDFFLASLGVPPESIPADAKCNRWLARLTLPPLPPEWRDRPYALFCPQASTPLRSIPAA
FT                   QRAALVERLARTYRLPVLGFGPIDHPDYVDVSGHSADTAQFVSWVGRARVALCSDTSAV
FT                   HIAAGFDVPTLACFSSIAPELRVRDYPLCTAIELDMPEMLRNRHKSDAANDIAQVDAAY
FT                   RRIDWDAIAWPPARE"
FT   gene            complement(144929..145957)
FT                   /gene="eutR"
FT                   /locus_tag="BURPS1710b_0135"
FT   CDS_pept        complement(144929..145957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutR"
FT                   /locus_tag="BURPS1710b_0135"
FT                   /product="transcriptional regulator, araC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49324"
FT                   /db_xref="GOA:Q3JY02"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY02"
FT                   /protein_id="ABA49324.1"
FT                   /translation="MDHEHTGAETTAEDTGRSADGDGGAAGRALVSVAHDADEQARNLI
FT                   GWRQTYDQLAAGRFVGTLTELPLDTMKVFRETTSHTLRQACEVRGDAYWFGIPLARDGA
FT                   ARIDARPIAADALAFRPGNVEFELLTPAQFSIYGVVVRGAVLRRYAQEVERCGLDERLP
FT                   LVPVVRVGEARLTRLCALLAQRLDDADAMSAAGEPLSDCARNDLQAEVLAALFDLCASP
FT                   AADASVEHSSRRRKIVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAP
FT                   ATYLRALRLNGVRRDLRGRAAASVQDAAAAWGFWHLSQFATDYRRMFGARPSETLRDAL
FT                   AC"
FT   gene            145559..147808
FT                   /locus_tag="BURPS1710b_0136"
FT   CDS_pept        145559..147808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48701"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY01"
FT                   /protein_id="ABA48701.1"
FT                   /translation="MRGRQQLELDVAGPERERVGGDRPRVDARRAVARERNAEPVRIAA
FT                   HLARLPQRMARRLPEHLHRVERQLGQRADEAARRELVVGLAPADQVARLLVGVVRDAHE
FT                   RAPGRAAVAVRAAPGVLRRRLGAGVLVIHRASLCVAEAETVRPITQFPCRSVPSPKSPV
FT                   SMRRCAAFEQPARDECSAMAQSAAPSARRAPRRRPDAPRRGVLARFWRNERRRARRAAH
FT                   HRYRHARSNDESRGHATSEHRIPVPQAVREFHRRRMGRPGRRRVFRQRLARHRPAVHRD
FT                   PSLARSRHRARARRRSRGQGGLGREGRGRARERAAEDRRPDGGEPHAPRRRRDDRQRQA
FT                   AARNHRGRRAARDRPLPLLRGLHPRAGRLDRRYRRRHGGLPLPRAARRRRPDHPVELPA
FT                   ADGRVEARAGARGRQLRRAQAGRADARVDPRVRRADPGSAAARRAQHRQRLRPRGRQAA
FT                   RVEQADREDRVHGRDVDGPPHHAVREREPDSRHARAGRQEPEYFLRRRDGSRRQLLRQG
FT                   ARRLRDVRAEPGRSLHVPIARARRGEHLRSLHRTRAQARRGDQAGPSARFADDDRRAGV
FT                   GRAAREDPVVHRHRPRRRRAMPDGRRAQRARRRARRRLLREADRVPRPQQDAHLPGRNL
FT                   RAGARGDDVQDRGGSARDRERHAVRPGRRRLDARRQPRVPLRPRHPGGPRVDELLSRVS
FT                   GARGVRRLQAIRHRPRDAQDDARPLPADEEPARQLQRKAARVLLIARGAGRLRAA"
FT   gene            complement(146001..147806)
FT                   /gene="carR"
FT                   /locus_tag="BURPS1710b_0137"
FT   CDS_pept        complement(146001..147806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carR"
FT                   /locus_tag="BURPS1710b_0137"
FT                   /product="carR"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50160"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY00"
FT                   /protein_id="ABA50160.1"
FT                   /translation="MLRANAPRRARSEEPERLFAVADEQVLRLLVVVEHHLVRLAADAG
FT                   LLVAAERRVRRIRVIAVRPHAARLDAAAEAVRAVAVARPDAGAQAVQRVVRDLERFLLG
FT                   LERRHREHRPEDFFLEDAHLVVAAEHGRLHVIAFGELAAEHVALAARQALRAFAAADVD
FT                   VRQDLLELLGRRLRADHRLRIERMALLDRLDALERAFDEAIVDALLDERARWARADFAL
FT                   VQREHREAFERLVEVAVVAIHHVGEENIRALAAQLERDGNQVLARVLHDEAARRRLARE
FT                   RDLRDPLARRERLAGLEAEAVDDVEHAGRQQILDQLGEHEDRRGRLLGRLEHDAVAGRE
FT                   RRRELPRGHQQREVPRDDLADDAERLVEVVGHHVAADIGDRAFLRADAAREVAEVVDRE
FT                   RHVGRGGFAQRLAVVDRLGDGEAREVRLHPVGDPQQHVRALGRALRGPARLGRVSGVER
FT                   ELDVGFARARDRGERPAGDGRDVVEILAADRGDPFAADEIPVLLAVREFDVQMLHVRVI
FT                   HRCSSHVGIGDAPRDVRDAVRYAKTVPARRAAVHRGAGAGLGARSARRTAPLLNTRRAP
FT                   VVQMRHSVASTPAILATVRFGMGIA"
FT   gene            146253..147773
FT                   /gene="acoD"
FT                   /locus_tag="BURPS1710b_0138"
FT   CDS_pept        146253..147773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoD"
FT                   /locus_tag="BURPS1710b_0138"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47698"
FT                   /db_xref="GOA:Q3JXZ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ9"
FT                   /protein_id="ABA47698.1"
FT                   /translation="MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGR
FT                   PFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRIADRMEANLTRLAVAETI
FT                   DNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIP
FT                   WNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLE
FT                   AGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDS
FT                   YFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDSQTMI
FT                   GAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIF
FT                   QEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF"
FT   gene            complement(148038..148283)
FT                   /locus_tag="BURPS1710b_0139"
FT   CDS_pept        complement(148038..148283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0139"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50782"
FT                   /db_xref="GOA:Q3JXZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ8"
FT                   /protein_id="ABA50782.1"
FT                   /translation="MACSAILPPRAALLPGVARDALRQSYAVAFGGLLEGLTAVTLLCA
FT                   LAAFVFLSRVRVHDEPAAEPARSRERRALALDRECG"
FT   gene            complement(148349..149152)
FT                   /gene="eutC"
FT                   /locus_tag="BURPS1710b_0140"
FT   CDS_pept        complement(148349..149152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="BURPS1710b_0140"
FT                   /product="ethanolamine ammonia-lyase, light chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="identified by match to protein family HMM PF05985"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50768"
FT                   /db_xref="GOA:Q3JXZ7"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ7"
FT                   /protein_id="ABA50768.1"
FT                   /translation="MSDGVEKNPWGQLKSFTNARIALGRAGNSLPTAPLLAFNLSHAQA
FT                   RDAVHQPLDADALRRDIEAAGLPTLGVQSAAPDRQHYLRRPDLGRRLADDSRALLAAHG
FT                   AALGEAPDLVFVVGDGLSAFAAAKQALPLLNAMRPKLDGWRVGPVVVARQARVALGDEI
FT                   GELLGARLVAMLIGERPGLSSPDSLGVYLTYAPKVGCHDAQRNCISNVRPEGLPHDAAA
FT                   HKLHYLLTHARRLGITGVGLKDDSDALLPAAQAQTRRLAPGPAQE"
FT   gene            complement(149149..150546)
FT                   /gene="eutB"
FT                   /locus_tag="BURPS1710b_0141"
FT   CDS_pept        complement(149149..150546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="BURPS1710b_0141"
FT                   /product="ethanolamine ammonia-lyase, large subunit"
FT                   /EC_number="4.3.1.7"
FT                   /note="identified by match to protein family HMM PF06751"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48271"
FT                   /db_xref="GOA:Q3JXZ6"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ6"
FT                   /protein_id="ABA48271.1"
FT                   /translation="MRYTETIGSRTYRFADLKTLLAKASPLRSGDQLAGVAAATEEERV
FT                   AAKMALASAPLTAFLNEAVIPYEDDEVTRLVVDTHSRDAFAEISHLTVGDFRNWLLSPA
FT                   ADAAALERIAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLPGRMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPATDSLAAITKLLAMIDAFRERYRVPTQS
FT                   CVLTHVTNTIAAIGKGAPVDLVFQSIAGTEKANASFGISLALLAEAREAALALKRGTVG
FT                   NNLMYFETGQGSALSANAHHGVDQQTCEVRAYAVARAFEPFLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDICYTNHAQADQDDMDNLLTLLGAAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDQLYVREVLGLRRAPEFEEWLETMEITDAHGALRAASARVPLLAGAN
FT                   DWMGRCA"
FT   gene            complement(150556..152118)
FT                   /locus_tag="BURPS1710b_0143"
FT   CDS_pept        complement(150556..152118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ5"
FT                   /protein_id="ABA49155.1"
FT                   /translation="MPIFDNTSINDSLASILSGEPRLSRCRIPPLRGEIHADRVEWPPR
FT                   RGRRRSAAGASADARHVAAVGNCRRPRDFGRVLRLELRLGERGHARLRRHRAVRRGDVH
FT                   DLHLQLHRAHDVDSARGRPVRLCAARVRPGGRLSGGRRDPCRVRVRAARDRARDRRVPA
FT                   RAVSRPRAEARGDGRVPRVHGAEYRRRADRRDVRARRHAARDLRAARVHGRRVAGLRLE
FT                   QLREGRLGGRRSLQRRRVPWHVRGDPVRDLVLPRDRGRRDGGRGGEAPETLDSDRVRGR
FT                   HPDARGARDRRDGVRGRRGRLDQAREYQRSAAAGDEVHRRREQRLDAHARVARPVRPRR
FT                   VVPRDHSRLFAPDLRARPRRLPARMAREGAPALQDALSRDPRGRRGRHRRDLQRRADPV
FT                   RRPDAHREHRDDVRVRRYRDVHRQHGRALQAAPRAAEDGAPVPRAAVSVLPGVRARRGA
FT                   RVPRHDGVLQRARRVDLRRVRRARVRLLPRDARAARGRARRRAARGVAGVRRAPEGGAR
FT                   PLR"
FT   gene            complement(150603..152012)
FT                   /gene="eat"
FT                   /locus_tag="BURPS1710b_0142"
FT   CDS_pept        complement(150603..152012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eat"
FT                   /locus_tag="BURPS1710b_0142"
FT                   /product="ethanolamine permease"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM TIGR00908"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49550"
FT                   /db_xref="GOA:Q3JXZ4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ4"
FT                   /protein_id="ABA49550.1"
FT                   /translation="MQTESNGRPGAGGGAARPALQQTLGTWQLWGIAVGLVISGEYFGW
FT                   SYGWASAGTLGFVVTALFVAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPAGGYLA
FT                   GVATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAATFEL
FT                   VVTLLAIFELLVFMGVVSPGFAWSNFVKGGWAGADHFSAGAFHGMFAAIPFAIWFFLAI
FT                   EGVAMAAEEAKHPKRSIPIAYVAGILTLVALAIGVMVFAGGAGDWTKLANINDPLPQAM
FT                   KYIVGANSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWLAKVHPRFKT
FT                   PYRAILAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIVSMAALFKLRRVQ
FT                   PRMERPFRAPLYPFFPAFALVAALVCLGTMVYFNALVASIFVAFVALGYGYFLATRAQR
FT                   EAAPADALLEE"
FT   gene            152501..153808
FT                   /locus_tag="BURPS1710b_0144"
FT   CDS_pept        152501..153808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0144"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49479"
FT                   /db_xref="GOA:Q3JXZ3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ3"
FT                   /protein_id="ABA49479.1"
FT                   /translation="MSSGTQIAVARTPTLSMCSRRTAHRFRAAPGCPTKNHSNDRETMR
FT                   DSYLDTARGAGIILVVYGHVLRGLFSAGLVPAGWPSALLAATDYTIYTFHMPLFFLLSG
FT                   LHVPKSLRRAGDVFLLTKLRTIVYPYFVWSLLQGAVQIALSARGTNHAFTPNDLLAIGW
FT                   RPFGQFWFLYALFICMLIAWAVSAITLRARTHGGASGANGENGGTEVSGENGEPSGAPC
FT                   AVPAMPIVLVLLAIGGLAAVAFVAGSATRWGIVSMTLAYFPFFVLGMLIGERLPAFLER
FT                   VSSGPALVAVAATFAASVAFAHRFGESDSIWALPAALSGSALVLLVAHRAARRGDAARH
FT                   APRASWLEYLGFASMPIYLAHILATAATRIALVTLGIVDVGAQLALGTFAGVLGPTLLY
FT                   ALALRAGTARLAGFPPLPAGYAMTPDKGRIGRADAA"
FT   gene            153848..154030
FT                   /locus_tag="BURPS1710b_0145"
FT   CDS_pept        153848..154030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0145"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ2"
FT                   /protein_id="ABA50317.1"
FT                   /translation="MPRIRREERQRAAAVGALVTQAGPFSSVPNAPHALRIALGPIARD
FT                   PLENALREVRRAVPG"
FT   gene            complement(154181..155644)
FT                   /locus_tag="BURPS1710b_0146"
FT   CDS_pept        complement(154181..155644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0146"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05552"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48977"
FT                   /db_xref="GOA:Q3JXZ1"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ1"
FT                   /protein_id="ABA48977.1"
FT                   /translation="MDSSSFLTSMQSTLGVYLPKIAGALGILVIGWLIAVIVRAGVRRL
FT                   LSALKVDARIAESTGQGTQVERIIAGGLFWLVLLVTAVGIFNVLNLYAISNPFSLLVTK
FT                   IINYLPNLLGGAALTLVAWLIASLLRSLADKTLKASRIDSKLSETAGMRPMSSYLGDVL
FT                   FWLVILMFIPAILAAFDLNGLLSPVQGMIDKILAIVPNVFAAAVIGFVGWLVARILRGL
FT                   VTNLLVAAGADRLTQSVESPTPVKLSNLVGTVVFIFVFVPTLISALDALKIEAISRPAT
FT                   DLLGQFLNAVPDIVAAVVIVLVTFYVARFVGALVQKLLVAAGVDGLPAMLGVERVFTGM
FT                   LQPSVLAGRLIVFFAMLFATVEAANRLGFTQVRDVVTLFIEFGGHVLMGGVILVIGFWL
FT                   AGLARRVIEQADNEHSRLLSRIAQFAILGLVFAMGLRAMGIANEIVQLAFGLVLGAIAV
FT                   AVALSFGLGGREAAGKLLDRWFNQRGKQE"
FT   gene            156167..156316
FT                   /locus_tag="BURPS1710b_0147"
FT   CDS_pept        156167..156316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ0"
FT                   /protein_id="ABA50685.1"
FT                   /translation="MPGHAPRRRNAHGRAQLKALRRRQRHRFGDASAVLLARVSRHRHC
FT                   FAFA"
FT   gene            156557..159304
FT                   /locus_tag="BURPS1710b_0149"
FT   CDS_pept        156557..159304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49362"
FT                   /db_xref="GOA:Q3JXY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY9"
FT                   /protein_id="ABA49362.1"
FT                   /translation="MSSALRRDGRPALRTETRRSGERRTACATNGRRLRCAALRAELRL
FT                   RTIDRAAFRACGVLRGRARFASKRRAVTRIIPTAAALHALTAPAMAAVAVAAVIATLAV
FT                   AAAMAMPAARFTAVMAAAAAVAAMPPAGKPLEPIHRRLRSLAAAQQPQAVADDDEARAR
FT                   VGEHRHPHRAHPRDRETDEHRLHGERERDVLHEHAMRRARQPHERRDLAQVVVHQRDVG
FT                   RLDRGIGAHRAHREADVGARERRRVVDPVADHADRAAARRERFDGGELVLRQLVAARVV
FT                   DADLLRDRLRGVRVVARQHRGLDAERVQLGNRRAARVLHRVGHREEAEHARAVDQHHDR
FT                   LALPLELVETRFERARAAVELLDEAMIAEPVRHAVDLAAHAAAGNRLEIGDVGERRGLR
FT                   ARGAARAGLSRARRRDRLRNRVIRARGEARGEPPHERGVDVGCAHLEIGLHRLAARDRA
FT                   RLVEREPREAAPLLEVHAALHENPAPRGRREPRYDRHGRRDHERAWARDHEQHERAIDP
FT                   VAPCAVEHERRRDRDDERDREHDRRVDAREAVDEALRRRLRALRLLDRMDDPRERRVAR
FT                   DRRHPIFERAGFVDRARVHRVALGFLDGQALARDRRLVDGRAAGNDLAVEADALAGLHA
FT                   HDRTERDLRGVDRLPRAVGLPERHGVGREAHQALDRVARTVERARLDQFGDGEEHHHHR
FT                   GLGPLANRHRARHRDAHQRVDVQVAVRERDPALAIRAEAAGRDRGERERGGEPYRQLQP
FT                   RGRFRRRRRDARDRERPPRARRVGRRGQRATARRAGVRLFGRHAERADRGGDAGFRARH
FT                   VLDREHPLHQVEFERRDFGHRAQLLADQCLLGRAVHLHDPERRAHTAAGGLSRAGQRRE
FT                   RDGGGRAARRAVVVVVVVVVVVVRMVAVRMRMGCMCVVARIAIA"
FT   gene            complement(156560..156973)
FT                   /locus_tag="BURPS1710b_0148"
FT   CDS_pept        complement(156560..156973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47557"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY8"
FT                   /protein_id="ABA47557.1"
FT                   /translation="MDWFKWLAGGRHRGYGGGRGHHGGEAGGGHGHGGGHGERGDHGSH
FT                   GYGGHGWGRQGVQRGGGWNDARDGAPLRGEAGAPAQHAACAKCGAINGAEAKFCAQCGA
FT                   SQTPPVCGACRAPLAASARFCPQCGTAVSAQRG"
FT   gene            complement(156986..159127)
FT                   /gene="cadA"
FT                   /locus_tag="BURPS1710b_0150"
FT   CDS_pept        complement(156986..159127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="BURPS1710b_0150"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48564"
FT                   /db_xref="GOA:Q3JXY7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY7"
FT                   /protein_id="ABA48564.1"
FT                   /translation="MRSAFRIMQMDCPTEETLIRKKLGAMSEVAALEFNLMQRMLAVEH
FT                   VPGAEAGIAAAIRSLGMTPEQADAGASGRGALPAPADAPRPWWPLAVAGVAAAASEAAT
FT                   WLQLPVWLAAALALAAVATCGLGTYRKGWIALTNGNLNINALMSIAVTGAMAIGQWPEA
FT                   AMVMVLFTVAELIEARSLDRARNAIQSLMRLAPDTVTLRQPDGTWQPVDAAQVALGAIV
FT                   RVKPGERIGLDGEIVAGRSTVNQAPITGESLPVEKTEGDAVYAGTINEAGSFEYRVTAV
FT                   ASNTTLARIIHAVEEAQGTKAPTQRFVDSFARVYTPIVFAIALVVAIAPPLVLDGAWRD
FT                   WIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEQGRRLAWLALDKT
FT                   GTITRGKPVQTDFEMRAADVDAALVRGLAARLAARSDHPVSQAVAAASAAQAGAGGAPR
FT                   AKPASFADVADFEAIPGRGVRGKIDGVPYWLGNHRLVEELDCCTSALEARLDELERQGK
FT                   TVVMLIDGARVLGLFAVADTVKDTSRAAVAELHALGIKTAMLTGDNPHTAQAIAQQVGI
FT                   DDARGNQLPQDKLAAVEALAAGGRAVGMVGDGINDAPALARADIGFAMGAMGTDTAIET
FT                   ADVALMDDDLRKIPAFVRLSRATHRVLVQNIAFALAVKAVFVGLTVAGMGTMWMAVFAD
FT                   AGASLIVVGNGLRLLRRGQ"
FT   gene            159549..159980
FT                   /gene="cadR"
FT                   /locus_tag="BURPS1710b_0151"
FT   CDS_pept        159549..159980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadR"
FT                   /locus_tag="BURPS1710b_0151"
FT                   /product="Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM TIGR02047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50614"
FT                   /db_xref="GOA:Q3JXY6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY6"
FT                   /protein_id="ABA50614.1"
FT                   /translation="MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRHYTDAHVE
FT                   RLRFIRNCRALDMTHDEIRALLRFTDDPADRCDSVNALLDEHIGHVNTRLAELQHLRMQ
FT                   LIELRERCQGEHAVEDCGIVHGLATMETPDMPGKRSHVG"
FT   gene            160065..160721
FT                   /locus_tag="BURPS1710b_0152"
FT   CDS_pept        160065..160721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0152"
FT                   /product="putative PadR transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48185"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY5"
FT                   /protein_id="ABA48185.1"
FT                   /translation="MTNHVMAQSASRYSPLALIVLAMLTEAPMHAYRIQQLVKLRGKDE
FT                   VVNVKQRNSLYQTIERLQRDALIAVRETERDGAFPERTVYEVTDAGRDTARMWLREQLA
FT                   RPAREYPSFPAALSVLPLLSVEDARRQFEARVAALEAELARLDETQNAALAMQIPRLFL
FT                   LDGELMRVTLEAELDWVRSVIGHLKVGALTWSEAWLREVAARFAQADSPDSADSD"
FT   gene            complement(160780..161313)
FT                   /locus_tag="BURPS1710b_0153"
FT   CDS_pept        complement(160780..161313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0153"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48439"
FT                   /db_xref="GOA:Q3JXY4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY4"
FT                   /protein_id="ABA48439.1"
FT                   /translation="MRGERLTGAGVRCARTVPRRVLRRRRRDRCGAGRVAAAGARHVGA
FT                   ARRARDRCAAAPAEFRHEPAHGWTGHVRRVLRRRASRTRAACRVSVRRHAGDGDVHVGV
FT                   SLADLPAYGADSVERVVYGIVREMGGPIAAEHGIGALKRPFPGYARSTAEIAVMRAMKA
FT                   AFDPLGMLNPGKAL"
FT   gene            161066..162673
FT                   /locus_tag="BURPS1710b_0155"
FT   CDS_pept        161066..162673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0155"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49195"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY3"
FT                   /protein_id="ABA49195.1"
FT                   /translation="MREARRRSTRRTCPVQPWAGSCRNSAGAAAHRSRALRAAPTCRAP
FT                   AAATRPAPQRSRRRRRSTRRGTVRAHRTPAPVSRSPRIRSAPRSCRARRTAPPRRRVRG
FT                   DAAIERGPHRLEADDARQRRAHAAPELHERAVAGHAAERRRGLGERRMQPPHRLAPLRA
FT                   TRLRDAPPIERLRIPERMRSDHARRNPGRRPAAAPVPHPPPVRRAASCVVRSLIARPAS
FT                   LRRDVDVAEVLAAERLHGAVRLQFVDRGIQARLQHIIALAQPERDAAAENLVVAHRRPD
FT                   EREALRLRPRQEAALARRREHERAVEAARREVRIRLVLILVRDHLHARARPVRIRIRLL
FT                   NRTLQHAHPFALQRCRRRLEAAVRARDQLRRHAIDHRREIDRLTALVGCVHRGIDRIEL
FT                   AALQRRNQPVERRLDPFARELRCVADGVADVDIEALQRAVRRLRFERRILRLEAEAQRL
FT                   RRVGARRAGPRGGAQCTGEREPELQSFHRCFSLRSGHVRSGRHRARQRLHRRRAPSTSV
FT                   ASSFEKLKRMQPVFAPSA"
FT   gene            complement(161318..161668)
FT                   /locus_tag="BURPS1710b_0154"
FT   CDS_pept        complement(161318..161668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49830"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY2"
FT                   /protein_id="ABA49830.1"
FT                   /translation="MGHGCGGGAPAGISPRMIRAHPFGYPKPLDRRRVAQAGCPKRRKA
FT                   VRRLHPPLAQPATALCRVPGYGALVQLWRRVRATLPGVVCFEAMRPAFYRCVAAHAPAR
FT                   RRRSTRTAASRR"
FT   gene            complement(161729..162523)
FT                   /gene="argT"
FT                   /locus_tag="BURPS1710b_0156"
FT   CDS_pept        complement(161729..162523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argT"
FT                   /locus_tag="BURPS1710b_0156"
FT                   /product="lysine-arginine-ornithine-binding periplasmic
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51042"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY1"
FT                   /protein_id="ABA51042.1"
FT                   /translation="MKRLQFWFALACALGAATGAGAARADASQTLRFGLEAQYPPFESK
FT                   AANGALQGFDIDVGNAVCNAAKLTCKWVETSFDGLIPALQGRKFDAINSAMNATDQRRQ
FT                   AIDFTTVIYRVPTQLIARADSGLEPTPASLKGKRVGVLQGSIQEAYANAHWAGAGVQVV
FT                   AYQDQNQAYADLTAGRLDGTLVLAPAGQRGFLSRPEAKGFAFVGPPVRDDKILGSGIAF
FT                   GLRKGDDVLKARLNAAIDKLKADGAVKALGRKYFGDIDISAK"
FT   gene            complement(162577..163731)
FT                   /locus_tag="BURPS1710b_0157"
FT   CDS_pept        complement(162577..163731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0157"
FT                   /product="aromatic aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50554"
FT                   /db_xref="GOA:Q3JXY0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY0"
FT                   /protein_id="ABA50554.1"
FT                   /translation="MQSAAAPRSKLPDVGTTIFTVIGQLAAEHEALNLSQGAPNFAPDP
FT                   ALVERVARAMRDGHNQYAPMAGIAALREALAVKTERLYGERYDPDSEVTIVASASEGLY
FT                   AAISALVHPGDEVIYFEPSFDSYAPIVRLQGATPVAIRLSPERFRVNWDEVAAKITPRT
FT                   RMLIVNTPHNPSATILGEADVARLAQLVAGTDIVVLSDEVYEHVVFDGARHHSMARDRA
FT                   LAERSVIVSSFGKSYHVTGWRVGYCLAPAELTRELRKVHQFMTFAADTPMQHAFAAALA
FT                   EPASYLELGAFYERKRDLLVRELAGSRFELLPSEGSFFMLARFGHFSDESDADFVLRAI
FT                   RDARVATIPLSAFYADGANTGCIRLSFSKDDATLVEGARRLCSL"
FT   gene            complement(163856..165646)
FT                   /locus_tag="BURPS1710b_0158"
FT   CDS_pept        complement(163856..165646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50432"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX9"
FT                   /protein_id="ABA50432.1"
FT                   /translation="MGVAVELVFQLRPQRGLLLQNGNARLRHRCRAQRARLDLAVQVEA
FT                   RRVRRPAAGARFAERERDQALFAIQTEERVPARVEVHAVDAAAAAVERIQLGHVTVRVL
FT                   GQPRDVARAEPRAERVEPRRGPRRARAFERFAERRVGGEEVIVGQFVELVAHLVGRPGH
FT                   DGRLLLVVVRLDQVSKDDFATCSGFGAARQIDCAAAAGLAPPPAAASRASELGGAAAGV
FT                   CSGFARARLREGDDSRDRGGRGRERRHVLRVFRRQGEPRRAHDPPLREDARDADARGRR
FT                   RAARRARPGGGGRAHRCAGRRDRAGPARVGRDVCDRAQGLADRRISSALRRLRRVVARC
FT                   ARRRERCAGRCAARRDRARRACAVLRVGVAIAADAGREGRCRATARRIASGGGGVSRGC
FT                   DGWRRGRRRGRRVRWASGVAGGFPCRWFCFRGASMRRRREARRRSAAIGGGHWRALVGA
FT                   VAAGISARFADALFDMHVGLGALHSSGVRVLLDDTPTRRHADGSTVPSVYESIPVSPMQ
FT                   SSRLTDSPIYRFASACRAAVPRPSGAERSIIGSRVHTTPTRRPPAVARPFEAARRRRHI
FT                   RRASRPTAVHSLEAHRRHKP"
FT   gene            complement(164410..165108)
FT                   /locus_tag="BURPS1710b_0159"
FT   CDS_pept        complement(164410..165108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0159"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47528"
FT                   /db_xref="GOA:Q3JXX8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX8"
FT                   /protein_id="ABA47528.1"
FT                   /translation="MTSRHVQVSAPPDKSIAQPQPALRRRPRQRRAQASSAALQQAFVR
FT                   VLLERGYAKATIREIAAVAGVSVGTFYEYFGDKESLAALTIHHYVKTLATRMRAVVDAR
FT                   RGERGRAVAAALIDAQVDAIEQDPRVWAAMFAIERKVSPIDAYRRHYDDYVALWRDALA
FT                   GASDAPADARLDVTARVAHALCYGWVSQSLLTQGAKVDVAQLRDELHRAAGAYLAAAMD
FT                   GGAGGGAAGG"
FT   gene            165158..166798
FT                   /gene="aidB"
FT                   /locus_tag="BURPS1710b_0160"
FT   CDS_pept        165158..166798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="BURPS1710b_0160"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49206"
FT                   /db_xref="GOA:Q3JXX7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX7"
FT                   /protein_id="ABA49206.1"
FT                   /translation="MAWSTHEVSNQFDELTDYNLFATDPALGEALERAGASWAAPRLDA
FT                   FGARLGTRDIARLAEDANRHVPELNAFDRRGRRIDRVDFHPSWHALLGLYREQGLISLA
FT                   FRESRAGRWAANAAGFYLHGQIEAGTLCPATMTQASIPVLQKEPALWAQLKDKLYSDTH
FT                   DPRDAPIGAKQSIMIGMGMTEKQGGSDVRANTTLAVPVGAGGRGGEHLLRGHKWFFSAP
FT                   MCDAHLVVARTEAGGPSCFYVPRWRPDGTKNAVRIQRLKNKVGNRSNSSSEIELDDAWG
FT                   VMLGEEGRGIPTIIEMATYTRLNCVLGSAAILRQGLVQAIAYTRQRHAFGRALAEQPLM
FT                   RAVLADLALESEAALALAMRLAQAFERGEPAWTRIVAPAAKFWVCKRAVEAAGEVMEIF
FT                   GGNGYVDDGPIARLFREAPVNSIWEGSGNVMCLDVMRAISREPDAAHALIDELHALGGR
FT                   DARIRAELDALRAQLGTPPDALEALGRVLAQRIALLAQACLLSDAAPAVVSDGFIATRF
FT                   GEPAWGRVTGALDARRVDAAALLQRAYAA"
FT   gene            165268..166917
FT                   /locus_tag="BURPS1710b_0161"
FT   CDS_pept        165268..166917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48826"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX6"
FT                   /protein_id="ABA48826.1"
FT                   /translation="MGRAAARRVRRAARHARHRAAGRGREPSRARAECVRPPRPPHRPR
FT                   GLPPELARAPRSVSRTGPDLARVPRIARRPLGGERGGLLPARPDRGGHAVPGNDDAGEH
FT                   SRSAEGARAVGAIERQALQRHPRSARRADRREAVDHDRHGHDRKARRLGRAREHDARRA
FT                   RRRGRPRRRASAARPQMVLLRADVRRASRRRAHRSGRPVVLLRAALAAGRHEERGAHPA
FT                   AEEQGRQPQQFEQRNRTRRRMGRDARRRRPRHSDDHRDGHLHAPELRARQRGDPAPGAR
FT                   AGDRVHAAASRVRPRARRAAADARGARRSRARKRSGARARDAARAGVRARRAGVDAHRR
FT                   AGREILGLQARGRGGGRSNGDIRRQRLRRRRSDRAAVSRGARQFDLGRLRQRDVSRRDA
FT                   RDLTRAGRGARAHRRVARARRPRCADPRGARRAARAARHAARCARSARPRARAAHRAAR
FT                   AGVPAERRGARRRERRLHRDALRRARVGPRDGRARCAARRRRRTAAARVRRVGAPRAWR
FT                   LARARPRRLRRSRARRAAAPNDRLLHERNMTP"
FT   gene            complement(166692..168254)
FT                   /locus_tag="BURPS1710b_0162"
FT   CDS_pept        complement(166692..168254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49833"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX5"
FT                   /protein_id="ABA49833.1"
FT                   /translation="MRDHRLAPFRMRAADHGCLRDGRVRVQHVLDFLRIDVLAARHDHV
FT                   LDPVDDEQVTVVVDARDVAAAVPAVVVERGARGAGVVEIAEHHAVRAQPDLADFTRPRE
FT                   PARGGHDAHVDARRALAPDRARLHRLLERMEHGAGGPRFGHAVHLIERFASIRAHQPAR
FT                   ERRADRPAAVQPGPHARQIERREIGDRIERQRVRHRRAEVQRDLLGLDRLQKAQRLIFA
FT                   HQHDGAAHIERAAEPVVERRRVPDRHRHQRALALGHRQRERARRGGERDRAMAVHAALR
FT                   APRRARRVKDFGERRVVGSRRGDAGRVGDEAVERRGAGCFAFGREAKRVVLDVCEHGRE
FT                   RRVEQHRAARAVPQDVVDLRRLQLVIDRHDDRPDAPCAEQQIEERGRVQAHRGDALARR
FT                   DAERREHLGRAPRALLHLPIGERRAVVAQERLVGRRARGALECGNQVHGVMFRSCSRRS
FT                   LGAAARRARLRRNRRGRARASRHARGAPTRRTRAAAVRRRRRAAHRARPSRGPTRARRS
FT                   ASR"
FT   gene            166914..168461
FT                   /gene="fcs"
FT                   /locus_tag="BURPS1710b_0163"
FT   CDS_pept        166914..168461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcs"
FT                   /locus_tag="BURPS1710b_0163"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47789"
FT                   /db_xref="GOA:Q3JXX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX4"
FT                   /protein_id="ABA47789.1"
FT                   /translation="MNLIAALERAARATPDKPFLRDDGATLTYRQMQQRSRRAAEVLAS
FT                   LGVAPGERVAAMCLNTPAFFDLLLGAWCIGAVVVPVNHKLQAPEVDHILRHSASRAVLF
FT                   DAALAPVLANVEHDALRLATEGEAAGAAPFDRLVADAAGIAPATPDDAALAEILYTSGT
FT                   TGRPKGCMHSHRTVALAAATSALALSMTERERTLMAMPVWHASPLNNWFGGTLYVGGTV
FT                   VLMREYQPLRFLQTVEAEQVTLYFGAPVSYTLPLDTIADFASFDLTSVRAWLYGGGPIG
FT                   ATLARRLMRAYRSEAFYQVYGMTETGPAGTVLHPFEQAMKPGSIGCQGTPGVDVRVVTA
FT                   AGGLARPGEIGEIRLRADSMMLGYLDDPGATRAAFDDDGWYRSGDVARVDDDGYLFVVD
FT                   RIKDMIVTGGENVYSKEVEDVLNAHPAVAEAAVVGRAHPEWGETVIAHVVLREAAGAAR
FT                   AGQAESAAGVDADALRAFCATRLAAYKIPREYVFAERLPRTPTGKLQKYLLRARGGA"
FT   gene            168230..169852
FT                   /locus_tag="BURPS1710b_0164"
FT   CDS_pept        168230..169852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX3"
FT                   /protein_id="ABA48763.1"
FT                   /translation="MGRDGDRACRAARGGRRRSRGPGRKRGRRRRRRAARVLRDAPRRV
FT                   QDSARIRVRRAPAAHADGQTTEVSAARARRRVTPRRRRIGLPRPPRAKRRMPHRRTAQR
FT                   KAGKPGIRQRIAQPRKNKTPVPPPRTRGSPMPASTSKRAANAAIRRARHALRRLLAADA
FT                   LQGLPFALLDLVHRDAAVPQVALRVIRDVRRRHARHVGLREQRQILRRVRRVRLLHRAE
FT                   HRHRAVVRIRRVRLHVFAEALLVLVRVRLAAGHFGERQAGERSDRAFGRVARDLQEGRR
FT                   VHHLAAHQRRRDAERLHLLGHRRGLRIRAAVVDEVRLRRLELRQDRLEVDSLVVREFTI
FT                   DDRRARRLRRLLELVGKALAVSGAIVDDRDLLHAEILHRERARDRALLRVGRHHPEGRL
FT                   VALRRVLGRRRHRDLRDARVRVDARSRNRRARVEVAEHALDAVVDELLRDRRAGARVGL
FT                   IVLRVEHELHRLAADRRLRRVDVLDREHDPVLHILAVVRLRARHRRGKADLDVIRVRRP
FT                   RERHDRDERRACQLFHRVLHIFS"
FT   gene            complement(168701..169840)
FT                   /gene="livK"
FT                   /locus_tag="BURPS1710b_0165"
FT   CDS_pept        complement(168701..169840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BURPS1710b_0165"
FT                   /product="putative extracellular ligand binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49333"
FT                   /db_xref="GOA:Q3JXX2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX2"
FT                   /protein_id="ABA49333.1"
FT                   /translation="MQHTMKKLAGATFVAVMSLAGTAHADDVKIGFAAPMTGAQAHYGK
FT                   DMQNGIVLAIEDINATKPTIGGKPVKFVLDTQDDQADPRTGTTVAQKLVDDGIKGMLGH
FT                   FNSGTTIPASRIYANAGIPQIAMATAPEYTTQGYKTTFRMMTSDTQQGSVAGTFAVKDL
FT                   GMKKIAIVDDRTAYGQGLADQFEKAAKAAGATIVDREFTNDKAVDFKAILTKLKATKPD
FT                   LVYYGGADSQAAPMAKQMKSLGVTAPLMGGEMVHTPTFLKIAGDAAEGSIASLAGLPLA
FT                   EMPGGKAYADKYKKRFGEDVQTYSPYAYDGAMAMFSAMKKANSTDPAKYLPLLAKTDMA
FT                   GVTSTHIAYDAKGDLRNGGITMYKVEKGEWKPLKSIGGK"
FT   gene            complement(169925..173854)
FT                   /gene="putA"
FT                   /locus_tag="BURPS1710b_0166"
FT   CDS_pept        complement(169925..173854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="BURPS1710b_0166"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF01619; match to protein
FT                   family HMM TIGR01238"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48352"
FT                   /db_xref="GOA:Q3JXX1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX1"
FT                   /protein_id="ABA48352.1"
FT                   /translation="MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIE
FT                   HGQLPPELSGHTGVADLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEP
FT                   ECVPFLIGEARLPASLASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMC
FT                   LAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEA
FT                   GLSSALTRLIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYD
FT                   MLGEAATTEEDALRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQER
FT                   TMNELLPRVRSLALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVV
FT                   QAYQKRCPFVIDYLVDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYT
FT                   DVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLY
FT                   EEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVAD
FT                   PVEDALKVVPLGAPHAKIALPRELYGASRVNSMGLDLSNEHRLASLSSALLASAHHPWR
FT                   AAPMLADDALAHAAPRDVRNPADLRDVVGTVSEATPDEVSAALAHAVAAAPIWQATPVD
FT                   ARADCLARAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSN
FT                   DTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLRDAG
FT                   VPAGAVQLLPGNGETVGAALVADPRTRAVMFTGSTEVARLINKTLSSRLDPDGRPIPLI
FT                   AETGGQNAMIVDSSALAEQVVADVLQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKGA
FT                   MRELALGNPDRLSVDVGPVIDADAKRTIDTHIAAMKDKGHAVTQLEMPDACAQGTFVPP
FT                   TIIEIGNVDELKREVFGPVLHVVRYRRSGLDKLLEQIRATGYGLTLGIHTRIDETIAHV
FT                   ISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPRSLE
FT                   AALVADAPQEGETRDNPSAALTALRDWLIEQREPALAARCDGYLSHVLAGATAVLSGPT
FT                   GERNTYTLGARGTVLCIAATASGARAQFAAALATGNRALFAGAAGEALAAALPAQLKAH
FT                   AGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPGPIVSVQGVAAGAFENGGDEDYALE
FT                   RLLTERSVSVNTAAAGGNANLMTIG"
FT   gene            170396..174043
FT                   /locus_tag="BURPS1710b_0167"
FT   CDS_pept        170396..174043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48176"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX0"
FT                   /protein_id="ABA48176.1"
FT                   /translation="MRQIAVAARGERRLALLDQPVAQRGERSGWIIARLAFLRRIGDER
FT                   RLERARQPGRARREQALQVERAARLRPRARQPFAAERLHAHHRADHVAVHVDVADVRAR
FT                   DHVRDRLVDPRVNAEREPIARRADLLEQLVEAAAAITHDVQHRAEHFTLELVDVADLDD
FT                   RRRHERALRACVRHLELRDRVPLVLHRRDVRVDRALRVGVDHRADVHRQPVRIAERELA
FT                   HRALEHRQRAIRDVVLQTQNAQRRTALTGRVERRLQHVGDHLLGERRRIDDHRVLAARL
FT                   GDQRDRPAVRIEARRQRLVDEARDFGRAGEHHRARAGVRHERRAHRLAVARQQLHRARR
FT                   HAGVAQQAHRLRGDQRRLLGRLREHRVARRQGGCDLAHENREREVPRADADDGAERAVR
FT                   VVREFVADLRRVVAQEVDRFADLGDRVRQRFARLAHDQAHQRVHLRFEQVRRAREAVRA
FT                   RVDGRRLPDRRGRDRVRERRAHLVGRRFAHRADDVAQIGRIAHVARRGVGERVVGEHRR
FT                   GAPRMMRAREQRRRQRREPVLVRQIEAHRIDARRTVQLARQRNLRVRRAERHDLQRILD
FT                   RIGHQFLHRHGLVGDPVHERRVRAVFQQAAHEIRKQRLVRADGRVHAAWAVQLVAAGDF
FT                   LVQRLAHPVQALELVLAGVVVLAREVIDRGERVRVVRRELRIHGVRRGEQLLRAREVGH
FT                   VGVDLARIDRIAFEAVHLRALDLGIPVRALHEADHQAMAAAAREVDKVVDHERAALLVR
FT                   LHDEADAVPAGELRIEAQRLEQIERELEPVRLLGVDVQADVIAAREQRERAHARQQLVH
FT                   RAFLLGARVARMQRRELDRDARALVDAAAARRLADRVDRLLVRRVVAQRVLFGGRRFAE
FT                   HVVRVAEAARLVLAAVRERFGDRLARDELLAHQAHRHVDALSDQRLAALADQPRERRRQ
FT                   ARLAVRRDELAGDHQAPGGRVDEQRRRVADVRAPVALADLVANQRVARRAIGNPQQRLG
FT                   EAHQRDALLARQREFMDQPLDAAARALLAQRLDKARRHCLHVRREARGQPRLADQERHA
FT                   FGLRPPVRGRDRRAQHRLRLHALREFEERVRRAVVVAVGVAVGQIGDARVAGELRRKLT
FT                   MLDPLEIREDRLLDQPVRSALEPRRRVLQTRAQQIVDFDAQCGACHDFLLVPARCRPRT
FT                   LKDRKIVRQAIKRCNQISHPVAPHISPLLSITYQKRQPARTTLNDRYFP"
FT   gene            174138..174308
FT                   /locus_tag="BURPS1710b_0168"
FT   CDS_pept        174138..174308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW9"
FT                   /protein_id="ABA50875.1"
FT                   /translation="MDGWVVIGIVLAAWIAGAIVFVHRASAVFFQALGCAQRVKKDERR
FT                   ARLSGLREAHE"
FT   gene            complement(174319..176586)
FT                   /gene="priA"
FT                   /locus_tag="BURPS1710b_0169"
FT   CDS_pept        complement(174319..176586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BURPS1710b_0169"
FT                   /product="primosomal protein n`"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49872"
FT                   /db_xref="GOA:Q3JXW8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW8"
FT                   /protein_id="ABA49872.1"
FT                   /translation="MADAFVRVALDHPLPTLFDYRYRGDMPEAPGMLVQVPFGRRSVVG
FT                   LVCEVTAHTDVPAAKLKAVDAVCTELPPLSRHWLELAAFAADYYQRGLGEVALPALPQA
FT                   LRDVPRWGRLLAPELRYRLLDAGRAALPDALPARGAALRRLAQALADAPALSLAEVRAL
FT                   HPKAVAVLDEWQAQGWAACDEIAITHADAQLVDNPAPASAWRPTALPPQLTDQQAEALD
FT                   AIAAADGFAPFLLHGVTGSGKTEVYLRALAALLERRPEAQALVLVPEINLTPQFEAAFR
FT                   ARFAATLPADAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPALAMIVVD
FT                   EEHEPAYKQQEGLRYSARDLAVWRAKQLAIPVVLGSATPSLETWWQAEQGRYRRLTLTK
FT                   RAVADAALPTVRLVDLEEERRRGRGSMGGLSGPLVAALKARLERGEQSLVFLNRRGYAP
FT                   ALACDACGWVAGCPRCSAYVVMHKPEHAVRCHHCGWEARIPRACPECGNVDIAPLGRGT
FT                   QRVEETLALAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQR
FT                   VSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLIQTRYPRHALYHAL
FT                   ARQDYVGFAGATLGERRDAHLPPFVYQALLRAEGRTLDAALAFLQQAADAFSGLPGAER
FT                   VTVYDAVPMTIVKVANVHRAQLLIESASRAALQHTLRAWQPLLRELKGVLRWSVEVDPL
FT                   DI"
FT   gene            complement(177027..178244)
FT                   /gene="hemE"
FT                   /locus_tag="BURPS1710b_0170"
FT   CDS_pept        complement(177027..178244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="BURPS1710b_0170"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by match to protein family HMM PF01208;
FT                   match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48803"
FT                   /db_xref="GOA:Q3JXW7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW7"
FT                   /protein_id="ABA48803.1"
FT                   /translation="MWPVRTPDHNGRPASVIWPRAPGGAPRPVECSFAFRFVALIVAQT
FT                   LLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKQPDYATEVTLQ
FT                   PLERFPLDAAILFSDILTIPDAMGLGLDFAAGEGPKFAHPVRTEADVAKLAVPDIGATL
FT                   GYVTDAVREIRRALTDGEGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYARP
FT                   DLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRFSLDYVRRVLAQL
FT                   KREHDGARVPAIAFTKGGGLWLEELAATGVDAVGLDWTVNLGRARERVAGRVALQGNLD
FT                   PTILFAPPEAIRAEARAVLDSYGNHPGHVFNLGHGISQFTPPEHVAELVDEVHRHSRAI
FT                   RSGAGS"
FT   gene            177141..178538
FT                   /locus_tag="BURPS1710b_0171"
FT   CDS_pept        177141..178538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW6"
FT                   /protein_id="ABA47710.1"
FT                   /translation="MARMVTVAVEHRARLGADRLGRREQDRRIEIALQRDAPRDALARA
FT                   AEVDRPVEADRIDARRRELLEPEPAALRERDRRHARAVVLALELREHASDVVEREALIG
FT                   AVGERAAPRIEDHHRLRAGFDLRVQIRGHCLRIDVENPVHQVGPRVRHRFHGAEIVRAA
FT                   AFDHVARERPRAAGEADQRHALAAFAVGERAANLAHRVGHVAERRADVRHRELRDVGLG
FT                   AHRMRELRPLARGEIEAQPHRVGNRQDVGEQDRGVERKALERLQRHFGRVIGLLREPEE
FT                   AARARARCVVLGQVAARLAHQPDRRVVGRLAQQRAQEGVVEESLGHDECDEAKRKGAFY
FT                   RTRRAARRSRPYDARRPSVMIRRPDRPHVSRKHDENEPDVARARLLRGARPCTNRAAAG
FT                   RARVAARRRARARHAARMHDGRLQAVHVPARGRRVRRHRHRHGGLAREIARREDGVRED
FT                   HMADPHR"
FT   gene            178261..179046
FT                   /gene="pheC"
FT                   /locus_tag="BURPS1710b_0172"
FT   CDS_pept        178261..179046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="BURPS1710b_0172"
FT                   /product="cyclohexadienyl dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50393"
FT                   /db_xref="GOA:Q3JXW5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR037298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW5"
FT                   /protein_id="ABA50393.1"
FT                   /translation="MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCT
FT                   TGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGG
FT                   ISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFA
FT                   KQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFG
FT                   EKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK"
FT   gene            complement(179246..179587)
FT                   /locus_tag="BURPS1710b_0173"
FT   CDS_pept        complement(179246..179587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0173"
FT                   /product="CoA-binding domain protein"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49225"
FT                   /db_xref="GOA:Q3JXW4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW4"
FT                   /protein_id="ABA49225.1"
FT                   /translation="MKSLLTCDKMVNRIVPVNPLLAGAALLGERVHPSLADARAALAAD
FT                   GIEIDMVDVFRKPEEVPAVVDAAIAIGARSLWLQPGVVHDEAAAKARTAGLDVVVDRCV
FT                   KIEHRGRFG"
FT   gene            complement(179911..181593)
FT                   /locus_tag="BURPS1710b_0174"
FT   CDS_pept        complement(179911..181593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48199"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW3"
FT                   /protein_id="ABA48199.1"
FT                   /translation="MAAHAICNRAYRRGARQRQSRLSAGRARIRAEQGRLQAVDRRGAL
FT                   QDVRVRGDDRGNRAGARDDARGRRAVRRARAEFAHGRDDERCGARGHAELRGRARARAG
FT                   GARFRAARRDRRDARLPRSDQHPVHERHDGQPEGRDAHAPQRRQQRALDRERDAADRGR
FT                   CDVHSGAALSLLRDGAVGARVRIGGREDGVSRRGVRAGCDARGGVRRALHRAARRADDV
FT                   HRRARSSGFRPFRPEHAAHRHHGGFAVPDRDDEARGREDAHVRGDDRLRDDGDEPRVVP
FT                   ERDDGFAREAHDDGRPDPAASGGEDRRRDGRDRARRRDGRAVHARLFGDARLLGRRGQN
FT                   ARGGGRWLDAHGRPRDARRRRLLQHRRAPEGHADSRRRERVPARDRGVSVPASEDPERA
FT                   GVRRARFEVRRGSMRVDRAARGRDDDGRRAARVLQRPDRALQGAALRALRRRTADDRDG
FT                   EGAEVRDARTNDRRTWFERAADGLTRRARFQWTKKSGLMSPLKTTRYGVSARRPKVERI
FT                   GMGRRRLQQGCPWEGIRYETDGLVIRACVRSHAAHETASVLKP"
FT   gene            180084..181865
FT                   /locus_tag="BURPS1710b_0175"
FT   CDS_pept        180084..181865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW2"
FT                   /protein_id="ABA49781.1"
FT                   /translation="MWFLAGSSARFFSSIGNVRGASSRLLHAQTKFVDHSFAHHELLHL
FT                   PRHGHRQFVDEAHVARHLVVRDLAAAELAQLVVRHRLARAQHDPRAYFLAVLRIGHAEH
FT                   LHALDLRMPEQKLLDLARVHVLAAANQHVLQAPDDVAKAFFVERREVARAHPAIDHRLA
FT                   RSGLVVPIAEHHRIAARAQLARLADGHDRARRVDDLRLQMRLDPADRRRALLERIRRRA
FT                   LERHGARLRHPVGDRHLGHVHLRDHALHRLDRARRTRHDAGAQRAQVETVEIRMIELGD
FT                   EHRRHALQRGAALVGHRRERRTRLERRAGKHHPRARRYAREHRQHHPEAVIERHRNAHR
FT                   IGLGQPHHVRDRARVVDDVAVRERRALRAARRAARELDVDRIAAIERRADRVEPRGSER
FT                   RPPAREHVREAQHARVRRIAHRHDRAQTRHARGAQHVARARRRELRRDFRDHLRVRGRL
FT                   EALRGDQQLAADLVQRVFELGQPIGGIDVDEHRADTRGCKLREQPFGAVRRPDADPVTA
FT                   RDAELDQRGGERVDFVRELAPRPAHALLAEHDRRAIGKAGDRIEQELPDRRVAQWDIRR
FT                   AAYVRKPVHRRDQRAHA"
FT   gene            complement(180147..181877)
FT                   /locus_tag="BURPS1710b_0176"
FT   CDS_pept        complement(180147..181877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0176"
FT                   /product="AMP-binding enzyme domain protein"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50786"
FT                   /db_xref="GOA:Q3JXW1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW1"
FT                   /protein_id="ABA50786.1"
FT                   /translation="MAADSGMGALIAPMHGLSYVRGPADVPLSDATIGQFLLDTVARFP
FT                   DRAAVVFREQGVRWTWREFADEVDALAAALIELGIARGDRVGIWSPNRAEWLLTQFATA
FT                   RIGAVLVNVNPAYRLAELEYALNKVGCKLLIAAERFKTSAYAEMIAEIAPELATTRAGD
FT                   VLCAARVPSLRTVVTMSDAAHAGMLSFADVLARGRAALASARLDAIGATLDCRDPINIQ
FT                   FTSGTTGSPKGATLTHRNVVNNARSIANVMRLTEADAMCIPVPLYHCFGMVLSVLACVS
FT                   AGARMVFPGAAFEPGATLAAVSDERCTALQGVPTMFIAELDHPDFDRFDLSTLRTGIMA
FT                   GSPCPIETMKRVVAKMHMSEVTIAYGMTETSPVSFQSATTDSLEKRTTTVGRIQPHLEA
FT                   KIVDATGAIVPVGETGELCTRGYSVMLGYWDDEARTREAVVDGWMRTGDLATLDEEGFC
FT                   NIVGRLKDMLIRGGENVYPREIEEFLFRHPKIQSVQVFGVPDSKYGEEVCAWIVLRAGE
FT                   TMTDDELREFCSGQIAHYKVPRYVRFVDELPMTVTGKVQKFVMRERMIDELGLSVQQTA
FT                   "
FT   gene            complement(182110..182535)
FT                   /gene="atpC"
FT                   /locus_tag="BURPS1710b_0177"
FT   CDS_pept        complement(182110..182535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BURPS1710b_0177"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00401;
FT                   match to protein family HMM PF02823; match to protein
FT                   family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49500"
FT                   /db_xref="GOA:Q3JXW0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXW0"
FT                   /protein_id="ABA49500.1"
FT                   /translation="MATIKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRI
FT                   RPGAVRIESESGDEEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEET
FT                   LQNAKSDIDLAKAQSELATAMAQLEAIQRLAKIRGKH"
FT   gene            182529..184391
FT                   /locus_tag="BURPS1710b_0178"
FT   CDS_pept        182529..184391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0178"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50504"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXV9"
FT                   /protein_id="ABA50504.1"
FT                   /translation="MPYRLLSIGVSASALTPIPCRGWPESALQRFTLAPRRSIGVSASA
FT                   LTPIPCRDRPESALEHVLRSRGGRPKRTLQRSPRSHAGTVERVTQAPYPRPRVDGMNTA
FT                   SRRPLRYTRPLLDLLGLLEGFVDRADHVERLFRQVVALAVDDHLEAADRFLQRHVLARR
FT                   AREHFGDVERLRQETLDLTCARNRQLVFRRQLVHAQNRDDVAQFLVALQRLLNAAGDRV
FT                   VLFADHVRVDLARRRVERVDGRIDTERCDVTRQNDGCVQVAEGGGRRRVGQVVRRHVHG
FT                   LNRRDRAFLRRRDALLQLAHFFSQRRLIAHCRRHTAEQRRHFGTGQRETVDVVDEEQHV
FT                   EAFVTEVLGHREARQRHAQTVARRLVHLAVHQRDLVENVRVLHFVVEVVPFTGTLAHAR
FT                   EHGVTAVLLRDVVDELHHVDGLAHARAAEQADLAALCERADQIDDLDARFEQFGRRRQL
FT                   VERRRLLVDRALVFALDRSRFVDRAAEHVHDAAEGRLADRHRNRIARILHHDAAAQAVG
FT                   GTQTDGTDHAVAQLLLDFERQFRAFQNERVVDLRHALAREFHVDNGADALYDLAFYQSS
FT                   STHRFSFQYLILYSRKGAVSRRSRRRACRVTPRRRRRRSPTIPS"
FT   gene            complement(182871..184265)
FT                   /gene="atpD"
FT                   /locus_tag="BURPS1710b_0179"
FT   CDS_pept        complement(182871..184265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BURPS1710b_0179"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48562"
FT                   /db_xref="GOA:Q3JXV8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV8"
FT                   /protein_id="ABA48562.1"
FT                   /translation="MSTAALVEGKIVQCIGAVIDVEFPRESMPKIYDALILEGSELTLE
FT                   VQQQLGDGVVRTICLGASDGLRRGVVVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGP
FT                   IESENKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLR
FT                   VALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGK
FT                   LQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDP
FT                   LDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARK
FT                   IQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFE
FT                   KAKKIQ"
FT   gene            complement(184345..185220)
FT                   /gene="atpG"
FT                   /locus_tag="BURPS1710b_0180"
FT   CDS_pept        complement(184345..185220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="BURPS1710b_0180"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47826"
FT                   /db_xref="GOA:Q3JXV7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV7"
FT                   /protein_id="ABA47826.1"
FT                   /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPY
FT                   AEKVRAIAAHMSRANPEYRHPFMVANDGVKTAGMILVTTDKGLCGGLNTNVLRASLQKF
FT                   KELEEQGQKVEATAIGGKGLGFLNRFGAKVISQVVHLGDTPHLDKLIGAVKTQLDLYSE
FT                   GKLSAVYLAYTRFVNTMKQETVIEQLLPLSSEHFDANDGTPATSWDYIYEPDAQAVVDE
FT                   LLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKEL
FT                   SEIVGGAAAV"
FT   gene            complement(185292..186833)
FT                   /gene="atpA"
FT                   /locus_tag="BURPS1710b_0181"
FT   CDS_pept        complement(185292..186833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BURPS1710b_0181"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50909"
FT                   /db_xref="GOA:Q3JXV6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV6"
FT                   /protein_id="ABA50909.1"
FT                   /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELV
FT                   GRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQ
FT                   RELIIGDRQCGKTAVAIDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTI
FT                   VVAASASESAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDD
FT                   LDVKDVLPFEKGLREYLKTSHADLIKRIEDTKDLSKDDESALHAALKDFKKSGAY"
FT   gene            complement(186880..187419)
FT                   /gene="atpH"
FT                   /locus_tag="BURPS1710b_0182"
FT   CDS_pept        complement(186880..187419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="BURPS1710b_0182"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49818"
FT                   /db_xref="GOA:Q3JXV5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV5"
FT                   /protein_id="ABA49818.1"
FT                   /translation="MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLS
FT                   VASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAEQFEALKNA
FT                   REGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLD
FT                   TSVRARLAGMQAALTA"
FT   gene            complement(187422..187892)
FT                   /gene="atpF"
FT                   /locus_tag="BURPS1710b_0183"
FT   CDS_pept        complement(187422..187892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="BURPS1710b_0183"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49215"
FT                   /db_xref="GOA:Q3JXV4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV4"
FT                   /protein_id="ABA49215.1"
FT                   /translation="MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLA
FT                   AAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQ
FT                   AKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL"
FT   gene            complement(188020..188289)
FT                   /gene="atpE"
FT                   /locus_tag="BURPS1710b_0184"
FT   CDS_pept        complement(188020..188289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="BURPS1710b_0184"
FT                   /product="ATP synthase c chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137;
FT                   match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48231"
FT                   /db_xref="GOA:Q3JXV3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXV3"
FT                   /protein_id="ABA48231.1"
FT                   /translation="MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQ
FT                   PELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
FT   gene            complement(188366..189217)
FT                   /gene="atpB"
FT                   /locus_tag="BURPS1710b_0185"
FT   CDS_pept        complement(188366..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BURPS1710b_0185"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50419"
FT                   /db_xref="GOA:Q3JXV2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXV2"
FT                   /protein_id="ABA50419.1"
FT                   /translation="MAASEGTRAPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWS
FT                   IVCGLITILLLRLAARKATSGVPGRFQCAVEMLVEMVEDQSKAIVHGNRAFIAPLALTV
FT                   FVWVALMNSLDFLPVDLPGRVIGWLGLSGIISHHRIVPTADLNGTLGIALGVFVLMLYY
FT                   SIKIKGAGGFAHELVSAPFGSHPLLWIPNLALNIVEFVAKTVSLGMRLFGNMYAGELVF
FT                   LLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHD
FT                   AH"
FT   gene            complement(190131..191282)
FT                   /locus_tag="BURPS1710b_0186"
FT   CDS_pept        complement(190131..191282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0186"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49431"
FT                   /db_xref="GOA:Q3JXV1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXV1"
FT                   /protein_id="ABA49431.1"
FT                   /translation="MPLDRAVSNSVVGRAPARIIAFVRHEPVLSILVAALIALQAVHSL
FT                   SAIALVRLVDWQTVATLAGLLMLTKALELSGFLMWLAHRIVHRVRSERALAALLVVFAA
FT                   ALSVWLTNDVALFVVIPLVLSLRELTPLPFKRLVIYIALAVNAGAIATPLGNPQNLFLW
FT                   QLSGVSFGRFVIALGPLALVLMALLLAMVVFAFDGRPLDLSRDSTERPVDRAQAFATVA
FT                   MFAGFVLLADAHHALAGVLAVAAVFLIVRRDAVLKIDWLLLLIFVLMFIVLRSAASLPA
FT                   VHQAIAGIGLDTPLRAYAAGALLSQIISNVPAAILLSEFTHDWRALAFGVSVGGFGIAF
FT                   GSLANLIAIRLSRARGMWLPFHLVSIPFGIASAVLGALLLHYF"
FT   gene            complement(191272..192159)
FT                   /gene="parB2"
FT                   /locus_tag="BURPS1710b_0187"
FT   CDS_pept        complement(191272..192159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB2"
FT                   /locus_tag="BURPS1710b_0187"
FT                   /product="chromosome partitioning protein ParB"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50349"
FT                   /db_xref="GOA:Q3JXV0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXV0"
FT                   /protein_id="ABA50349.1"
FT                   /translation="MNAVAKKKGLGRGLEALLGGSADITEAVKIEGAPNVLALGKLQAG
FT                   KYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLEEV
FT                   PVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRSRSA
FT                   VSNLLRLLNLAMPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRETEKL
FT                   VAHTTKAEPAVKARAKDDGGRDTRRLEEELSDLLASNVKIKVGRRGRGQLTIDFGDLDA
FT                   LEGILARLRGNVAA"
FT   gene            complement(192195..192965)
FT                   /gene="soj"
FT                   /locus_tag="BURPS1710b_0188"
FT   CDS_pept        complement(192195..192965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="BURPS1710b_0188"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49822"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU9"
FT                   /protein_id="ABA49822.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNA
FT                   TMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENR
FT                   ERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRGSRGAQAYIQFGAEMIERVRAL"
FT   gene            complement(193018..193716)
FT                   /gene="gidB"
FT                   /locus_tag="BURPS1710b_0189"
FT   CDS_pept        complement(193018..193716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BURPS1710b_0189"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48788"
FT                   /db_xref="GOA:Q3JXU8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXU8"
FT                   /protein_id="ABA48788.1"
FT                   /translation="MTVQQRRRPPIASRETLQALLSEGAQALGVALSDAQRGALLDYVA
FT                   LLAKWNAVYNLTAIRDPRQMLIQHILDSLSIVPHLGAHGAAAAALDVGSGGGLPGVVLA
FT                   IALPGWRVTLNDIVHKKSAFQNQAKAELKLGNLSVVTGRVETLRPGADVPAKFDVIVSR
FT                   AFADLADFVTLARHLVAPGGSIWAMKGVRPDEEIGRLPDGARVKQMIRLTVPSLDAERH
FT                   LIEVELDEAI"
FT   gene            complement(193713..195686)
FT                   /gene="gidA"
FT                   /locus_tag="BURPS1710b_0190"
FT   CDS_pept        complement(193713..195686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BURPS1710b_0190"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48591"
FT                   /db_xref="GOA:Q3JXU7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXU7"
FT                   /protein_id="ABA48591.1"
FT                   /translation="MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRVLY
FT                   KQAIRRRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGVRFRARAVVLTAGTFLDGKI
FT                   HVGLNHYTGGRAGDPAAVSLSSRLKELNLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDL
FT                   DPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRSGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASKDSHQIFLEPEGLTTNEFYPNGISTSLPFDVQLALVHSMRGLEQAHILRP
FT                   GYAIEYDYFDPRALKSSLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQEK
FT                   DAWCPRRDQAYLGVLVDDLVTRGVSEPYRMFTSRAEYRLSLREDNADMRLTEVGRELGV
FT                   VDDVRWDAFNRKRDAVSRETERLRTTWVTPKTLPADEATALLGKPIDHEYSLAELLRRP
FT                   GVSYDGVCGLRGGECGPSEPLAEDELLLAQIKEQIEIGIKYQGYIERQAGEIERNGANE
FT                   NTRLPDGIDYTEVRGLSFEVSQKLNQFRPETIGQASRISGMTPAAISLLMVHLKKRGLG
FT                   RRKGADSVPGADVQADNTAAQQ"
FT   gene            complement(195848..196603)
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0191"
FT   CDS_pept        complement(195848..196603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0191"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47652"
FT                   /db_xref="GOA:Q3JXU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU6"
FT                   /protein_id="ABA47652.1"
FT                   /translation="MDREAKPVLAVQNLSVRYGKVEALHRAALTVGAGQIVTVIGPNGA
FT                   GKSTLLNAVMGALPTNGHAAGTVLYRGDDVDALPVEQRVALGMCLVPEKRELFGTMSVE
FT                   DNLVLGAYRRKMAGDASFLDQLEPVFSLFPRLKERRKQAAGTLSGGERQMLAVGRALMG
FT                   KPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVAMLLIEQNARAALQISDYGYVLETG
FT                   EIALEGPAGELAQNPQVIETYLGLARKAV"
FT   gene            complement(196606..198390)
FT                   /locus_tag="BURPS1710b_0192"
FT   CDS_pept        complement(196606..198390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0192"
FT                   /product="branched-chain amino acid ABC tranpsorter,
FT                   permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50671"
FT                   /db_xref="GOA:Q3JXU5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU5"
FT                   /protein_id="ABA50671.1"
FT                   /translation="MKAILRNKAFWLFLVALFALPALPGAARVPEYWITLLNYIGLYAI
FT                   VAVGLVLLTGIGGMTSFGQAAFVGVGAYATAFLTTAYGVSPWLGLIAGVVLTALVALML
FT                   GVVTMRLSGHFLPLGTIAWGLALFFLFGNLDWLGKYDGINGIPALALFGHAFDTGRSLY
FT                   YLIWIVVLAAIVSVQNLLNSRPGRAIRALRGGGMMAEAMGVNTGWLRVVIFVYAAVLAS
FT                   ISGFLYAHLQRAVNPTPFGLSHGIEFLFMAVVGGVAHVWGAVLGAAIVTVLQDYLQTLL
FT                   PKLLGAEGNFEIIVFGVLMVLLLQYARQGVWPFVAKLMPREPAARAPGQAAPLPRRARP
FT                   QAGEALLVVDNVRKQFGGLVAVNDVSFDVLAGQIVGLIGPNGAGKSTTFNLVTGVLRPT
FT                   SGAITFRGERIDKLVSREIVKRGIGRTFQHVKLLPGMTVLENVAIGAHLRGSAGIWRSV
FT                   VRLNAHEEARLMSEAARQLRRVGLDGHMYDEAGSLALGQQRILEIARALCSDPTLLLLD
FT                   EPAAGLRYQEKQQLAELLRKLKAEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLP
FT                   QDVQKDPAVLEAYLGGVE"
FT   gene            complement(198395..199450)
FT                   /gene="livH"
FT                   /locus_tag="BURPS1710b_0193"
FT   CDS_pept        complement(198395..199450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="BURPS1710b_0193"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49609"
FT                   /db_xref="GOA:Q3JXU4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU4"
FT                   /protein_id="ABA49609.1"
FT                   /translation="MDFSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFV
FT                   TYGALTLAALQAQKFPATCWLLFVAGIACFMLEVGGLIRHRARRRRLARTLTTLASRYV
FT                   LLPLAIYAVTRSAAAQPLPMIAQIALTLAIVVPLGPFIYRLAYQPIAEGTTLLLLIVSV
FT                   AVHFALVGLGLVMFGAEGSRTTAFSDTSLALGSLSISMQSAWVVGTALVLIAALYLYFE
FT                   RTLPGKALRATSVNRLGARLVGIGTTEAGRLAFTLAAGLGALSGVLVGPLTTIYYDSGF
FT                   LIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIVPVLLWRS
FT                   LAAPQTEDEEA"
FT   gene            complement(199763..201184)
FT                   /gene="livK"
FT                   /locus_tag="BURPS1710b_0194"
FT   CDS_pept        complement(199763..201184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BURPS1710b_0194"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48964"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU3"
FT                   /protein_id="ABA48964.1"
FT                   /translation="MATAAARRAAGRVFCNRGAGGIGRKIAVEAAEGRVRCARARGAQQ
FT                   QEERAPRRFHVERETGAAACRFDRCAMSPCPLDRVSRSVWRHTMKMNRWIEVAFAAGCL
FT                   CTAGLASAQVKIGVTVSATGAAASLGIPEKNTVALLPKEIGGKRVEYIVLDDASDTSRA
FT                   VQNTRKLIDEDHVDAIVGSSITPNALAMIDVVAQGKTPAISLAASAHIIAPMDAKRAWV
FT                   FKTPQNDRLMADALAGYMAKHGVKTVGFIGFADAYGDGWYGVFSAAAAANGLRIVANER
FT                   YNRTDASVTGQVLKTLGARPDAVLIAGAGTPAALPAKTLKARGYTGKVYQTHGVANNDF
FT                   LRVCGKDCDGELLPAGPVLVADQLPDSNPAKQPALAYKAAYEKAYGAAAVSTFGGHVWD
FT                   AGLMLQRAIPDALKKAQPGTPAFREALRGALENVKDLPVSHGVINTTPADHNGFDTRAR
FT                   VIVQIVGDKWKLQAD"
FT   gene            complement(201241..202692)
FT                   /locus_tag="BURPS1710b_0195"
FT   CDS_pept        complement(201241..202692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47980"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU2"
FT                   /protein_id="ABA47980.1"
FT                   /translation="MHRETKFAGGERGDIRGTECPIESAVGFVPTALFICAFSAVYISL
FT                   SLNAVYHAAFDCRPLAPAGAHRCGLTRLSRAQRVRYTRHSPTRWSGNGRARDTETNSMI
FT                   GAGRFWGIGTANAWAAVSGVAFAEARTDFAACSDAASARFAAPPGLRAKDAIALPPREI
FT                   DRWATRAVALDDAADSARVPNGAYSHPSENHLDAPIGSAVSTPSSAMGGTAARLPARAM
FT                   SSMATASGLESFDAKRAFRGFETRPRDLSASAAIARHGFATRDRKTIAPAGLDAACSGS
FT                   ALAQVGGASVVKRIMLAEAGRRVCGDASVAPWASRAPSKRPDAVTPHAGPGARMLGALS
FT                   LKTPAAPSACCDAGATCRRAHGAAIEGLRHAHGAGGGGARRPAGLALVVDAFLTDSSFN
FT                   SLFAPVFRLAYEDAHDAGTTPTTGEHARSAAPLSAHGVRGASNRSRLGMPVFRRASPTS
FT                   CDGATDVAGVCRVFDRHAGLGEAFV"
FT   gene            complement(202886..203860)
FT                   /locus_tag="BURPS1710b_0196"
FT   CDS_pept        complement(202886..203860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0196"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter integral membrane subunit"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51184"
FT                   /db_xref="GOA:Q3JXU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU1"
FT                   /protein_id="ABA51184.1"
FT                   /translation="MQRKALYGLLLLGLLVAPFVGAYPVFVMKVLCFALFAAAFNLLIG
FT                   FTGLLSFGHAMFLATAGYVTGYAMQSLGTAPELGVLAGTAAATLLGLVVGLFAIRRQGI
FT                   YFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGLVDLSSDLALYYVVLVVIAC
FT                   ACFFIVRIVHSPFGQVLVAIKENEPRAISLGYDTDRFKLLAFILSAALAGLAGALKVVV
FT                   LGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLVGAALIVALEDRLGDIGGWLASVTHI
FT                   DWFRSLGESATIVTGLIFIVCVLAFRRGIVGEVIARVRPLRAS"
FT   gene            complement(203860..204744)
FT                   /locus_tag="BURPS1710b_0197"
FT   CDS_pept        complement(203860..204744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0197"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50431"
FT                   /db_xref="GOA:Q3JXU0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU0"
FT                   /protein_id="ABA50431.1"
FT                   /translation="MDIFGIPVSAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAMLAWMGLNYLGLPYWAMLVLAPVVVGLFGILIERSMLRWLYKLDHLYGLL
FT                   LTFGLTLVVEGVFRAIYGSSGQPYDVPALLEGATNVGFMFLPNYRAWVVVASLAVCLAT
FT                   WFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMVTLTYGFGVALAAFAGVLAAPVIQVS
FT                   PLMGQPMIITVFAVVVIGGMGSILGSIVTGLMLGVVEGLTRVFYPEASATVVFVIMAIV
FT                   LLIRPAGLFGKER"
FT   gene            complement(204884..206080)
FT                   /gene="livK"
FT                   /locus_tag="BURPS1710b_0198"
FT   CDS_pept        complement(204884..206080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BURPS1710b_0198"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic branched-chain amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49071"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT9"
FT                   /protein_id="ABA49071.1"
FT                   /translation="MKLKTLAHACLAVAAAWSVGAAQAADSVKIGFITDMSGLYADIDG
FT                   QGGLEAIKMAVADFGGKVNGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGGTNS
FT                   ATALSMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVVKQGG
FT                   KTWFFLTADYAFGKALEKNTADVVKANGGKVLGEVRHPLSASDFSSFLLQAQSSKAQIL
FT                   GLANAGGDTVNAIKAAKEFGITKTMKLAALLMFINDVHALGLETTQGLVLTDSWYWNRD
FT                   QASRQWAQRYFAKMKKMPSSLQAADYSSVTTYLKAVQAAGSTDSDKVMAQLKKMKIDDF
FT                   YAKGSIRTDGSMIHDMYLMEVKKPSESKEPWDYYKVVATIPGEQAFTTKQETRCALWK"
FT   gene            complement(206148..206903)
FT                   /locus_tag="BURPS1710b_0199"
FT   CDS_pept        complement(206148..206903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0199"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter ATP-binding subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48767"
FT                   /db_xref="GOA:Q3JXT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT8"
FT                   /protein_id="ABA48767.1"
FT                   /translation="MNHSEREERELNSVESGTPALALAGLEAWYGESHILHGVDLTVHR
FT                   GEVVTLLGRNGAGRTTTLRAIMGLTGRREGSIRIAGHETIGLPTHKIAHYGVGYCPEER
FT                   GIFSSLSCEENLLLPPVLGDRKRAMSLEDIYEMFPNLASRRASQGTRLSGGEQQMLAVA
FT                   RILRTGANLLLLDEISEGLAPVIVQALAKMIVTLKARGYTIVMVEQNFRFAAPLADRFY
FT                   VMEHGRIVEHFGAAELEGKMPVLHDLLGV"
FT   gene            complement(206900..207679)
FT                   /locus_tag="BURPS1710b_0200"
FT   CDS_pept        complement(206900..207679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0200"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48827"
FT                   /db_xref="GOA:Q3JXT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT7"
FT                   /protein_id="ABA48827.1"
FT                   /translation="MILGDTILETRGLTKEFKGFTAVNGVNLRVRRGSIHALIGPNGAG
FT                   KTTCFNLLTKFLKPTSGQIVYNGIDITDERPSQIARRGVIRSFQISAVFPHLSALQNVR
FT                   IGLQRSLGTAFHFWRSERLLKRLDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALEIAT
FT                   TLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVANGRTILMVEHNMNVIAGISDTITVL
FT                   QRGEVLAQGTYAEVSKNPLVVEAYMGSADAALAGAHA"
FT   gene            complement(208179..209864)
FT                   /gene="betA"
FT                   /locus_tag="BURPS1710b_0201"
FT   CDS_pept        complement(208179..209864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="BURPS1710b_0201"
FT                   /product="oxidoreductase, GMC family protein"
FT                   /EC_number="1.1.99.-"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49390"
FT                   /db_xref="GOA:Q3JXT6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT6"
FT                   /protein_id="ABA49390.1"
FT                   /translation="MTTERTLEGEFDYVIVGAGTAGCVLANRLTEDPDVTVLLLEAGGR
FT                   DDYHWIHIPVGYLYCIGNPRTDWLYKTEPEAGLNGRALSYPRGRVLGGSSSINGMIYMR
FT                   GQRGDYDDWARATGDAGWSWDSVLPVFRRSEDHHAGATDMHGAGGMWRVEKQRLRWEIL
FT                   EAFSQAAQQTGIPATDDFNRGDNTGVGYFEVNQKRGIRWNASKAFLRPALARPNLTVIT
FT                   GAQAERLVFDGKRCAGVEYRGGGAPFVARARVEVLVASGAVNSPQLLELSGIGDGSRLQ
FT                   ALGIGVVADLRGVGENLQDHLQLRMAFRVRGVRTLNTLSAHWWGKLWIGAQYALMQRGP
FT                   MSMAPSQLGAFAKSDPNDPALAQPDLEYHVQPLSLERFGEPLHRFNAFTASVCHLRPTS
FT                   RGSVHAASPDPARAPSIAPNYLSTDYDRHVAANALRLTRRIASAPALARYAPEEILPGA
FT                   RYVSEAELIAAAGAVGTTIFHPVGTCRMGRADDPDAVVDSRLRVRGVTGLRIVDASVMP
FT                   TITSGNTNSPTLMIAERASDMIRADRRGASERGASARAEAVLPT"
FT   gene            complement(210039..211565)
FT                   /gene="mmsA"
FT                   /locus_tag="BURPS1710b_0202"
FT   CDS_pept        complement(210039..211565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="BURPS1710b_0202"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47947"
FT                   /db_xref="GOA:Q3JXT5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT5"
FT                   /protein_id="ABA47947.1"
FT                   /translation="MTGSTHSNDSRVRALAHFIGGRALDGASDRYGDVFDPALGTVTAR
FT                   VPLASGAEVDAAVAAAAAAFPAWSETSPLKRARVMFKFKELLDRHHDELAELITREHGK
FT                   VFSDAKGEVMRGIEVVEFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVAGITPFNFP
FT                   MMVPCWMFPVAIACGNTFVLKPSERDPSASIRLAELLKEAGLPDGVFNVVHGDKTAVDA
FT                   LIAHPDVAALSFVGSTPIAEYIHTQAARRGKRVQALGGAKNHLVVMPDANLDQAVDALV
FT                   GAAYGSAGERCMAISVAVAVGGVADALVERLAERAKALKIGNGMNADVEMGPLVTAAHR
FT                   AKVSAYIDAGVAAGAKLVVDGRRHVVAGGENGFFLGGTLFDDVTTDMSIYREEIFGPVL
FT                   AVVRVPDFASAVELINAHEFANGVSCFTSDGGIARAFARKIQVGMVGINVPIPVPMAWH
FT                   SFGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFTMPVAK"
FT   gene            211706..212605
FT                   /locus_tag="BURPS1710b_0203"
FT   CDS_pept        211706..212605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0203"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47766"
FT                   /db_xref="GOA:Q3JXT4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT4"
FT                   /protein_id="ABA47766.1"
FT                   /translation="MDLTLLRAFVAVAREGNLTRAAAQLHLTQPAVSLQIKNLQDLLGI
FT                   ALFVRTSRGLVLTRDGQALLPHAERALDAAADVKRAAAALRHEVRGRLRIGTILDPEFL
FT                   RLGGFLKRLVEAHPQIETALRHGMSGWVLDEVRARELDVGYYIGRPEEDDPRDAERFHT
FT                   VTLTQFRYRVLAPAGWKERVQRARTWRELAALPWIWTPAASAHQRLLSRRFADAGAQPV
FT                   KVAEVDQETSMLDLVKSGVGLTLARDSIALREAHAHALTIVEHVAVPAELTFVTLADRR
FT                   DEPAIAAALRLIDEQWAI"
FT   gene            212996..213526
FT                   /locus_tag="BURPS1710b_0204"
FT   CDS_pept        212996..213526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0204"
FT                   /product="Adenylate cyclase"
FT                   /note="identified by match to protein family HMM PF01928"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50113"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT3"
FT                   /protein_id="ABA50113.1"
FT                   /translation="MARNIEIKARAREFEQLRERAAELATDAPLFYRQQDFFYDVPRGR
FT                   LKLRRFEDGTPAELIFYQRDDQDGPKASYYTRSPVTNADAMHALLATALTTRGIVTKER
FT                   HVYLAGRTRIHLDRVDGLGDFVELEVVLGPDDDEDGGHAEAHAVFAKLGVPSDDLVAVA
FT                   YVDLLNAQAEPTA"
FT   gene            complement(213627..214172)
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0205"
FT   CDS_pept        complement(213627..214172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0205"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51160"
FT                   /db_xref="GOA:Q3JXT2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT2"
FT                   /protein_id="ABA51160.1"
FT                   /translation="MDKCDNCASKRIITRRIIMLELDHFDLALLDVLQRFGRATHQQLG
FT                   EEVPLSPSQIGRRLQRLEAAGVIDGYRVVLRPERLGLGVTAFTSLKLKHHGDSIIEQFQ
FT                   QQIDVLPEVLECHAVVGDADYLLRIVAPDLNALSSFVMKKLMRVPGVDSVRSNIVLTTF
FT                   KRNGPLPLGHLASGAPAA"
FT   gene            214145..215155
FT                   /gene="phhA"
FT                   /locus_tag="BURPS1710b_0206"
FT   CDS_pept        214145..215155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhA"
FT                   /locus_tag="BURPS1710b_0206"
FT                   /product="phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="identified by match to protein family HMM PF00351;
FT                   match to protein family HMM TIGR01267"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47543"
FT                   /db_xref="GOA:Q3JXT1"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT1"
FT                   /protein_id="ABA47543.1"
FT                   /translation="MMRNYRIYPYTIAHFAPKPREPRSTLACIPTTDAKQGYPMSTVVT
FT                   AKLKEQFDAGLETRADFTIDQPLARYGDVDHAVWTQLYTRQAALLRGRACDAFIEGLAR
FT                   IGLAPDRVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRRPDQL
FT                   DYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALRVADDASALALLARLYWYTVEFG
FT                   LIRDTRGENGLRIYGAGIVSSKGETLYSLESTSPNRIGFDLERVMRTRYRIDTFQKTYF
FT                   VIDDFAQLFALADLDARALAARLAGAPEHAAGAVLDGDHVLTRGTGEGWAADADA"
FT   gene            215173..215544
FT                   /locus_tag="BURPS1710b_0207"
FT   CDS_pept        215173..215544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0207"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="identified by match to protein family HMM PF01329"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47754"
FT                   /db_xref="GOA:Q3JXT0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXT0"
FT                   /protein_id="ABA47754.1"
FT                   /translation="MADTARRRANGRGRAAIGRGTKMIHKLTSEERKTQLESLHHWTAV
FT                   PGRDAIQRSLRFADFNEAFGFMTRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDANGLTE
FT                   RDIKLAHFIDEVGKHAKAA"
FT   gene            215979..216671
FT                   /locus_tag="BURPS1710b_0208"
FT   CDS_pept        215979..216671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0208"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50929"
FT                   /db_xref="GOA:Q3JXS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS9"
FT                   /protein_id="ABA50929.1"
FT                   /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRH
FT                   ELVILDLGLPGIDGMTLLSRFRQTNRHTPVIVLTARDELNDRVQGLNSGADDYMLKPFE
FT                   PAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEM
FT                   LLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQ
FT                   EIRQTASV"
FT   gene            216778..218262
FT                   /gene="tctE"
FT                   /locus_tag="BURPS1710b_0209"
FT   CDS_pept        216778..218262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tctE"
FT                   /locus_tag="BURPS1710b_0209"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49867"
FT                   /db_xref="GOA:Q3JXS8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS8"
FT                   /protein_id="ABA49867.1"
FT                   /translation="MSPDPAVTSLRRTLLRRLAAPLSMLALMSGLIAYWLAWQYTQHVV
FT                   DRSLADLASAISKQIQIAGPDAPFTVPPLAQAMFSDPTEQLIYRISDGEHELAGDPKLP
FT                   LQGTSVRRMHVAYVFEAEYDNQAVRVAQVRVAQTESGNPMIVEVAQPVRYRYRIAAEFL
FT                   IAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETEVPLEIRPL
FT                   TSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAIKLHAEQAAVARDPQQALTAVREL
FT                   RSAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAALAFETGAEWVPRALAAHVDLGFQ
FT                   RGDGRGDDEPLLVRGNPVLLREVIANLLDNALKYVPLARPQGARITMDVSRIALDEGHA
FT                   AAEIVVEDNGSGVPAAQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDIIAMHGGTVS
FT                   YADAPEGGSCFIVRVPLADTPSTPAPPPCESPAASA"
FT   gene            complement(218704..219267)
FT                   /locus_tag="BURPS1710b_0210"
FT   CDS_pept        complement(218704..219267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0210"
FT                   /product="SET domain protein"
FT                   /note="identified by match to protein family HMM PF00856"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49118"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS7"
FT                   /protein_id="ABA49118.1"
FT                   /translation="MRGAIVSVSSRLQRIRSMSSRRIVVRRSGVHGKGVFAAVPIKAGE
FT                   RVVEYKGERISWKEALRRHPHDPDDPNHTFYFALEEGGVIDGKIDGNSARWINHSCAPN
FT                   CEAEEVGGRVYIHALRDIDEQEELFYDYGLVIDARLTKKLKREYACHCGAATCRGTLLA
FT                   TSEEDEGKKKKKAKKGGKDKKKKK"
FT   gene            complement(219526..220638)
FT                   /gene="frp"
FT                   /locus_tag="BURPS1710b_0211"
FT   CDS_pept        complement(219526..220638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frp"
FT                   /locus_tag="BURPS1710b_0211"
FT                   /product="oxidoreductase, FAD/FMN-binding"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48152"
FT                   /db_xref="GOA:Q3JXS6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS6"
FT                   /protein_id="ABA48152.1"
FT                   /translation="MSALFSPFTLRGVTLPNRIVISPMCQYSAENGEARAWHMIHLGHL
FT                   ALSGAGLLCIEATAVEPDGRISAADLGLWSDATEAALEPVLAAIRKHSPIRVAMQLSHA
FT                   GRKASSDVPWKGGQLIAVDEGGWRPHAPSGVPHREHEPTPLALDAAGLERVKRAFVESA
FT                   KRAARLGIDAIEVHAAHGYLLHQFLSPLANHRDDAYGGSLENRMRFPLEVFDAVRAAFP
FT                   DDRPVGVRVSATDWVSGGWELDDTIAFAHELKRRDCDWIDVSSGGVSPLQKIPLSPGYQ
FT                   VPFAQAVKRAVGLPTIAVGLISDPAHANRVIEAGDADFVAMARAMLYDPRWPWHAAAQL
FT                   GATVSAPPQYWRSQPREYKALFGDASFGQR"
FT   gene            complement(220876..221586)
FT                   /locus_tag="BURPS1710b_0212"
FT   CDS_pept        complement(220876..221586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0212"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49459"
FT                   /db_xref="GOA:Q3JXS5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS5"
FT                   /protein_id="ABA49459.1"
FT                   /translation="MNAEVVAIRHVHFEDLGSFEQVLGERGRRVRYVDVGGSRVEVLDA
FT                   LEPSLLVVLGGPISAYDDGLYPTTAPLAALVGKRIEAGLPTLGVCLGSQLIARALGARV
FT                   YPAAAKELGWIPLALTDAGRASPLRHVDGAITSMMHWHGDTFDLPAGAIHLASTPACRN
FT                   QAFSWGTHVLALQCHPEIRADRFEPWLIGHAGEIAATPGTDAKRLREQTAQLGPTLECA
FT                   ARRMFGEWLDSVGL"
FT   gene            complement(221626..222438)
FT                   /locus_tag="BURPS1710b_0213"
FT   CDS_pept        complement(221626..222438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0213"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48405"
FT                   /db_xref="GOA:Q3JXS4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS4"
FT                   /protein_id="ABA48405.1"
FT                   /translation="MVGADGGAEIACRFAACASRRTCRTRSSGCALLRQRSRPDLPTNG
FT                   RLRKTAGNSEKTMSDGVYGNQAAGRVTHSLLRLSTAMRSQAWDWAEGAGLTPTQGEILV
FT                   LLLQRKGPMRLGEIARETQLTAATTSDAVSTLEHKGLVEKRRALDDGRALAVRLSARGR
FT                   TAAKKALQWPDFLSKAVGTLGGDEQGVLYRALLKTLRELQVNGDIPPHRMCVTCKHFQP
FT                   GKAARKPTYRCSLLDLTMADSDLRLDCAVHEEADVLTQKKTWKLFAQA"
FT   gene            complement(222781..224028)
FT                   /locus_tag="BURPS1710b_0214"
FT   CDS_pept        complement(222781..224028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0214"
FT                   /product="uncharacterized enzyme subfamily, putative"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02050"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47831"
FT                   /db_xref="GOA:Q3JXS3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXS3"
FT                   /protein_id="ABA47831.1"
FT                   /translation="MLDRRAATDRAARRLSQPVGRRRAARRELSRALDAFRPVIRNHAM
FT                   ALETFVNSEPFTFGVELEIQIVNTHNYDLTKAASDLMRLIKDAKFPGNITPEITESMIE
FT                   LSTGICRTHDQALGELHAIRDTLVSAADQLNVGLCGGGTHAFQQWSERQIFDAPRFQYI
FT                   SELYGYLAKQFTVFGQHVHIGCPDADSALFLLHSMSRFIPHFIALSASSPYVQNVDTGF
FT                   HSARLNSVFAFPLSGRAPFVLTWHGFEEYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIE
FT                   VRVMDTPLSVDRAAAIACYIQTLARYLLIDRPLKLSEDDYLVYTFNRFEACRFGLEGTC
FT                   VNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTIFKQE
FT                   KSLNETVRQQCLRWRE"
FT   gene            complement(223941..225155)
FT                   /locus_tag="BURPS1710b_0215"
FT   CDS_pept        complement(223941..225155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0215"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50931"
FT                   /db_xref="GOA:Q3JXS2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS2"
FT                   /protein_id="ABA50931.1"
FT                   /translation="MKSAFSFLPNWPLAPDAIFWAGFALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLVAGSFGFGVIDASTDDTSRLLVNVALGLLLFELGSRLDLRWIRRNPWLIASS
FT                   LAEATLTFVLVLAVLLLLKVPGMIALVLAAIAISTSPAMVIQLKTELRAEGQVSQRLIT
FT                   LSALNSVYAVVLTKLVTSWLHQEAYGNVFATILQPIYLLAGSFIVAYLFARACNYLFRH
FT                   VAATMRDEHSFVALFGLVVLAIAVAQVLKLSTMLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVILFVLTLTSFEGQDIAAGGLIAGALIATRFLAKLVGVLAFAKPSGLGVKQGI
FT                   ALGVSLVPMSALAYLLVDDTYQLYPNFDPRLRAVVMCSIVVLQLIGPLVVYRSLSAVGE
FT                   RRDAS"
FT   gene            complement(225372..225464)
FT                   /locus_tag="BURPS1710b_0216"
FT   CDS_pept        complement(225372..225464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS1"
FT                   /protein_id="ABA49879.1"
FT                   /translation="MAQSVSFTHVMAQRHDCINGTVGSNSDLRI"
FT   gene            complement(225894..228029)
FT                   /locus_tag="BURPS1710b_0217"
FT   CDS_pept        complement(225894..228029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0217"
FT                   /product="oxidoreductase, FAD-binding family protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF05430"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49513"
FT                   /db_xref="GOA:Q3JXS0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXS0"
FT                   /protein_id="ABA49513.1"
FT                   /translation="MRSARLSGRANRLRRGLAEARARFRWILPTPGGTGLSRRFAAFSP
FT                   PSFLFRMTDRIVPATLVFREDGTVVSPLYGDIYHSAAGALAQADHVFIRGNGLPERWRH
FT                   ERAFTIIETGFGTGCNFLATWAAWRADPSHCERLHFVSVEKHPFAREDLRRAAAHIVAY
FT                   TTITTITPIAPLVDELANAWPALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLALRAHA
FT                   FYLDGFAPSKNADLWSPAIFKSLAKLADERATFATYTSSGAVKRALDEAGFAYRKVDGF
FT                   AGKRAMLVGEFAPRWRVRRHEPPRAFSTDRRDAIVIGAGLAGCAVVERLAARGWHVTLI
FT                   ERRERIASEASGNPAGVFHPMIARDDNLAARLSRAGFLHALHRWRALERAGHAFSRSTH
FT                   GLVQLATSDDEFERMRESIDALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSIS
FT                   PAALAAAQCAAAGDRLSRIVGVEIARLERGGDGRWRALDASGATIAQASVVVVANAADA
FT                   ARIAGLRHAPTQRVRGQLTLLPPGSAPAVPLPVIGDGYVVPLANGVTLTGATYEPDDTD
FT                   ATPREAGHRENLERLERLLPAFSANALDAGALAGRVGFRCVASDRLPLVGELGDEAAAA
FT                   REAAALTGARLRDVPRATGLYGAFGYGSRGLVWATLGAELIAAQIDGEPWPLERELAEA
FT                   IDPARFLVRALRHGRVA"
FT   gene            complement(228649..229989)
FT                   /locus_tag="BURPS1710b_0218"
FT   CDS_pept        complement(228649..229989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0218"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48838"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR9"
FT                   /protein_id="ABA48838.1"
FT                   /translation="MNQPLPVTVLSGFLGAGKTTLLNHILANRAGLKVAVIVNDLAAAN
FT                   VDATFVRGATELSHIEAHLVEMSNGCICCTLRDDLLVEIRRLAAENRFDAIVVESTGIA
FT                   EPMPIAETFTFVDDDGSALEDVARLDTMVTVIDAFNFLHDYARDDALAEHGLAATDEDD
FT                   RTLVELLIEQIEFCDVLVINKADLVDADALARLQRILANLNPRARQIVSRFGDVPLAEV
FT                   INTGRFDFDAAANAPGWLASLEHRHDADEAECGQSQSQGDGRVHSEADEYGIGHFVYRA
FT                   RRPFHPQRLWALLHEEWKGVLRSKGFFWLATRNDIAGSLSQAGGVCRHGPAGHWWAAQD
FT                   RTEWPEAGDELYDEIVADWHGELADTSIGDRRQELVLIGIGLDAAAWRAKFDACLLTGA
FT                   EYAQGKQAWAGYADPFPAWDVDDHDHDHAHDHHDHDHGDDSEIVHRH"
FT   gene            complement(230308..230793)
FT                   /gene="hpaH"
FT                   /locus_tag="BURPS1710b_0219"
FT   CDS_pept        complement(230308..230793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaH"
FT                   /locus_tag="BURPS1710b_0219"
FT                   /product="HpaH precursor"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49414"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR8"
FT                   /protein_id="ABA49414.1"
FT                   /translation="MEKRFVIVAMFAAGAWFASAPARADCYDEAAKYQKVNPLVLRAIA
FT                   WQESHNRPEALNKNANGSTDYGLMQINSIHLPTLSRYGITKDTLMEPCKSVYIAAWHLR
FT                   RKMDKYGNTWQAIGAYHSETPSLRDKYARQIADILARWKLLPASAASATQDTQSAQR"
FT   gene            231196..233448
FT                   /gene="gspD"
FT                   /locus_tag="BURPS1710b_0220"
FT   CDS_pept        231196..233448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="BURPS1710b_0220"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50905"
FT                   /db_xref="GOA:Q3JXR7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR7"
FT                   /protein_id="ABA50905.1"
FT                   /translation="MRRVATALVVAGIVAAQAAHAQVTLNFVNADIDQVAKAIGAATGK
FT                   TIIVDPRVKGQLNLVAERPVPEDQALKTLQSALRMQGFALVQDHGVLKVVPEADAKLQG
FT                   VPTYIGNAPQARGDQVVTQVFELRNESANNLLPVLRPLISPNNTITAYPANNTIVVTDY
FT                   ADNVRRIAQIIAGVDSAAGSQVAVVPLKNANAIDIAAQLTKLLDPGAIGNTDATLKVTV
FT                   QADPRTNALLLRASNAQRLAAAKKIAQQLDAPSGVPGNMHVVPLRNAEAVKLAKTLRGM
FT                   LGKGGGESGSSASSNDANAFNQGGSQSGSNFSTGASGTPPLPSGLSSNSSGGAGGTTGG
FT                   GGLGNAGLLGGDKDKGDDNQPGGMIQADAASNSLIITASDPVYRNLRAVIDQLDARRAQ
FT                   VYIEALVVELQATTSANLGIQWQVANNALYAGTNLVTGQTGLGNSIVNLTAGAVTNPGG
FT                   TLGSLGSITNGLNIGWLHNMFGVQGLGALLQFFAGSSDANVLSTPNLVTLDNEEAKIVV
FT                   GQNVPIPTGSYSNLTSGTTANAFNTYDRRDVGLTLHVKPQITEGGILKLQLYTEDSAVV
FT                   PGTNTTSANSPGPTFTKRSIQSTVLADNGEIIVLGGLMQDNYQVSNTKVPLLGDIPWIG
FT                   QLFRSEGKTRQKTNLMVFLRPVIINDRETAQAVTSNRYDYIQGVTGAYKSDNNVIRDKD
FT                   DPIVPPMPLGPSQGGSPAMNLFDLDKMRRQQLAPPAPASAPAAASDAGTASPGARP"
FT   gene            233445..234938
FT                   /gene="gspE"
FT                   /locus_tag="BURPS1710b_0221"
FT   CDS_pept        233445..234938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="BURPS1710b_0221"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47994"
FT                   /db_xref="GOA:Q3JXR6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR6"
FT                   /protein_id="ABA47994.1"
FT                   /translation="MTQALAQGAPDQPAAGAPSPIAARLLPYGFAKAGQILIAHQHADT
FT                   LEVWISERTSSAALAEVARNFGAISLQRMPADELAQAINHAYARQDGSAAQIVGEVEGE
FT                   VDLSRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFRV
FT                   DGTLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPT
FT                   GHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLISRPHGIVLVTGPTGSGKTTTLY
FT                   ASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDIIMIGE
FT                   IRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRLV
FT                   RQLCPACKEERHEGGRAVWHPVGCDKCGHSGYTGRRGVYELLVIDDSIRSLIHRNAADA
FT                   EILATGRANGMRTLRDDAERWLAAGATSLEEVLRVTGGA"
FT   gene            234943..236160
FT                   /gene="gspF"
FT                   /locus_tag="BURPS1710b_0222"
FT   CDS_pept        234943..236160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="BURPS1710b_0222"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49210"
FT                   /db_xref="GOA:Q3JXR5"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR5"
FT                   /protein_id="ABA49210.1"
FT                   /translation="MPAFRFEAIDASGRAQKGVIEADSARNARGQLRTQGLTPLVVEPA
FT                   ASAQRGARSQRLALGRKLSQREQAILTRQLASLLVAGLPLDEALAVLTEQAERDYIREL
FT                   MAAIRAEVLGGHSLANALTQHPRDFPEIYRALVAAGEHTGKLGIVLSRLADYIEERNAL
FT                   KQKILLAFTYPAIVTVIAFGIVTFLLSYVVPQVVNVFASTKQQLPVLTIVMMALSDFVR
FT                   HWWWAILIGIAAVVYLVKATLSRDGPRLAFDRWLLTAPLAGKLVRGYNTVRFASTLGIL
FT                   TAAGVPILRALQAAGETLSNRAMRGNIDDAIVRVREGSALSRALNNVKTFPPVLVHLIR
FT                   SGEATGDVTTMLDRAAEGESRELERRTMFLTSLLEPLLILAMGGIVLVIVLAVMLPIIE
FT                   LNNMVQ"
FT   gene            complement(236232..236642)
FT                   /gene="gspC"
FT                   /locus_tag="BURPS1710b_0223"
FT   CDS_pept        complement(236232..236642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="BURPS1710b_0223"
FT                   /product="GspC"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR4"
FT                   /protein_id="ABA50053.1"
FT                   /translation="MNALSIRILSLALFAVLCATATYWVVTLSAHQAPLPAAAARTPVR
FT                   TEDAAALFGGQLTRSPVQDIHLFGILALQRGAAAIVGIGGDAPHAVSLGSEIAQGAKLA
FT                   EVRDRSIIVERNGARSEIFLPANTPSPAIYVR"
FT   gene            236790..237242
FT                   /gene="gspG"
FT                   /locus_tag="BURPS1710b_0224"
FT   CDS_pept        236790..237242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="BURPS1710b_0224"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01710; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47580"
FT                   /db_xref="GOA:Q3JXR3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR3"
FT                   /protein_id="ABA47580.1"
FT                   /translation="MQTWITRRSQAARRQRGFTLIEIMVVVAILGILAALIVPKIMSRP
FT                   DEARRIAAKQDIGTIMQALKLYRLDNGRYPTQDQGLNALIQKPTTDPIPNNWKDGGYLE
FT                   RLPNDPWGNSYKYLNPGVHGEIDVFSYGADGKEGGESNDSDIGSWQ"
FT   gene            237277..237876
FT                   /gene="gspH"
FT                   /locus_tag="BURPS1710b_0225"
FT   CDS_pept        237277..237876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="BURPS1710b_0225"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01708; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48388"
FT                   /db_xref="GOA:Q3JXR2"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR2"
FT                   /protein_id="ABA48388.1"
FT                   /translation="MFSMYARPGTIFVCDTRRHAGAALGGAAKARAGACAGVSSGRPAG
FT                   TASARRARGFTLLEMLVVLVIAGILVSVASLTLRRNPRTDLREEAQRIALLFETAGDEA
FT                   QVRARPIAWRATEHGFRFDIRTGDGWRPLRDDVLRARDWDGGVTGAAIDYPGSDTHTDA
FT                   VVFGTESIDVPVRVTLYSAVGSATIVGTGNGRYEVR"
FT   gene            237879..238283
FT                   /gene="gspI"
FT                   /locus_tag="BURPS1710b_0226"
FT   CDS_pept        237879..238283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="BURPS1710b_0226"
FT                   /product="general secretory pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47586"
FT                   /db_xref="GOA:Q3JXR1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR1"
FT                   /protein_id="ABA47586.1"
FT                   /translation="MRAPAPPRSPARSRGFTMIEVLVALAIIAVALAASIRAVGSMATG
FT                   ASDLHARLLAGWSADNALAQLRLAHAWPDIGMQTFDCSQGNVALTCTQRVSSTPNPVFR
FT                   RVEIAVSMNGRAGVLAQMVTVVANETSRPL"
FT   gene            238261..238989
FT                   /gene="gspJ"
FT                   /locus_tag="BURPS1710b_0227"
FT   CDS_pept        238261..238989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="BURPS1710b_0227"
FT                   /product="general secretory pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48750"
FT                   /db_xref="GOA:Q3JXR0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR0"
FT                   /protein_id="ABA48750.1"
FT                   /translation="MKPAVRSERRAPGEKRPRRARRAFRRGARHGARGFTLIEMMIAIT
FT                   ILAVIAILSWRGLDQIIRGREKVAAAMEDERVFAQMFDQMRIDARRAATDDEAGQPAVR
FT                   VAGDTLQIVREFDAPGAAPRLQVVRYRISNGRVVRYASPPIGDVNALRDALRGGDTEGW
FT                   SEVALMRGVGMINARLYVPKVGWTTSMPDADNALEQNNNALKVPMLGNAPPPRAVTGLE
FT                   VSIGATSLRVPITRIFLIGE"
FT   gene            238991..240241
FT                   /gene="gspK"
FT                   /locus_tag="BURPS1710b_0228"
FT   CDS_pept        238991..240241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="BURPS1710b_0228"
FT                   /product="General secretion pathway protein K"
FT                   /note="identified by match to protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49596"
FT                   /db_xref="GOA:Q3JXQ9"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ9"
FT                   /protein_id="ABA49596.1"
FT                   /translation="MRAFALLARFASPGRPRAALGPHAPDAVQPAPARSPRAPHGGSAV
FT                   ADVRVCPPARRPGAPVHRERGVAIINALLVVALSAILVSGMLWRQQVQVRRIENQRLLA
FT                   QAQWVARGALDWTRMVLRSEGDTAPGITYLGGIWAVPIAKTKLSDFLGRIGVTDSAEGS
FT                   DTYLSGSIEDAQAKFNLRNLVSSPAPGALQLNAAQVQTFQRLLATLGLDQQLAKIVARR
FT                   VRAGLKQSATRFQAAQLPGAASGVPVPLPDGGTESGGNFTDEPGIAGGEGRGPAPLMMT
FT                   SVDSLLDVEGFTPEMVERLRPFVTVLPTVTPVNLNTAPAEVIAALVPGMSVSSAQALVS
FT                   RRETVFFRNVGDVQLALRGSGAPNVNLDSSQIDVTSSYFIVHGRIEHDRAVVDRTSLVY
FT                   RDPTTHTTRIVRIRDQL"
FT   gene            240308..241696
FT                   /gene="gspL"
FT                   /locus_tag="BURPS1710b_0229"
FT   CDS_pept        240308..241696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="BURPS1710b_0229"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50481"
FT                   /db_xref="GOA:Q3JXQ8"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ8"
FT                   /protein_id="ABA50481.1"
FT                   /translation="MPLQEWQWPELPFALVDKSGHTQRAGRAALALLPQAATTVLIVAA
FT                   RDLLMLEQALPPLKGPRLKQALPNIIEDQLIQDPQGCHIAVDPAALDGGRRVLAVIDRA
FT                   WFKFIVDAFTAAGHRHLRAVPVTRCLPPATRRDAAAAAETEAVADVALDRPAEHAAAAD
FT                   APGSGHAGATANAPAPAESIVAVALGLAATERAPSLAEEPAALLPQAPSAPRVELALAR
FT                   GALGEGFAAPVSSAVATLEALANGTPLELYELGEPGAEPQLASVRPLDDKRLLPGAAIW
FT                   PFDALVRRALDSRFDLCQFEFEFAPWRFDRATFMRLRLPLALAATTLAIAVIGANAHWW
FT                   KLSRERDALAAQITETLLSTFPKTTTVLDPAAQMTRQLDRLRIAAGELSPNDFLSLASG
FT                   LARSLGPLPPNGIASLDYHDRRLDVGFKPETKVDPDFAQRLARNGLTGEIDSSTGKWTI
FT                   RSRS"
FT   gene            241693..242199
FT                   /gene="gspM"
FT                   /locus_tag="BURPS1710b_0230"
FT   CDS_pept        241693..242199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="BURPS1710b_0230"
FT                   /product="general secretory pathway protein M"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48585"
FT                   /db_xref="GOA:Q3JXQ7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ7"
FT                   /protein_id="ABA48585.1"
FT                   /translation="MKTTEFNEALSQFWEARTAREKLLLGWGGAVLALAIAYSVLWSPA
FT                   QEGRARIQRELPTMRHELAEMTAQANEARSLAGAAQGVAPTGVALKDALAASLSDHGLA
FT                   AAAPQVVGGGVQIQLKNASFPAWTQWLDDVRRQFKAQVVEAHVSALKEDGQVDLTAVLQ
FT                   PASVK"
FT   gene            242238..243029
FT                   /gene="gspN"
FT                   /locus_tag="BURPS1710b_0231"
FT   CDS_pept        242238..243029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="BURPS1710b_0231"
FT                   /product="general secretory pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49641"
FT                   /db_xref="GOA:Q3JXQ6"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ6"
FT                   /protein_id="ABA49641.1"
FT                   /translation="MPMTWPMRVRRVAPWILIGGVAILVTLVALLPASWVTPQFGRATG
FT                   GHVNLVDPDGSLWRGSATLLLAPGADRSASTLLPGRVEWRTQFWPLFAGRVRMRLRQTD
FT                   AMPDGVTLDATLRGAVLSAGSMAVPASLLAGLGTPFNTLDLQGDVRLDWTDWRLFGKDA
FT                   FGQLTVTITDMSSRVSRVKPLGSYRAVLEARGANSTLDLSTSKGPLMMSGQGNFGATGA
FT                   SFRGTASAEPEQRDNLAGLLNLLGHPIGNGAVSLIYGDAAR"
FT   gene            complement(243225..244841)
FT                   /gene="opmB"
FT                   /locus_tag="BURPS1710b_0232"
FT   CDS_pept        complement(243225..244841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opmB"
FT                   /locus_tag="BURPS1710b_0232"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50714"
FT                   /db_xref="GOA:Q3JXQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ5"
FT                   /protein_id="ABA50714.1"
FT                   /translation="MPQVPHPRARRALSAAVAAATAVLLAGCAVGPDYHRPDAAIPAAY
FT                   KEAPPGWKLAQPADRADRGPWWSIYDDAQLNALIDKLNASNQTVAQYAAAYRQARALVA
FT                   EARASYFPTLGLTASESRASSALSSGTASRGTTRTVGNTYSVGLDASWEPDLWGKVSRT
FT                   VGAQKAGEAAAAADLANARLSAQATLAQTYFQLRAADATQKLLDDTVESYRKSLQLTQN
FT                   QYAQGVAARADVIQAQTQLQSAQAAAIDNGIARAQYEHAIATLVGEPAPTFSLPPMPLT
FT                   AEPPAMPIDVPSAILERRPDVAAAERRAAAANEQIGVAIAAFFPTLTLSASGGFQSSVW
FT                   SQLFTLPARFWSVGPQLAATLFDAGLRAAQTEAARATYDQDVAAYRAAVLSAFQDVEDN
FT                   LASQRILEQEIVVQRQAVESAQHSLDITLNQYKAGTVGYLNVLTAQTTAFSARQKLAAL
FT                   SGQRMVSSVGLVKALGGGWDGSQIARETGGMQAPAAPAGASAPAAMPAAAVAPAARPAA
FT                   VVAAAGPDTQARRPRATPAAQ"
FT   gene            complement(245063..245383)
FT                   /locus_tag="BURPS1710b_0233"
FT   CDS_pept        complement(245063..245383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0233"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48911"
FT                   /db_xref="GOA:Q3JXQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ4"
FT                   /protein_id="ABA48911.1"
FT                   /translation="MHASPRSSGERPEDFPMPFLKQAAGALRRNLSDTARHTLSGPHRG
FT                   WKIALYAALLIVPGGSLAALGFAWFDQRRHRTAGMRAASAQEPSAPMLCLAATHGEPVR
FT                   CS"
FT   gene            245492..246025
FT                   /gene="marR"
FT                   /locus_tag="BURPS1710b_0234"
FT   CDS_pept        245492..246025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="BURPS1710b_0234"
FT                   /product="MarR family protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47940"
FT                   /db_xref="GOA:Q3JXQ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ3"
FT                   /protein_id="ABA47940.1"
FT                   /translation="MHCCGSCNRPDSLTMSGLYDPEHIELESSLGYYLTKARQALVERL
FT                   DRALGPLELTAQQISVILLLARGYARTPFELSRKLSYDSGSMTRMLDRLEKKGFVVRAR
FT                   SESDRRVIELALTERGAHAARALPALIATELNAQLEGFSADELALLTDLLRRFIANAPG
FT                   AADAACAEPPPDQR"
FT   gene            246173..247735
FT                   /gene="bcrA"
FT                   /locus_tag="BURPS1710b_0235"
FT   CDS_pept        246173..247735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcrA"
FT                   /locus_tag="BURPS1710b_0235"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49050"
FT                   /db_xref="GOA:Q3JXQ2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ2"
FT                   /protein_id="ABA49050.1"
FT                   /translation="MAATAPASPSRSAEPAPLSGGTLALLTIGLALGTFMEVLDTSIAN
FT                   VAVPTISGSLGVATSEGTWVISSYSVASAIAVPLTGWLARRVGEVRLFTLSVLAFTIAS
FT                   ALCGLAENFETLIAFRLLQGLVSGPMVPLSQTILMRSYPPAKRGLALGLWAMTVIVAPI
FT                   FGPLLGGWISDNYTWPWIFYINLPIGVFSAACAFFLLRGRETKTTKQRIDAIGLALLVI
FT                   GVSCLQMMLDLGKDRDWFNSTFITSLALIAVVSLAFMLVWESTEKEPVVDLSLFKDRNF
FT                   ALGAMIISFGFMAFFGSVVIFPLWLQTVMGYTAGLAGLATAPVGILALVLSPMIGRNMH
FT                   RLDLRMVASFAFVVFAVVSIWNSMFTLDVPFNHVILPRLVQGIGVACFFVPMTTITLSS
FT                   IPDERLASASGLSNFLRTLSGAIGTAVSSTFWENDAIYHHARLAESVNVYAQSTLDYQG
FT                   ALARLGVMGDVSTAQINQIVTQQGFMMATNDFFHISALAFVALAALVWVTKPKKGAGPA
FT                   IGH"
FT   gene            complement(247795..248718)
FT                   /locus_tag="BURPS1710b_0236"
FT   CDS_pept        complement(247795..248718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0236"
FT                   /product="LysR family transcription regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50145"
FT                   /db_xref="GOA:Q3JXQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ1"
FT                   /protein_id="ABA50145.1"
FT                   /translation="MELRALRYFVEVVRQQSFTVAAEQMHVTQPTISKMVKALEDEIGS
FT                   PLLLRDGRQMVLTDAGRIVYQRGQDVLAAQAQLQAELNDLGTLGRGELTIGIPPLGGSL
FT                   FTPAIAAFKERYPRIELKLFEQGARMIEEALVAGELELGGVLEPVDPAVFDVLPMVRAP
FT                   LWLVAPHASRWDGDATVPLADLADEPFVFYAESLALHDAVLDACRKVGFTPQIVSRSGH
FT                   WDFMAALVHAGVGIALLPEPYCRRLDTARFTCRPIVEPEITWAVAIGWLKRGYLSHAAR
FT                   AWLDVARETGPVDPGDDLAFGSLRAR"
FT   gene            248858..249328
FT                   /locus_tag="BURPS1710b_0237"
FT   CDS_pept        248858..249328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0237"
FT                   /product="LrgA family protein"
FT                   /note="identified by match to protein family HMM PF03788"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51152"
FT                   /db_xref="GOA:Q3JXQ0"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ0"
FT                   /protein_id="ABA51152.1"
FT                   /translation="MSRISATAATATRPTTAAPARVGRAARVALQTAALGALWAAIDWT
FT                   VRAFGVPVPSGVVGLAVLLALLLSGRVAPGWVKDGANWLLSDMLLFFIPATVAAVQYGG
FT                   LFKADGWRLALVVVAGTTFVMLSVAIAVDVAAGFERRLAVMRVRAGRRRARA"
FT   gene            249358..250119
FT                   /locus_tag="BURPS1710b_0238"
FT   CDS_pept        249358..250119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0238"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04172"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48387"
FT                   /db_xref="GOA:Q3JXP9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP9"
FT                   /protein_id="ABA48387.1"
FT                   /translation="MPFVDGTGSEGRIMTTPDLSFLTAPSSAAISAGCFALTIALYFAS
FT                   KRLYACRKTLFFSPLVLVPAVLVAFVALTGIPYAVYFRDTRWLMWLLGPATIAFAVPIY
FT                   EYRELMKRHWFSLAVGVVVGIAVAICGSLLLSKLLHLSPELQRSLVTRSVSTPFALAVS
FT                   DRIHAPRDLTALFVIATGICGMLVGEFVLALVPLRSRLARGALFGAAAHAVGTAKAREI
FT                   GSEEGVVSSLTMMIAGVAMVLIAPLLTLLPI"
FT   gene            250893..251435
FT                   /gene="fliL"
FT                   /locus_tag="BURPS1710b_0239"
FT   CDS_pept        250893..251435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="BURPS1710b_0239"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49301"
FT                   /db_xref="GOA:Q3JXP8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP8"
FT                   /protein_id="ABA49301.1"
FT                   /translation="MPNNAGYLESSRRHAMATTANPTVDKPASSGKLKRLVLFLLIGIV
FT                   AAAAAAGGTYFMLSKEGAHSAAPSAPAPLAVPAFFPLEPLTVNLLSDDGIQHYLRVGLS
FT                   LKLTDPKAQEYLTQHMPELRSRILLALSNKHPEQLATLEGKHALADELKTLIEQPTQPG
FT                   NQSARVDDVLFTEFVVQ"
FT   gene            251458..252456
FT                   /gene="fliM"
FT                   /locus_tag="BURPS1710b_0240"
FT   CDS_pept        251458..252456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="BURPS1710b_0240"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM PF02154; match to protein
FT                   family HMM TIGR01397"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50681"
FT                   /db_xref="GOA:Q3JXP7"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP7"
FT                   /protein_id="ABA50681.1"
FT                   /translation="MGHEEFMSQEEVDALLKGVTGEDDSADEPAEASGIRPYNIATQER
FT                   IVRGRMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNL
FT                   VHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFE
FT                   HYASAWKSVRPLQFEFVRSEMHTQFANVATPNEIVIVTQFSIEFGPTGGTLHICMPYSM
FT                   IEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELVADLAEVPTTFEKILNLRTGD
FT                   VLPLDITDSITAKVDGVPVMECGYGIFNGQYALRVQRMISASDTMKEGGYD"
FT   gene            252515..252946
FT                   /gene="fliN"
FT                   /locus_tag="BURPS1710b_0241"
FT   CDS_pept        252515..252946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="BURPS1710b_0241"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49482"
FT                   /db_xref="GOA:Q3JXP6"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP6"
FT                   /protein_id="ABA49482.1"
FT                   /translation="MSAAAAGNAAGAAPQEEMAMDDWAAALAEQNQQPIETGATGAGVF
FT                   RPLSKATASSTHNDIDLILDIPVKMTVELGRTKIAIRNLLQLAQGSVVELDGLAGEPMD
FT                   VLVNGCLIAQGEVVVVNDKFGIRLTDIITPSERIRKLNR"
FT   gene            252943..253608
FT                   /gene="fliO"
FT                   /locus_tag="BURPS1710b_0242"
FT   CDS_pept        252943..253608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /locus_tag="BURPS1710b_0242"
FT                   /product="flagellar protein FliO"
FT                   /note="identified by match to protein family HMM PF04347"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50684"
FT                   /db_xref="GOA:Q3JXP5"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP5"
FT                   /protein_id="ABA50684.1"
FT                   /translation="MKPRFAPLAARAVPVCVPAFLSPRRAAERAPRGRRRAPAALAALA
FT                   SGTAALPVSAADMNAVNHAASLASGVVVGSAAPSLGVGAVLQTLVGLAVVIGLVFGCAW
FT                   LARRFGLQPQRRGGALKIVASVAVGGKESATVVEIGDTWLVLGVAPGNVRLLHTLPAGS
FT                   AGVIGAPAGGGLTRSPGAPGGTAMSGPLPEGASFGARFRDAMLGEAAKRFKRDGGKDR"
FT   gene            253610..254440
FT                   /gene="fliP"
FT                   /locus_tag="BURPS1710b_0243"
FT   CDS_pept        253610..254440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BURPS1710b_0243"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49592"
FT                   /db_xref="GOA:Q3JXP4"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP4"
FT                   /protein_id="ABA49592.1"
FT                   /translation="MPRLRFVAPRADAAACAPSDSRSMKTACLRGAARWLPAILIGLAP
FT                   ALACAQAAGLPAFNSAPGSNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLS
FT                   LLRQAIGTASTPPNQVLVGLALFLTLFVMSPVLDRAYNDAYKPFSEGTLQMDQAVQRGT
FT                   APFKAFMLKQTRETDLALFAKISKAAPMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIF
FT                   IPFLIIDMVVASVLMSMGMMMVSPATVSLPFKLMLFVLVDGWQLLIGSLAQSFT"
FT   gene            254466..254738
FT                   /gene="fliQ"
FT                   /locus_tag="BURPS1710b_0244"
FT   CDS_pept        254466..254738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BURPS1710b_0244"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48012"
FT                   /db_xref="GOA:Q3JXP3"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP3"
FT                   /protein_id="ABA48012.1"
FT                   /translation="MTPENVMTLAHQAMYIGLLLAAPLLLVALAVGLVVSLFQAATQIN
FT                   EATLSFIPKLLAVAATMVIAGPWMLSTMIDYLRETLLRVATLGAG"
FT   gene            complement(254617..255888)
FT                   /locus_tag="BURPS1710b_0247"
FT   CDS_pept        complement(254617..255888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP2"
FT                   /protein_id="ABA49020.1"
FT                   /translation="MPQPMRGAAREAHQARRPRHGATHAGTVTEPNADTDARRAETAGD
FT                   AEQRAPPASDAPRAGRRRRSSRRPAGSRRGAAARAPSGSMHAGRDAPDEIDAGIEQPPD
FT                   ERNQVRRHQLDEQQADEHRHRKADLEDPDLRRGAIEDAEREIRDQQRRDDGQREQQPHL
FT                   ENRRAERDERLPAGRAQQIGRDRHEPERIDERREHLQMPVEREKREDRDRVQETPHHGR
FT                   RAARMRIEEGREAEPHRQADDVARRLDRREHDLHREAERRADQELVDDDPHALRGEHGG
FT                   HRNRRQRRRDDERHEAREADLHAHGRRAVARHRRDRDEREHPHERPQEGGEPAVQLRVG
FT                   DGEHRSRMAKARTGGTSRRIGRIRRIDRGGRDARRGGRDAPSGVSPRRASRRAAGSRAG
FT                   SRSSSTASRGPRSPSSRQPRAASE"
FT   gene            254857..255639
FT                   /gene="fliR"
FT                   /locus_tag="BURPS1710b_0245"
FT   CDS_pept        254857..255639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="BURPS1710b_0245"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01400"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49902"
FT                   /db_xref="GOA:Q3JXP1"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP1"
FT                   /protein_id="ABA49902.1"
FT                   /translation="MFSVTYAQLNGWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIG
FT                   LAGFMALVVAPTLPPIPVATVFSAQGVWIIVNQFLIGAALGFTMQIVFAAIEAAGDIIG
FT                   LSMGLGFATFFDPHSSGATPVMGRFLNAVAILAFLAFDGHLQVFAALVDSFRLVPVSAN
FT                   LLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIANLALGILNRAAPQIGIFQVGFPVT
FT                   MLVGLLLVQLMAPNLIPFVGRLFDTGVDFVGRVAAGMH"
FT   gene            complement(254871..255632)
FT                   /locus_tag="BURPS1710b_0246"
FT   CDS_pept        complement(254871..255632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0246"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP0"
FT                   /protein_id="ABA51171.1"
FT                   /translation="MPAATRPTKSTPVSNSRPTNGIRLGAISWTSSRPTSIVTGKPTWK
FT                   IPICGAARLRMPSARFAISSAATTGSASNSPISKIAAPNATSVCQPAARSRLAETGTSL
FT                   NESTSAANTCKCPSNARNARIATAFRKRPITGVAPLECGSKKVAKPSPIDRPMMSPAAS
FT                   IAANTICIVKPSAAPIRNWLTMIHTPCAENTVATGIGGSVGATTSAMKPARPIFTRTGV
FT                   ERWPVTGAIATSASIRTNGHRKAVSQPFSCA"
FT   gene            complement(255959..256510)
FT                   /locus_tag="BURPS1710b_0248"
FT   CDS_pept        complement(255959..256510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0248"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49251"
FT                   /db_xref="GOA:Q3JXN9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN9"
FT                   /protein_id="ABA49251.1"
FT                   /translation="MRGLSVVIPIRGGHRRSPVRMLAFGRPELHCANSSPLEVKRVGNL
FT                   DIAEVAQRSGVPASALRYYEEKGLIASTGRRGLRRTFDARVLERLALIALGRAAGFSLD
FT                   EVASMFDAQGRPNIDRALLVAKADELDGAIRRLTSMRDGLRHAAACTAPSHMECPKFRR
FT                   ILRAASDARRARKKAPPPGG"
FT   gene            256469..257344
FT                   /locus_tag="BURPS1710b_0249"
FT   CDS_pept        256469..257344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0249"
FT                   /product="similar to aklanonic acid methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47930"
FT                   /db_xref="GOA:Q3JXN8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN8"
FT                   /protein_id="ABA47930.1"
FT                   /translation="MTATDRNDNGQAAHWNGRAGRAWADAQPMLDRMFEPFAQRLVEAA
FT                   RTGRRVLDVGCGAGATTLAVAQRLGARGRCVGVDVSRPLIAAARARAERGGVPASFVHA
FT                   DAQTHAFVPASFDTIISRFGVMFFENAVDAFANLLRAATSDASLAFVAWRTAAENPFMT
FT                   TAERAAAPLVPNLPARQPDAPGQFFFGDARRIETVLAQSGWCGIDVRPIDVECTLPERE
FT                   LIGHFSRLGPLGQLFGDLDDATRARVVDTVRAAFAPYVHGAEVRFTAACWLVGARAPAK
FT                   WSKRKEAAGV"
FT   gene            257337..257858
FT                   /locus_tag="BURPS1710b_0250"
FT   CDS_pept        257337..257858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0250"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48465"
FT                   /db_xref="GOA:Q3JXN7"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN7"
FT                   /protein_id="ABA48465.1"
FT                   /translation="MSDALAFAGCALAIGVGATAVMDAWALVRKRCFGVPPLDYALVGR
FT                   WLGHLARARVRHAPIAASPRVPGERAIGWAAHYLIGVAFAALLLALRGVGWAGEPTLAP
FT                   ALAVGIGSVAAPLFVMQPAMGAGIAASRTPRPGAARFHSIVAHAVFGAGLYGAGCAANR
FT                   LGVPALLGIG"
FT   gene            258016..259029
FT                   /locus_tag="BURPS1710b_0251"
FT   CDS_pept        258016..259029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47675"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN6"
FT                   /protein_id="ABA47675.1"
FT                   /translation="MRTTLRALSLAAVAAGLSFGFAAQPAFADDGGKITIMVGGITKLI
FT                   YLPARLTQELGYFKAEGLDVELQSQPAGVDAENELLAGAVQGVVGFYDHTIDLQSKGKD
FT                   VKAIAVLGQVPGEVEMVSTKAAGAIKSMADVKGKTLGVTGLGSSTSFLTQYLAQQHGIA
FT                   ANQYTMLPVGADASFIAAVKQGRIDAGMTTEPTVSVLEKNGDAKVLVDLRTLDGTRAAL
FT                   GGTYPAASLYVQSAWADTHKAQAAKLAHAFARTMQFIHTHSAEEIAAKMPADYQKDKAL
FT                   YVSALKASLPMYTPDGRMPADGPATVLKVLSAFNPSVKGKHIDLSKTYTNDFVSAK"
FT   gene            259044..259910
FT                   /locus_tag="BURPS1710b_0252"
FT   CDS_pept        259044..259910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0252"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50623"
FT                   /db_xref="GOA:Q3JXN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN5"
FT                   /protein_id="ABA50623.1"
FT                   /translation="MNQAHEGRRRRTDGAGSDAGLLAMNPHVSAHAPAIEFRNVSCRFI
FT                   SPDGRATVALHDFTMSVARGEFVAVVGPTGCGKSTTLNLITGLLKPVSGEVRVMGKPVD
FT                   GIDPRIGFVFQADAVFPWRTVIDNVAAGPLFRGRSKESAYAQAEEWIRRVGLAKFAKHY
FT                   PHQLSGGMRKRVALAQTFINQPEILLMDEPFSALDMQTRTLMQDELLQLWSANKGSVVF
FT                   VTHDLEEAIALADRVFVLTSRPATLKRVYEIDLPRPRVTSEVRYEPRFIEISKDIWHDL
FT                   REEVQIG"
FT   gene            259938..260786
FT                   /locus_tag="BURPS1710b_0253"
FT   CDS_pept        259938..260786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0253"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49705"
FT                   /db_xref="GOA:Q3JXN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN4"
FT                   /protein_id="ABA49705.1"
FT                   /translation="MTLPTPLGTLTSLEDEERAAQRRLRRRRQLIVGLRIAVLVAVLGG
FT                   WEIAARLKWIDPFFFSMPSLIAAQIQDWFVNGTSQGPLLLQVWVTLEETIAGFLIGSVA
FT                   GIFCGIVLGRNKLLADVFGLYIQIANSIPRVVLGSVFVIALGLGMASKIALAVVMVFFV
FT                   VFGNAFQGVREADRYLIANAQILGASRRQITTSVVIPSALSWILASLHVSFGFALVGAV
FT                   VGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADFLLTRLEKRLLKWRPAA
FT                   F"
FT   gene            260864..262243
FT                   /locus_tag="BURPS1710b_0254"
FT   CDS_pept        260864..262243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0254"
FT                   /product="sensor kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48070"
FT                   /db_xref="GOA:Q3JXN3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN3"
FT                   /protein_id="ABA48070.1"
FT                   /translation="MSHSLRGRLLWWLLLPLAVFVAIAGAMSYDTARKTADLVQDGALV
FT                   ASARVIAEDVDWEGGALVANVPPAALELFASPAQDHVYYKVRTGGGRLLAGNPDLDGPA
FT                   APAASGAQPVLFDTALGGLAIRAVAYTRELYNAGNTETVTVVVGKTQTSRQMMIAAIWH
FT                   PQLWRLALMLALAMALVYLGLTFELRPLMKLKEDVADRGPMELEPIRTERLHFELRPIV
FT                   DAINQCIARLNLHAATQRRFIADAAHQLRTPIAVIDTQIQCARQRENGDAALAALLASM
FT                   QRSSRRMADVTDKLLLLAHAEAASPARLAARVDIAAVVSGVLEEAIVLAERRRIDLGAE
FT                   LDDDLQVAGSESLLSALLMNLVDNAVRYAHEGGRVTVSARRDGDAVVLEVVDDGPGIPA
FT                   EARPHVFKRFYRVARDEEGTGLGLAIVEEIAQSHGGAVSLATGPGNRGVRMTVRLPAYR
FT                   N"
FT   gene            262254..262931
FT                   /locus_tag="BURPS1710b_0255"
FT   CDS_pept        262254..262931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0255"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50540"
FT                   /db_xref="GOA:Q3JXN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN2"
FT                   /protein_id="ABA50540.1"
FT                   /translation="MKLLLVEDNAELAHWIVDLLRGEGFGVDSAPDGESADTVLKAQRY
FT                   DALLLDMRLPGMSGKELLARLRRRGDNVPVLMLTAHGSVDDKVDCFSAGADDYVVKPFE
FT                   SRELVARIRALIRRQCGVGATQLACGDLVYLFATREFQCGGAPLALRRREHAILETLML
FT                   QQGKTVSKARLMDSVYGLDDEPSADAIDIYIHRLRKHLSGSLAQIITLRGLGYILRTQD
FT                   AAE"
FT   gene            262971..264599
FT                   /locus_tag="BURPS1710b_0257"
FT   CDS_pept        262971..264599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN1"
FT                   /protein_id="ABA49427.1"
FT                   /translation="MPPARARLLRPALQLFRCFAKPCRAAARRARLIQPKNARHPVLIP
FT                   RFAWPARKRREGLRPLRWRGRSTRIAQRLRSRRCVLRKNGGQHDIGGDDLETTIPGTFH
FT                   RDGRLRGAASARAVERPALRAHRPERSDLSLAREREGRSRDRHGARRRAVVQRQPLGAE
FT                   GRGGHRRRHEGDLPARKRIHGSRRQHGGPGPDLRPRCVGRRRKRHVRQAHRGLPEHDRA
FT                   RRGGDLRRPLRLGEAHDRGRRLDEREQLQADDLLRGRCDGHALQQRPRVEEAVRQRHLR
FT                   ERGLRVQQFDELRAELDLSGRARLQRRPVQRVGLLQPREPRGLREQVVLGRRQLHVRHL
FT                   PRERRLLPLPGRSGRARPAPGQRVDGVVQGRAEGRARLRARLSADARAQRRVQQRRQRA
FT                   EREHRRLQPHVGRRQRLQGNAVRLGVLPPVEAHRAVPRRRLHAPARRLYGRVHARRDQS
FT                   ARADDRHPHAVLIRRAGRPADASAVPPFALPAPPACSVFPAFFAAPARSPARRGVRRPG
FT                   SCRAFCLPRPFVDEPRGTPSNSAAP"
FT   gene            complement(263098..264525)
FT                   /locus_tag="BURPS1710b_0258"
FT   CDS_pept        complement(263098..264525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN0"
FT                   /protein_id="ABA50188.1"
FT                   /translation="MSRAVERRGAQEIGRARRKRRERPNRRAGRGARRAARPTRRPAAP
FT                   RGGSEPRADAGRQLELIGRAVRGRDRIAAVQAHVVAGEVQLGALRQVVEHRAVQRFLEA
FT                   VADARREAEVADVRVRHVAVAVVRGVVHAHLLIAELVVERALRRDLERHRPRVVLALAE
FT                   RALIAQVAEVAGVHAEDVERVVAADRERLVRVARVVHVAEEARHVERAAVVAERDLIGR
FT                   VLPEARRIAERVARAREDAVAEQLLPREAVVVARARRTGRVEDHLLEVVRVRPAAFLGR
FT                   ELRRAVRVAVDRRRVARDRVLEARGELAERVVFDADPRIAVEDLARVLHVAVGYRVFAF
FT                   EPEDHLRAAADVLRALQPPAAAAEPRLAAEPHADHVIALRVRVRAIGRNAQVDEPVELD
FT                   ARLRVRLRRRAGGRRDGKCQVLSFQDRPLRYRVDRHSFVVRSVGCADAARCASNGHAIV
FT                   VGAILRGAFAPATRISG"
FT   gene            263161..264381
FT                   /locus_tag="BURPS1710b_0256"
FT   CDS_pept        263161..264381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0256"
FT                   /product="outer membrane porin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49480"
FT                   /db_xref="GOA:Q3JXM9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM9"
FT                   /protein_id="ABA49480.1"
FT                   /translation="MAVRRASRSVCAADAAYYERMAVNTISEGTILKRQYLALSIATAA
FT                   CAAPQAHAQSSVQLYGLIDLSVPTYRSHANAKGDHVIGMGLGGEPWFSGSRWGLKGAED
FT                   IGGGTKVIFRLESEYTVADGNMEDPGQIFDRDAWVGVENDTFGKLTAGFQNTIARDAAA
FT                   IYGDPYGSAKLTTEEGGWTNANNFKQMIFYAAGATGTRYNNGLAWKKLFGNGIFASAGY
FT                   AFSNSTSFGQNSTYQVALGYNGGPFNVSGFFSHVNHAGYANKSFSVGGNYTFDIFRVNA
FT                   GYFRYLGDQGALGQRQDNAWTVSFKVAPKGALDYELGYQQMRVHNAAYNSDGNVPNANI
FT                   GDFSLTSGVGNGFKETLYGSVFYHLSKRTELYLAGDYMRLHGGYTVASTHGATNQLELT
FT                   TGIRTRF"
FT   gene            264836..266869
FT                   /gene="mod"
FT                   /locus_tag="BURPS1710b_0259"
FT   CDS_pept        264836..266869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mod"
FT                   /locus_tag="BURPS1710b_0259"
FT                   /product="type III DNA modification methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50296"
FT                   /db_xref="GOA:Q3JXM8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM8"
FT                   /protein_id="ABA50296.1"
FT                   /translation="MQLMGRMMQKLDAASPEAQSADLVAANVERLKALFPDVVTEGPDG
FT                   ASVNLDALAALVGASAAAAADADEKYGLNWHGKRRARRLALTPSTGTLRPCPRESAGWA
FT                   STRNLMIEGENLEVLKLLQKSYAGRVKLVYIDPPYNTGKDFVYPDNFTDSLRHYLELTG
FT                   QTTGGKRVTSHTDASGRFHTDWLNMIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVM
FT                   REIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQR
FT                   MLGAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYDRISADGRVYRLVSMAWPNK
FT                   KKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMRALIDKGLVEFGADETTQPQRIYFL
FT                   DENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGS
FT                   GTTAHAVMALNAADGGHRRYVLVQLPEPLDADSKDQKAAADFCAAQRVPLNLAELTKER
FT                   LRRAAARIAAEHPGTRADLGFRVFRLDSTNVSEWDPRGDDIQQSLFAAVEHIKPNRSEE
FT                   DLLYELMLKLGLDLCAPIDARMIAGKAVYVIDGAIVACFDAHIDRASTDALGEGIVGLI
FT                   AEAADAREVTCVFRDSGFADDVAKVNLSAILEQHGVKRIRSL"
FT   gene            266910..269939
FT                   /gene="res"
FT                   /locus_tag="BURPS1710b_0260"
FT   CDS_pept        266910..269939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="res"
FT                   /locus_tag="BURPS1710b_0260"
FT                   /product="type III restriction system endonuclease"
FT                   /EC_number="3.1.21.5"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50907"
FT                   /db_xref="GOA:Q3JXM7"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM7"
FT                   /protein_id="ABA50907.1"
FT                   /translation="MQLHFESDLDYQLEAIEAVCDLFRGQEACRAEFSVTAQAARRRAG
FT                   PQISLGMAESGLGVGNRLTLDAHTFAENLARVQVRNGLPPSGAPSSNDFTVEMETGTGK
FT                   TYVYLRTIFELHRRFDFTKFVIVVPSVAIKEGVHKTLQITEQHFRRLYAGVPFDYFVYD
FT                   SAKLGEVRSFASKSIVQIMIVTVAAINKKDVNTLYKDSEHTGGEKPIDLIRATHPIVIV
FT                   DEPQSVDGGLEGRGKEALDAMRPLCTLRYSATHADKYQMLYRLDAIDAYERKLVKQIEI
FT                   ASATVEDAHNKPFVRVISIGSRRGAIAARVELDVATAAGDVERQTVSVSDGDDLERVAR
FT                   RAVYANFSIGEIHAARGAEYLVLRYPGGDAFLSVGDAYGDVDTHAIQREMIRRTIREHL
FT                   DKELRLTPLGVKVLSLFFVDAVDKYRKYDRHGQPFKGDYALLFEDEYRRAAKLPEYRAL
FT                   FDGVDAGLAAEAVHDGYFSIDKKGGWTDTSDRSAGSRENAERAYGLIMKDKERLLSFDT
FT                   PLKFIFSHSALKEGWDNPNVFQICTLRDIHSERERRQTIGRGLRLAVNQRGERVRGFDV
FT                   NTLTVIAGESYEQFAENLQKEIEADTGIRFGIVETHQFAALPVPADDGSVQPLGVERSA
FT                   ALWMHLRDAGYLDARGRVQDTLRAALKLRALPLPDEFDALRALIVDMLRKLAGRLDVRN
FT                   ADERRHIALRRDAHGKAVYLGDAFRALWDRIRHRTTYRVNFDNARLIERCVAALKAAPA
FT                   VTRARLQWRKADIAIDASGVEATETEDAGAIAIDEGEVELPDLLTELQDRTQLTRRTIA
FT                   KVLIESGRLDEFPLNPQRFIALVAAALERCKRDALVDGIEYRLLGEAHVHALSLFESEP
FT                   LTGYLSSMRRGAAKSIHEDVPCDTPAERAFVESLEQDDAVRLYAKLPGWFKIPTPLGSY
FT                   SPDWAVLIAEGDGPRLYFVVESKSGVADGDLRADERRRVQCGAAHFRALEAVADNPARY
FT                   VRARRADDLPTAAADARDAA"
FT   gene            270359..271816
FT                   /locus_tag="BURPS1710b_0262"
FT   CDS_pept        270359..271816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49855"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM6"
FT                   /protein_id="ABA49855.1"
FT                   /translation="MFVRRRERCAPHAAPHSEPEIDGGAPSAAAHNDNPNGDDDEEVCG
FT                   SGGGPCRRDGRARVRRQRHAVRPDRCRRVVRVERRRQAQRVFRRRHRGAESMGASGHRG
FT                   SRRRREGDLRADVAIRARQRRRAADAGLDVLAHRARRPLERAARQRDARPAIRLHDRFA
FT                   DVRLVRRCVPLRRSVQLPPGAVLEARDSRQSHRLVRLRPVGGFEPRAELGQVHEREPER
FT                   ARVRPDVRFRQSGGRRARGEQHRQRRPQVRDGQFRARRRLRRSQVSADEQRARRAAQLG
FT                   ARRALCTVRVRSEPAVHEHAQHADGRGDRRDPGRRALRRRAVDDRRELRVHEGQRAARS
FT                   QLRASSHGGRAVCAVQAHVRVRRDRVPVRGRQRGRACVDQRRDGARCAVELAFAVSRAN
FT                   RHAYPFLTVSRPRRPPRAVRLRGSGRAARAPGRPEFAGCAGLARGGFRTRRHGRASRAG
FT                   ARACVFGQVAAGACIARRTAPCVGWRT"
FT   gene            270477..271577
FT                   /gene="omp38"
FT                   /locus_tag="BURPS1710b_0261"
FT   CDS_pept        270477..271577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp38"
FT                   /locus_tag="BURPS1710b_0261"
FT                   /product="outer membrane porin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48848"
FT                   /db_xref="GOA:Q3JXM5"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM5"
FT                   /protein_id="ABA48848.1"
FT                   /translation="MKKFAVAAAGLAVATGAHASDGSVTLFGLIDAGVSYVSNEGGKRN
FT                   VYFDDGIAVPNLWGLRGTEDLGGGAKAIFELTSQYALGNGAALPTPGSMFSRTALVGLW
FT                   SERLGSVTLGQQYDFMTDSLTFGSFDGAFRYGGLYNFRQGPFSKLGIPDNPTGSFDFDR
FT                   LAGSSRVPNSVKYTSANLNGLVFGLMYGFGNQAGGGLAANSTVSAGLKYETGSFALGAA
FT                   YVEVKYPQMNNGHDGLRNWGLGARYALSAFDLNLLYTNTRNTLTGAAIDVIQAGVRYVG
FT                   APWTIGANYEYMKGNAQLDRNYAHQVTAAAQYALSKRTSAYVETVYQYAGGSAGAHAWI
FT                   NGVMGPDAQSSSRSQFLARIGMLTRF"
FT   gene            271977..272936
FT                   /locus_tag="BURPS1710b_0263"
FT   CDS_pept        271977..272936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0263"
FT                   /product="AraC family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50871"
FT                   /db_xref="GOA:Q3JXM4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM4"
FT                   /protein_id="ABA50871.1"
FT                   /translation="MVNGRFFTTAGESPAFRGRAWGRVVTQYFGGLDACCDGDDAFDAQ
FT                   LSQYEIGPMRVFTIAAPAHRIVRPVAALHDHGSDFFKLILQLSGVSEIEQRGKTFRLHS
FT                   GDWSLYDPRVPYSIANLTHVEQLAIQIPRKQLGGFAVPDLHTSDVREFELKGLFSLLSS
FT                   FLVSLSEQLPSLPGTTGTALSETILGLIVSTLTAQRDAQGEHVALPAVLRMRVKQYIHG
FT                   HLADADLSIDRIARELRCSKRYLHRIFEEEGVTIDRYIWSSRLERCKDALDNARAAKPA
FT                   ISEIAFSWGFSSSAHFCRSFKQRYGMTPREFVRRRAWP"
FT   gene            complement(273059..273790)
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0264"
FT   CDS_pept        complement(273059..273790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0264"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48211"
FT                   /db_xref="GOA:Q3JXM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM3"
FT                   /protein_id="ABA48211.1"
FT                   /translation="MQLEVKNLVVHRANKPVLHGVSLAVTPGRVTALVGANGAGKSTLV
FT                   MSIAGALPATSGNVLLGGAPLGALRPEAVRRLGVAVVPEGHHVLGDLTVRDNLRAAGAF
FT                   LSARRLNGAIDRALAIFPELEPKLDARANDLSGGQKQMVCVSQALIGEPHTLLIDELSL
FT                   GLAPTVTKRLAQTVARIANDGVAVLLIEQFTTIALALATNAYVLERGRVAFAGSAQTLR
FT                   ERPEILHGSYLASKGSGANAA"
FT   gene            273899..275020
FT                   /locus_tag="BURPS1710b_0265"
FT   CDS_pept        273899..275020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM2"
FT                   /protein_id="ABA50342.1"
FT                   /translation="MRRAEGNGANAAPEAIDRARRAAKTSTALAAPTASRRRATAPPIA
FT                   GRRRTAGPARAPHAVRAPFARALAPALVHERRFDAGRPIRRFASRFMFVERLAEIRTAH
FT                   ERIVEHRARGPEREPLAEIEHERRLAHGIDQVDVVIDQQHLRADAFGNANDHVGEPRGF
FT                   GLVQARARLVEQQQARRADERLAEFQHAALIQVERRALRVRDVGEADEFERAPRVVARG
FT                   EGRHHVLGEREHVVVHAQILDDLFGLERAPHARAHALGDGQREQRAAVQRDAARTRPQE
FT                   AAQYVQQRRLARAVRADQPAYGRSELRVERVEHARAAELHGQVRDFDHRAPPSRARNAR
FT                   PTRDASPASCPAMPAGAVTSACSSAAPKKIIAR"
FT   gene            complement(274163..274885)
FT                   /locus_tag="BURPS1710b_0266"
FT   CDS_pept        complement(274163..274885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0266"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48543"
FT                   /db_xref="GOA:Q3JXM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM1"
FT                   /protein_id="ABA48543.1"
FT                   /translation="MIEISNLTVQFGGTRVLDALDAKLAAPICGLIGPNGAGKTTLLNV
FT                   LSGFLRPRAGSVALDGRALLALSVAERVRAGVRRTFQTEQIVEDLSVHDNVLALAEHVM
FT                   PALAARDDTRRALELVGLADVAHAQGAALNLYQRRMLELGKALVGAPRLLLLDEPGAGL
FT                   NETEAARLADVIVRIPECVGAQVLLIDHDVDLIDAVCEATLVLDFGKRLALGPTRAVLD
FT                   DPLVRSAYLGQAFDEHEA"
FT   gene            complement(274882..275931)
FT                   /locus_tag="BURPS1710b_0267"
FT   CDS_pept        complement(274882..275931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0267"
FT                   /product="branched chain amino acid ABC transporter,
FT                   ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48755"
FT                   /db_xref="GOA:Q3JXM0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM0"
FT                   /protein_id="ABA48755.1"
FT                   /translation="MKTPLAFAAPPRDAAARAKPAGARLALVATLGTLAAIALVVPAVA
FT                   DAYWIKTLTSALTVSIAAAGVALLYRQLGLVCLSQHALFGVGGWIALRLAHLGAPFELC
FT                   VLAGAAGGSAIGMIAGLPALRLRGLYLALVTLMMAGGFQVVVSAIGFPDGGGGFTGHLS
FT                   FGARQMMARPLVGQSDAAYFRYVAAWAALAFALIELHRRSKAGRSWALIRRGEMPALAA
FT                   GVNVVLYQTWAFGLAGLLAGLSGGLLAGSVGQLDGRAFAASESVLLFALSVVGGVYHWF
FT                   GALITGLLLRAVPALLTDFGVNGYLAMIFFGAALLHALVTAPAGIAGQLAGLASRVGRA
FT                   FRARDGGAR"
FT   gene            complement(275928..276722)
FT                   /locus_tag="BURPS1710b_0268"
FT   CDS_pept        complement(275928..276722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0268"
FT                   /product="Branched-chain amino acid transport system /
FT                   permease component, putative"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50056"
FT                   /db_xref="GOA:Q3JXL9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL9"
FT                   /protein_id="ABA50056.1"
FT                   /translation="MLYRASGVLNFAFGATGALGAYVAAACLDADYPQALAWGAAVAAS
FT                   TAASLVYGLVLAPRLAARERVVRSVATLGFALVLLGFCEWYWGDTPRRLVLPTDSEALD
FT                   FGDVRFTYTRIVGLALACAMMAAIGVVLARTRLGLHMRALSNDRHLSGVLGIRVLSVDA
FT                   AAWAISGVFAGITGLLLANLVRLQAAVLTFLVIPAFAAAIVGRLASLPATVAAGVAIGL
FT                   AEALAITVPGFAPYRSATPFLIALVAMLFIGSPSSGRAANES"
FT   gene            276276..277601
FT                   /locus_tag="BURPS1710b_0269"
FT   CDS_pept        276276..277601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL8"
FT                   /protein_id="ABA49033.1"
FT                   /translation="MPVVRQRAHVQPEPRAREHDADRGHHRAREREADDARVREADVAE
FT                   VERFAVGRQHEAARRIAPVPLAEAEQHEREAERRDAAHDALARGEPRREHEAVDERRRG
FT                   RRGDRRAPRERLRIVGIETRGRDVRAERARRAEREVQHAGRAIQHDEADARQRVHRADA
FT                   EPGDQVRNEVDRVHGVSASSFRPRGCRRVADRRPPGTSTPSSSPCPSIAPSGPRCSRCA
FT                   ARPRRRRTGRTGCRCGSPSPRAARPSRARDRAGSRAVSAACRSRAARPDSPPARTCRAG
FT                   PSCRRTCPSPRASSGCPAFARRAAGTRGSRRNCPSSTGRSPSARRGRSRTPPRRSESAG
FT                   RGSAARRPTGSAPSALSAARAGSPADSSTPPAARPTSDRLSRGPSRSCRRSRRCACPRA
FT                   PALRTTTRRGSGCSARCTPSASPCTAASRTTPPPSSTGAAPC"
FT   gene            complement(276811..278070)
FT                   /locus_tag="BURPS1710b_0270"
FT   CDS_pept        complement(276811..278070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48987"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL7"
FT                   /protein_id="ABA48987.1"
FT                   /translation="MKPLSLNMKRALAGACIGAAGFLAQQAALAQSCGLANGKPATGAP
FT                   IPIGAVVGKTGPDDFSSSARAAAAYFKCVNANGGINGRPVQYLVEDDQWNPETASQVAS
FT                   KLVRDRKVLALAGNASFVECGANAKFYEQENVIAIAGVGVPRECYFARNYAPLNMGPRL
FT                   SMTEAALYAKQQYKATRMVCIAPNIPSLGAWSCEGPALWGKRNGVSVDTIVMDPDSADP
FT                   TSVVLQAASKNPQAILLGLPKGLMVPILSAAEQQNLGRRIHFVSAASGYDLGVPKAIGP
FT                   YWKGNFDVNLEFQPLDAQTPDNRNWLAVMDKYGDRKDPRDTFSQAGYLAARLVTDTLLK
FT                   LPANQLDRAHVTAALREVKDFRSDILCGPFYVGAGERHNANNAGRMAQSTGTGWKTVST
FT                   CQAVDDPQLADIRAAEKKMH"
FT   gene            278128..279888
FT                   /locus_tag="BURPS1710b_0271"
FT   CDS_pept        278128..279888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48616"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL6"
FT                   /protein_id="ABA48616.1"
FT                   /translation="MLRGCFGAASACVADIRVSRCVSFSTSKFQYAGASARGRFADAWP
FT                   ERGAPARRSMRDADGFELGELFERRAAELAAVARLLEAAERQVGVEHVVRVDPDDARLQ
FT                   PRHDAMHVRQVLRPHARREPEVGVVREPHRVVDRVERRDRDDRPEHLLAHDPHRRRGVD
FT                   EHRRLHEIAAVERARAAGDERRALLLRGADVAEHALEVPLRHERADLRVRIEARADLHR
FT                   FGGRGDAGDDPLEQALLHVHARARRADLPLIEEDALRRAMRGEVGVGIVQDDQRRFPAE
FT                   LEREARHPLDGRVADRAAHADRAREGDLVDARMRGERRARLGARARHDVQHAVGQPRFL
FT                   RELAQAQRGERRFLRRLQHHRAAACERGRDLPQRDRERKIPRHDRADDAHRLAARIREI
FT                   LGAGGRGDRCIERRAFELRRPTGHVADVLGAAQHVDRARDADQLAGFERLERGELVRVA
FT                   LEALGELMQQLFAARGPHARPVARIERAARGGHGRVDIARVARGDFRDRHLGRRIDDGQ
FT                   IAARARLGGAAVDPVAELAAGEKAGLALMLGRKSGQVHGDLVRNKKTRWLNERTKALTA
FT                   ASPARRAACR"
FT   gene            complement(278287..279792)
FT                   /locus_tag="BURPS1710b_0272"
FT   CDS_pept        complement(278287..279792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0272"
FT                   /product="phenylacetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.39"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47982"
FT                   /db_xref="GOA:Q3JXL5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL5"
FT                   /protein_id="ABA47982.1"
FT                   /translation="MNLAALSTQHQRQSGFLARRQFGNWIDGRAAEPRSGRYLPVVDPA
FT                   TEMTIAEVAASDARDVDAAVAAARRAFDSGDWPRMRPASREKLLHQLAERLERYADELA
FT                   ALETLETGKLIGVARAIDVLGGAEYVRYMAGWATKLEGSTLDTSIAAPAGAEYFAYTRR
FT                   EAVGVVGAIVPWNFPLAIALWKVATALACGCTVVLKPSEETPLTALRLGELAQEAGLPD
FT                   GVLNIVTGAGAEAGAALAAHPGIDKITFTGSVGVGRAIGHAAVERMARFTLELGGKSPL
FT                   IVLDDADPDFAAHGAAQGIFFNQGQVCTAGSRVYVQKRLFERVVAGIAAAAEAMKIGSG
FT                   FDPNTQIGPLVSKRHFERVLGHVGAAKEEGATLVTGGTRALDGGYFVKPTVFVDAAPAM
FT                   RIVREEVFGPVVTVTPFDTVDDAVRLANDTDFGLAASVWSQNLSHVHRVVPRLKAGIVW
FT                   VNTHNMLDPNLPFGGFKQSGYGRELGRAALEQFTELKSVCIAH"
FT   gene            complement(279848..280267)
FT                   /locus_tag="BURPS1710b_0273"
FT   CDS_pept        complement(279848..280267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49802"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL4"
FT                   /protein_id="ABA49802.1"
FT                   /translation="MRNRSEDHTMRTPYQIVADHYAASDRRDPAAMMADIAPTIEWTEM
FT                   AGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFALDALHDAGDTVIGIGRYSGTYRRTGK
FT                   SFACRVAHVWRVDAGKIVRFEQFTDTLLVAQAMQP"
FT   gene            complement(280171..281595)
FT                   /locus_tag="BURPS1710b_0275"
FT   CDS_pept        complement(280171..281595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL3"
FT                   /protein_id="ABA50400.1"
FT                   /translation="MGAIDAREPRHRVRLRARVAARADRAARQHRDPVVARRPFRGAER
FT                   HRLRDDQARADRPHTLARARLRPCRRARERGVPGLGAHRDGRRADGRAARRARARDARG
FT                   RLPARHARRAARPPGAARRSRRHGAVPGVAVCIDGHGHVAARRRRRIRRRSADDRIRAL
FT                   MPGATAPDELFRGLTDERQTAGLEELRRLRGRHRHEPAARDRCARRPRADVRAAGRRVR
FT                   REFRRRPDALVATRRDRRHRLVRGDRSRARYVLRRRHVQEPAGRGADARVQHRDAARAR
FT                   HPVAHPQPRRSGRRAARRAGFPRRHDRRRPSRCGCIGHIGHSGRRARRDARSDRHAHAE
FT                   RLQPEPHVRAHVPELGALLLAMPRRRAARPRRRRSRDDLQVRRRSLRVHVPRVPDSGRV
FT                   GVRVQLRGRPLDRQVSRRDGRRRDREPAGRLLHPQTVAGRLSGRCATDLRTIRCVPLTK
FT                   SSPIITRRPTGAIPPR"
FT   gene            complement(280251..281060)
FT                   /locus_tag="BURPS1710b_0274"
FT   CDS_pept        complement(280251..281060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49506"
FT                   /db_xref="InterPro:IPR024724"
FT                   /db_xref="InterPro:IPR035348"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL2"
FT                   /protein_id="ABA49506.1"
FT                   /translation="MNDKPQDWKNYEDFAAGIDTNRLPATDALVGRALTFELPGGAFAA
FT                   NFVDGQTLSWRRGETGGTDWYEAIEVAPDTFFVDVTFKSRPAEALTLVFNTATRRALGI
FT                   LSRIRSRDEAGAAPRVAQDFLVGTIAGGQADAGVSGILGIAGAEPAETRDLIGTRTLNV
FT                   YSPNHTYEHTYLSSARYCWQCLVGEQRGHGDVDLATTYKFADDLYVFTFREFLIPVASV
FT                   FVFNFAAGRSTGKFLGETGDGAIANRPAGSFIRKLSQAVYPDDAQPI"
FT   gene            complement(281106..281903)
FT                   /locus_tag="BURPS1710b_0276"
FT   CDS_pept        complement(281106..281903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0276"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48685"
FT                   /db_xref="GOA:Q3JXL1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL1"
FT                   /protein_id="ABA48685.1"
FT                   /translation="MHTFNDKVALITGGGTGIGAAVARKFVEAGGRVVLLGRRREPLDA
FT                   VAKPLGAAAIAVAGDAADAHDVRRALDDARAAFGRVDVLVANAGGHGVGSALDTDDASW
FT                   AQSTRVNLDTAFVCARELLPELIERRGSIVILSSLAGHFAGPNVIGYVTTKHALIGLTR
FT                   SLARDYGRAGVRVNAVCPGWVRTAMADEQMDALRDAHGLATREDAYRLVTRDVPLGRPA
FT                   QPDEVADTVLYLASPYASMVTGTSLLVDGGASAVDLPTIEFAR"
FT   gene            complement(281707..283461)
FT                   /locus_tag="BURPS1710b_0277"
FT   CDS_pept        complement(281707..283461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL0"
FT                   /protein_id="ABA48756.1"
FT                   /translation="MGLRDRAASARGRPPDVRAAGPHARRRQLGERDGLHPRHAGRLRR
FT                   LARRRLRRLGLGRRAAVLPARRAQSPARRAAARRRRAAARKRLALSASAEPRVRPGRAG
FT                   VRTAIQRRLQRRVTGRRRLLSDDDVRRPARQHRRDVSRRRQARSAADDRNRRVRHAHRV
FT                   RERRGGRRALPGARRRRADRACARGNRAVRRRAREPEAPDAVGRRPGGATAAARHSGGA
FT                   RFARGRAQLPGSSRSVAVRARARAGQSRGAGPRAQRAAPRHPVHVVSYGAAHVERRRKR
FT                   RLRRHGERRPPGRAVPRAARARRRRRPRTARGPRNLDQSMLSAAEVARHRAPAQRRSAR
FT                   ADPFRRQFPQSSGRFRGAHARPVARARDHADAVDVEGDRGRDAADRRRPRRSRRVRALA
FT                   REDRLSPVGHVPHGRRSGFGRRRATARARRRRAADLRRIGDALARVRQHQCADDHDRRA
FT                   LRRIHAVAGARADCARRREYAASRAAGREPRALSAARSPSRRASARAVTIALSHSFEGD
FT                   VSHAYVQRQGRVDHGRRHGHRRGRRAQVRRSGRQGRAARPPSRAARRGREAARRRRDRG
FT                   RGRRGRCA"
FT   gene            complement(281988..283658)
FT                   /locus_tag="BURPS1710b_0278"
FT   CDS_pept        complement(281988..283658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0278"
FT                   /product="glucose-methanol-choline (GMC) oxidoreductase
FT                   family protein"
FT                   /EC_number="1.1.99.-"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50734"
FT                   /db_xref="GOA:Q3JXK9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK9"
FT                   /protein_id="ABA50734.1"
FT                   /translation="MSAANQNGSTEFDYIVIGGGSAGCVVTHRLVSAGHRVLLLEAGPP
FT                   DNSFFVHTPATFVRVIGTKRTWVYETEPQAHAAGRRMYVPQGRTLGGGSSVNAMVYIRG
FT                   TPADYDGWRDAGCDGWGWDDVLPFFRRAEHNHRLAGPLHGVDGPLHVSDSRFRHPLSHA
FT                   FVQGAQEFGLPYNDDFNGASQAGVGFYQTTTFEGRRGSTAATYLAAVKRDPLLTTETDA
FT                   FVTRIVFENGAAVGVRYQARDGEERIARARAEIVLCAGALASPKLLMLSGVGPAEQLLQ
FT                   HGIPVVHDSPEVGLNFQDHLEVSLYGRAREPVSLAGQDRGLNALRHGIQYTLFHTGLLT
FT                   SNVVESGGFVDTANGGRPDVQFHVLPVLVGDVGREPLAGHGISINPCFLRPKSRGTVRL
FT                   RSADPHAPILFDGNFLSHPDDFAALMRGLSLAREIMRMPSMSKAIAGEMLPTDGGRVDL
FT                   DAYVRSHAKTVYHPSGTCRMGGDPDSVVDAQLRVRGVGGLRICDASVMPSLVSGNTNAP
FT                   TIMIAERCAEFMLSPALAPTARAGASTPQAAPQDASHAR"
FT   gene            284385..284726
FT                   /locus_tag="BURPS1710b_0279"
FT   CDS_pept        284385..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0279"
FT                   /product="PadR-like family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49170"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK8"
FT                   /protein_id="ABA49170.1"
FT                   /translation="MKTQLKKGALDMCVLAMLARRDSYAYELVSTLAETMEISEGTIYP
FT                   LMRRLQAEAWVTTYLVESTSGPPRKYYSITDAGRASLRQMEDEWRSFVDEVNGVLALHG
FT                   TRADGEERQ"
FT   gene            complement(284597..286048)
FT                   /locus_tag="BURPS1710b_0281"
FT   CDS_pept        complement(284597..286048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK7"
FT                   /protein_id="ABA48051.1"
FT                   /translation="MAASDASSQPREISWHCCFTEQKKGARYSPERPCPFEGKTRPSRG
FT                   TSVRPLPLELRRYRIDPPPHVPPERAPRDPRQPDAHEQPDDPDRQHREPVAERDAAERE
FT                   PGRCGNAHVLLAVVDGDPAADDRYRILAVRHRQVHAAAAIRRHLHVAARDAGHVHARHR
FT                   SARVRHRHLVAVRALQIERDHVGARDAERVVLARREQLARAITRRVDRQLAALLARIDH
FT                   ALARDDRHAAAVVQVEHVALALDTQLLRVVQRIGGRGARALRILRDLAGLRGLAVRRAL
FT                   AVRLARSAGRAELRRAAAERQDARHGRAEHVVTAERDERDEARHRQRAEEHVAQRQHEH
FT                   VQQERHEQDQVQQPEARDRADHAHQIAERAPLLPLAEIRLRLQLARELLRFTERGDHVF
FT                   LGAPGRERVADVLAVIGDDLVDVPFRQAAERLPQPLDECVLLHCRSSPSARVPCNASTP
FT                   LTSSTKLRHSSSICRRLARPASVIE"
FT   gene            284723..285910
FT                   /locus_tag="BURPS1710b_0280"
FT   CDS_pept        284723..285910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0280"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50184"
FT                   /db_xref="GOA:Q3JXK6"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK6"
FT                   /protein_id="ABA50184.1"
FT                   /translation="MKQDAFIQRLRQALGSLPKRDVDEIVADYREYIGDALSAGRTEED
FT                   VIAALGEPEKLARELKAQANFRQWEERRSFGNLMRVVGSIAGLGLLHLVLLVPFLLYML
FT                   VLTLGYVFFGALTVAGLVTLVAFGSHYVFGTPVPGVLPFGGGAAQLGAAGASGKADGKG
FT                   ATDGKAAQTGKIAQDPKSASAAAADALNDAKELRVEGERYVLDLHDGSRVSIVTRKGVI
FT                   DARKQGGKLSIDATGDGARELLTTGKDDTLGIARADVIALDLKSANGDQMTVANTGGSV
FT                   PGVNVPGIAGGNVQMTPDGRGGMNLSVTNGENSVSIVGGRITVDNGKQHVSVAAPAGFA
FT                   LGGIAFGYGLAMLPIGIVGLLVCVWLTRVTWRALGRYVRRRIDAVSAKLERERAN"
FT   gene            complement(286583..288205)
FT                   /locus_tag="BURPS1710b_0282"
FT   CDS_pept        complement(286583..288205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0282"
FT                   /product="fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48268"
FT                   /db_xref="GOA:Q3JXK5"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK5"
FT                   /protein_id="ABA48268.1"
FT                   /translation="MAHRRIAAAPLERRVPDGVVHLARPGRPHRPRPPRARARDARLPR
FT                   MGQEPVRTPGQHRRQCRLGAPAADQARRRAGGGRVRRDGLRRPAGSAHPRAVGRRRAVG
FT                   YVPHARRAARRLACARAGARSRRGRARGVPARRQGDPAGRLRSAAAGAVRRRRRARGVH
FT                   RMRAALRRRGPPDLARPPRQRASVRAGRGARRDRGPPALAREAAGGDIDMNDRIRIRDL
FT                   FTRDEIRALTARSNWRGAWAVGSTWAVIALAFAGLAYARAHFPAWGFALALAAGMTIIA
FT                   GRQLCLGILQHDAAHGTLFRTRWANDVLVDWLCARPIWNALHKYRPYHLMHHATTSSRA
FT                   DPDLSLVAGLPTTRASLARKCLRDLSGVTGVKFLIGRALMDAGVLQWSLTNDIRRLPQT
FT                   GRRWWDYPRAFLRAAAGMLITNAILLGALWASGHPWLYGVWVLAYVTPFPLFIRIRSMA
FT                   EHACLETSDDPLRNTRTTHAGWLARATVAPIRVNYHVEHHLMASVPYFRLPKMHRMLRA
FT                   RGCVARPPSYWQVLRTVSAKTAA"
FT   gene            complement(287599..288435)
FT                   /locus_tag="BURPS1710b_0283"
FT   CDS_pept        complement(287599..288435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49201"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK4"
FT                   /protein_id="ABA49201.1"
FT                   /translation="MTQPTARHLILDLLVAKDGEPLQVREAIIACRLFGLTENSVRVAL
FT                   ARLAAESLVEGAERGSYRLGPSAVELSEELTAWRTVESRLRRWSGAYLMVSCISLGRVD
FT                   RTALARRERALEMLGFREWDKSLYVRPDNIAGNVDSVRRRLTKLGVEPAAAVFVAMGFD
FT                   APQEARIRALWDGDALSDTYRTLGAQLEDWLARAPELDLDVAAREAFLLGGKAIRQVVF
FT                   DPLLPEPFVDVAARAAFIECARRYVGAGHRIWRALLDSEHPSAPGAARDAIVGHLH"
FT   gene            complement(288875..289876)
FT                   /locus_tag="BURPS1710b_0284"
FT   CDS_pept        complement(288875..289876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0284"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48669"
FT                   /db_xref="GOA:Q3JXK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK3"
FT                   /protein_id="ABA48669.1"
FT                   /translation="MKARSLDVVNSRLFDIAILSHDGRPVPTIGGLDVPATAALSDADA
FT                   HEVVIVPAQFMPDAQIGALERVFIDWLERRYAAGALVVGLNAAPLLAKAGLLDGRGATG
FT                   LPSERTLFARHFPAVRYTPSKPLVVDGRLITVSGINPAVDACAYVIDYCFGAGVSQRLL
FT                   RVALTQSLPSYEHMAVWAAQYKRHGDAPVLAVQDSVERALAHPPTLAELAARAAMSERT
FT                   LSRRFAAATGLTLRRYVAALRVELAAFLLRTSRMTLEHIADECGFASASALSHAFLAGQ
FT                   GCSPIQYRNRHRPDARPDARREPAGGGGTGGTGGTAAGSGEGAASSGGRAGK"
FT   gene            289947..291239
FT                   /locus_tag="BURPS1710b_0285"
FT   CDS_pept        289947..291239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0285"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49391"
FT                   /db_xref="GOA:Q3JXK2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK2"
FT                   /protein_id="ABA49391.1"
FT                   /translation="MATPGRPVPRSGFFITRKWRFGSTQIVPDLLKYRKQPAVGTDAPR
FT                   DSSPGDAMIPRTIFAEEHEQFRESVRRFIESEVMPHHERWEEQGYVDRDVWTKAAAAGY
FT                   HCASMPEAYGGVGADIRYSVVLFEEIARAGASGLGFGLHSEIVAPYILHYGSDALKARY
FT                   LPKLASAEMIGAIAMTEPGAGSDLQGVRTTAVRDGDHYVLNGSKIFITNGWHADVVIVV
FT                   ARTTPEGGSKGTSLFVVDTGMAGFSKGKRLKKVGMKAQDTSELFFDGVRVPAGNLLGEE
FT                   NRGFVYLMQELPWERLQIAISAIASAEAALAWTLDYTRERRAFGRAVIDFQTSRHALAE
FT                   LKSEIQIGRVFVDKCIELQLAGKLDAATASMAKYWTTDLQFKVIDRCVQLHGGYGYMWE
FT                   YPIARAWADSRVQQIYGGTNEIMKELIARTL"
FT   gene            291257..293110
FT                   /locus_tag="BURPS1710b_0286"
FT   CDS_pept        291257..293110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0286"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47799"
FT                   /db_xref="GOA:Q3JXK1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK1"
FT                   /protein_id="ABA47799.1"
FT                   /translation="MGDAARLGRASRFERGRRRDRRERFARGARSGGAIRVRAAWHGVA
FT                   WHGVALQPDAVRPPRSARAFARHANRLGERAAVRGVAPCVARGIGAAPSGRPNRTAACA
FT                   ELAPTPSGLSSRVCVRDRARHHEDAPGERAAGGRLGKWCRAGGRTGKARRKHAGKRRSA
FT                   RPSGATGRTRRTSRRPAERRGLSRSAAAAAVRPGWPSRLAVPTGHLHQPKERFMEAYIF
FT                   DAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPVGEQGA
FT                   CIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESMSRVP
FT                   MGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAAQAG
FT                   WFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRYPE
FT                   LERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTGP
FT                   AYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
FT                   ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI"
FT   gene            293123..295246
FT                   /gene="fadB"
FT                   /locus_tag="BURPS1710b_0287"
FT   CDS_pept        293123..295246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="BURPS1710b_0287"
FT                   /product="fatty oxidation complex, alpha subunit"
FT                   /EC_number="5.1.2.3"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49172"
FT                   /db_xref="GOA:Q3JXK0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK0"
FT                   /protein_id="ABA49172.1"
FT                   /translation="MIDYTLDDDGIATLSWNLPARSQNVLNGESCEAFFAAAARALQDA
FT                   AVKGMLVTSAKPDFIAGGDLEWLQASDSAETLFARTCELHRALRALETGGKPVAIAMPG
FT                   SALGGGLEIALAGHYRVAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGVQASLPLLL
FT                   EGKRLKAADALAAGILHAVVPAGEEIAAARAWLLDASRRTATQPWDAKGFRIPGGALTH
FT                   PSVQQVFMAANALARQKTYGNYPAVANILSCVYEGLLTDLDTGLKTEARYFVKAVLSPE
FT                   AKAMIRTLFFGMNEANKLAARPAGVPTQRYRKVGVLGAGMMGAGIAYVSAKAGLDVVLI
FT                   DTGEEAAARGKDYSRKLVDKQVQRGRLAREKADALLAKIVPTTDFARLDGAQLVIEAVF
FT                   EDRAIKADVTRRSEAVLAPDALFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPL
FT                   VEVIVGRDTSEATLARALDYVKTIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVA
FT                   PALIENAGLLAGMPVGPLALTDEVSSELIHKITRQTRADLGDAYVARPGEDVAARMVEL
FT                   GRLGRKAGLGYYDYPASGGKKALWPGLAQEFPLAAEQPDVAALIERLVTVQAVETARCL
FT                   EERVLTTARDADVGAILGWGFPAFRGGPASYIHGVGVDAFVATCDRLAARHGARFAAPA
FT                   LLREMAAQGRSFY"
FT   gene            295642..296775
FT                   /locus_tag="BURPS1710b_0288"
FT   CDS_pept        295642..296775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0288"
FT                   /product="alpha-methylacyl-CoA racemase"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48626"
FT                   /db_xref="GOA:Q3JXJ9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ9"
FT                   /protein_id="ABA48626.1"
FT                   /translation="MGPLHGIRIVEIAGIGPAPFCGMLLADMGADVILVERTAGRDGDP
FT                   LDLGRRAIFNRGKRSLALDLKQPEAVGAVLRLVEHADALIEGMRPGVMERLGLGPDTCF
FT                   ARNPKLVYGRMTGWGQDGPLAHAAGHDINYIGLSGALWYAGQPGDAPFAPPTLVGDLGG
FT                   GALYLAMGVLAGIVDARLRGKGQIVDAAIVDGSANLMNLLLSIHAAGFMPMARGQGLLD
FT                   GPHWYGSYRCACGGYVSVGALEPQFYALLVDKLGLADDDDFRNPYDASRWPRLRERLAE
FT                   IFASRPRAHWVELMEGTDACFAPVLSPAEAQSHPHLAARGVYAQRDGILQAAPAPRFSG
FT                   SPNAQPGAVPKRGADSAAILREAGFAEDEIAALAAKE"
FT   gene            complement(296852..297418)
FT                   /locus_tag="BURPS1710b_0289"
FT   CDS_pept        complement(296852..297418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0289"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ8"
FT                   /protein_id="ABA47856.1"
FT                   /translation="MRTIRAWLALTFVASIACLIATTPAARAAPAGKTLTFDGVAFFQR
FT                   DAAGNRLEYTPKGEDDLSAWRTMITLVRYPEATTADGLASIADSVLRLYKQNGAMILKV
FT                   DAVPAARGKPAEYFISVAFPTRDFIEAVFTRIALVDGSGAAAIYSHREYGRAVGNEVSA
FT                   WIEKNGAAKERALKQWNPLPTVGGK"
FT   gene            complement(297754..298467)
FT                   /locus_tag="BURPS1710b_0290"
FT   CDS_pept        complement(297754..298467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0290"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49518"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ7"
FT                   /protein_id="ABA49518.1"
FT                   /translation="MPGAPVAHRVRRAFLLAAVAHARAHAEYRARNTAARSFVYPLSAG
FT                   AFANARHRAPAPIDHAGRRDVGGPTAHPHVRVSAQSLIMNRLILRCTTALIGSGAFVCA
FT                   CAQTYDGTTAPIDTSDCRAITGQADIDGAMQQVVGRACLQSDGTWRLVQNPDGSVPWYP
FT                   LAAYPYPDPWYWGAPFFVGAGTTFVFVDRFHHFHRFHRFHPMTPSHVGPPAGGGVHHGP
FT                   SRSGGMGGWGGTARH"
FT   gene            298606..299214
FT                   /locus_tag="BURPS1710b_0291"
FT   CDS_pept        298606..299214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ6"
FT                   /protein_id="ABA48652.1"
FT                   /translation="MHTPARPMRARRANCTRRGICVELSRRLIVSRICPTIRFAWLVAA
FT                   IRIPLIKTEGTMPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKTPTGSVTSGVDLCGQC
FT                   VSYVKRVCPTLPLTGQWRKGAPVKGNATIVAGTMIATFNAAGKYDGHAAIYVSQTKDGG
FT                   ILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGDNFYVVE"
FT   gene            299201..299569
FT                   /locus_tag="BURPS1710b_0292"
FT   CDS_pept        299201..299569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0292"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47865"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ5"
FT                   /protein_id="ABA47865.1"
FT                   /translation="MSWSKAACALFALSFLGCAGASGTAGSIDAGTQVCPVRAQSPLQY
FT                   VDVFDGAPSDLATLIPDDAGERTGHWELGYVYDAGRYVTIRCKYADGRTKDVRLAERVK
FT                   RCDYRIDGKKTLQVTCAK"
FT   gene            complement(300237..300995)
FT                   /gene="prtR"
FT                   /locus_tag="BURPS1710b_0293"
FT   CDS_pept        complement(300237..300995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtR"
FT                   /locus_tag="BURPS1710b_0293"
FT                   /product="transmembrane regulator PrtR"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50609"
FT                   /db_xref="GOA:Q3JXJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ4"
FT                   /protein_id="ABA50609.1"
FT                   /translation="MNIPPDEHDLHAYVDGRLDADARTAVERWLALHPARAEQVRRWRQ
FT                   DAQQLRAALDSLPTPAPTRTLDPAVLRARRAGRARARLAMAASLVLCVALGAIGGWQAH
FT                   GWSGAPAAPMSDAVAAYKLMVVDRSARVDVAQKQPGELQAWVARALGAAARLPDLSSAG
FT                   FAPVGGRLFATERGAAAMVLYEDAAGRTLSFYIRPPESANRLLAAGERADGALLARYGS
FT                   ARGFNYAVVGRADSVGEAAVARALEVEGQS"
FT   gene            complement(300992..301507)
FT                   /gene="prtI"
FT                   /locus_tag="BURPS1710b_0294"
FT   CDS_pept        complement(300992..301507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtI"
FT                   /locus_tag="BURPS1710b_0294"
FT                   /product="ECF sigma factor PrtI"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48938"
FT                   /db_xref="GOA:Q3JXJ3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ3"
FT                   /protein_id="ABA48938.1"
FT                   /translation="MPSADLDDPLRELLPRLRRFALWLTRDVHSADDLVQSTLERALSR
FT                   WSTRRDASALRSWLFTILYRQFVDATRRAKRYAWLLGRIKDDDEPQWPSAEDHALARSM
FT                   LDAFGRLSTEQRSLLLLVAVEGFSYQEVAELLDIPIGTVMSRLSRARQALRALGDGEIS
FT                   APSLRLMK"
FT   gene            301668..302753
FT                   /locus_tag="BURPS1710b_0295"
FT   CDS_pept        301668..302753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0295"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF00199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48079"
FT                   /db_xref="GOA:Q3JXJ2"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ2"
FT                   /protein_id="ABA48079.1"
FT                   /translation="MEHPSTPPGDGPSRGFWRWALIGGAVAAVAATFGYVGGWLAPHRL
FT                   TPQRLVDALQRNGGLHPGYRRNHAKGVCVTGYFEGNGAASAYSTAPFFAAVRTPVVGRF
FT                   ALPGGNPYAPDSSVPIRSLALRLSAPDGEQWRTGMNSMPVFPVATPRAFYEQTVAGRPD
FT                   PRTGKPDPAKLKAFFDAHPETAAFRAWMKTAKPSASYVTETYYSLNAFYLVDAAGRRQA
FT                   VRWRVAPERMADAGESAKAGDPNVLREDLARRIGSGPQRWHLLLTLAEPGDPVDDATRA
FT                   WPATRTTIDAGTLVLDRVEAQDSGPCRDVNYDPTILPDGIRASGDPLLAARSAAYADSY
FT                   LRRTSEEAGMPGAAHPLSEKR"
FT   gene            302753..303277
FT                   /locus_tag="BURPS1710b_0296"
FT   CDS_pept        302753..303277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0296"
FT                   /product="cytochrome B561"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51031"
FT                   /db_xref="GOA:Q3JXJ1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ1"
FT                   /protein_id="ABA51031.1"
FT                   /translation="MKTTFSPLARLLHWVMAAMIVSMLFVGAGMVTTVSGRHAALVAMH
FT                   KPLGVAVLVLACVRVVVRLSSRPPALPADLPGWQKFAAHGSHLVLYALMIAMPLVGWAM
FT                   LSAGGYPVTLGGGVRLPSIVPADAVWFAWLRHAHRWLAYLFFATFLAHFAAALYHGMIR
FT                   RDGVLRAMVGR"
FT   gene            305337..305600
FT                   /locus_tag="BURPS1710b_0297"
FT   CDS_pept        305337..305600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0297"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49582"
FT                   /db_xref="GOA:Q3JXJ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ0"
FT                   /protein_id="ABA49582.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            305624..306457
FT                   /locus_tag="BURPS1710b_0298"
FT   CDS_pept        305624..306457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0298"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48544"
FT                   /db_xref="GOA:Q3JXI9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI9"
FT                   /protein_id="ABA48544.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTQANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYRKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(306716..309184)
FT                   /gene="gyrB"
FT                   /locus_tag="BURPS1710b_0299"
FT   CDS_pept        complement(306716..309184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BURPS1710b_0299"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47501"
FT                   /db_xref="GOA:Q3JXI8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI8"
FT                   /protein_id="ABA47501.1"
FT                   /translation="MTEQHNSQPENSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGYCNDIHVTIHADNSISVTDNGRGIPTDVKLNDKHEPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLIVRRDGKKHFMEFHRGIAQ
FT                   NRVLEERDGEQVSPMQVIGETENRGTEVHFMADPTIFGTVEYHYDILAKRIRELSFLNN
FT                   GVRIRLTDLRSGKEDDFAFAGGVKGFVEYINKTKSVLHPTIFHINGEKDSVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKVETTGDDMRE
FT                   GLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICGKIV
FT                   EAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKDDYNLDKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYVYIAQPPLYKVKAGRDERYLKDDTELN
FT                   AHMLRLALQGSELVPTENGTPISGDALGELARSYLLARGVVERLSRLYDPAALEAVMDG
FT                   VAIDLSSEASTEASAKALAAMLSDDSKTEVRVVPAYDAVREQRSLRVERTHHGNVRVSV
FT                   IDEEFQHTADYQQLVNTANTFKGLIGAGAAIKRGERSSNVTDFKEAMKWLMADAERNLS
FT                   KQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIEDAIAADGIFTTLMGDEVEPRRAFIEN
FT                   NALRAGNIDV"
FT   gene            complement(309372..310475)
FT                   /gene="dnaN"
FT                   /locus_tag="BURPS1710b_0300"
FT   CDS_pept        complement(309372..310475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BURPS1710b_0300"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50826"
FT                   /db_xref="GOA:Q3JXI7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI7"
FT                   /protein_id="ABA50826.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQSKDFGASLAVPQKAFRQLLGMVYFAMAQQDIRYYLNGMLLVV
FT                   DGDRLMAVATDGHRLAFSSMKIEGSFGRQEVIVPRKTILELQRLLEDIDDTVKIDIAQT
FT                   QAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRAAILTSDKFKG
FT                   VRCIIAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQVS
FT                   LGDASSSALITVPENDEFKYVVMPMRI"
FT   gene            complement(310638..312239)
FT                   /gene="dnaA"
FT                   /locus_tag="BURPS1710b_0301"
FT   CDS_pept        complement(310638..312239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BURPS1710b_0301"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49564"
FT                   /db_xref="GOA:Q3JXI6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXI6"
FT                   /protein_id="ABA49564.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAP
FT                   NRFKLDWVKSQFSGRISDLARDFWNAPIEVQFVLDPKAGQRSPAGATPLAPRAPLPSAN
FT                   PAPVAPGPASAPAVDAHAPAPAGMNAATAAAVAAAQAAQAAQANAAALNADEAADLDLP
FT                   SLTAHEAAAGRRTWRPGAANANSEAADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQ
FT                   VADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQ
FT                   RKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKE
FT                   ISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVSLSEDVAFFVAKHLRSNV
FT                   RELEGALRKILAYSKFHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVA
FT                   DMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKD
FT                   AQLNHELHVLEQTLKG"
FT   gene            312836..313303
FT                   /gene="rnpA"
FT                   /locus_tag="BURPS1710b_0302"
FT   CDS_pept        312836..313303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BURPS1710b_0302"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="identified by match to protein family HMM PF00825;
FT                   match to protein family HMM TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49183"
FT                   /db_xref="GOA:Q3JXI5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI5"
FT                   /protein_id="ABA49183.1"
FT                   /translation="MSAVRSDAGEAAAVRGSIPLQASAAFPKAARLLKTDEFSSVFRLR
FT                   PWRRTAHFVIYGKPTGRDARLGLVIGKKYAARAVTRNLVKRLAREAFRTRRAEFAGWDI
FT                   LLRLHARFDKKAMPSAASAPLAALCAGEIRELLDRAAREVARRNGAKPASE"
FT   gene            313383..313652
FT                   /locus_tag="BURPS1710b_0303"
FT   CDS_pept        313383..313652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0303"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /note="identified by match to protein family HMM PF01809;
FT                   match to protein family HMM TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47943"
FT                   /db_xref="GOA:Q3JXI4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXI4"
FT                   /protein_id="ABA47943.1"
FT                   /translation="MQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAAR
FT                   GTYLAARRLCRCHPFSAGGVDLVPPPNSDARNAPHEAEASSHRL"
FT   gene            313661..315337
FT                   /locus_tag="BURPS1710b_0304"
FT   CDS_pept        313661..315337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0304"
FT                   /product="inner membrane protein, 60 kDa"
FT                   /note="identified by match to protein family HMM PF02096"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50098"
FT                   /db_xref="GOA:Q3JXI3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXI3"
FT                   /protein_id="ABA50098.1"
FT                   /translation="MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASN
FT                   ATNGNGASGASAAAAANALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLA
FT                   KLTLTKAGDGKQPDLSVTLFDHTANHTYLARTGLLGGDFPNHNDVYAQVAGPTSLAADQ
FT                   NTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIENVGAAPVTPSVYMELVRDNSSV
FT                   ETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADYVTSADNGWIAMVQHYFASAWIPQ
FT                   SGAKRDIYVEKIDPTLYRVGVKQPVAAIAPGQSADVSARLFAGPEEERMLEGIAPGLEL
FT                   VKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKE
FT                   ITPRMQALRERFKSDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASV
FT                   EMRGAPWVLWIHDLSQRDPYFILPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSV
FT                   MFFFFPAGLVLYYVVNNVLSIAQQYYITRTLGGAAAKKKAS"
FT   gene            complement(313703..316033)
FT                   /locus_tag="BURPS1710b_0305"
FT   CDS_pept        complement(313703..316033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49432"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI2"
FT                   /protein_id="ABA49432.1"
FT                   /translation="MSAPVADRNLWHPPVKPSLSWAKHNPIGCLPGSGRTAQSGHADTR
FT                   RKSGVHRTSQIRLVAQSRKSDRRDGTRFAFQFASSRRASGFSANRAQMADGPHDPDTGQ
FT                   APYACRVASGGSALVALRPAAERGAHHAATAAARRKVSADTGDDRARVENRGALAASSV
FT                   SGAGADRAVLRRYVQALSRAAVSTKKPPDENRAAFFILSAEMMSGDHARFTGAAQKRSA
FT                   CAALFRQAKASARLFLRRGAAERARDVVLLRDRQHVVHHVVQHEAGREEEEHHRERDRH
FT                   EHHHLRLNRVRGSRVQLRLHEHRDGHQHRQDEVWVALRQVVNPQNPRRAAHFDRREQHP
FT                   VQRDEHRNLDHHRQAAAKRVHLLRLVQFHQRRVHLLRIALEAFAQRLHPRRDFLHPRHR
FT                   LVARRRQREEHRLDQQREQHDRPAPIADEAVNLLEQPEQRLRDDRHPAVILHELQARRD
FT                   AFEHPLFLRAGEQARGHVGRLARRDRRDRLLHADAVQRRVDLLDVDVALRARLWNPGGR
FT                   EVVLNHRDPAVVGGRDVIGLVLVDVAERDLLEVLLIRVHRRPEERMREHRRLDRRVVAH
FT                   ELHVYARRHGRGADVLDLRVDADHVAAARERVRLHHLHAALHRRFERQLQRVLVGRERR
FT                   RAGHLRIDVVVIREIAAEQARAREIRVVRRVIEQRHRQVGLLAVARLRQRQLRERAAAR
FT                   VDLAIVDVGREAHELRLRRRRGRRGGRARRGRRQRIRRRRRARARRAIAVSRVRRGVRL
FT                   RDVREEHRRASVGPLPVVEQHDR"
FT   gene            complement(315493..315954)
FT                   /locus_tag="BURPS1710b_0306"
FT   CDS_pept        complement(315493..315954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47755"
FT                   /db_xref="GOA:Q3JXI1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI1"
FT                   /protein_id="ABA47755.1"
FT                   /translation="MVVFLAAVELHNLAMPTHEEKAAFTERLKFALLRSPEKVTGATEL
FT                   ALHFNLRHHGEHPVSPQTAHKWLTGRTIPTPDKLHTLAEWLRVDLHWLHYGPPPSAART
FT                   TPQPLPRDEKYPPTPETIELASKIEALSPHHRYLVQELIEQFYGDTSKR"
FT   gene            316250..317653
FT                   /gene="trmE"
FT                   /locus_tag="BURPS1710b_0307"
FT   CDS_pept        316250..317653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="BURPS1710b_0307"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00450; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50818"
FT                   /db_xref="GOA:Q3JXI0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXI0"
FT                   /protein_id="ABA50818.1"
FT                   /translation="MLATDSDPIVAIATASGRGGIGVVRLSLGRAGEAAARALSDALCG
FT                   ARLMPRHASYVPFLDGAGEPLDRGIALYFPAPHSYTGEHVIELQGHGGPIVLQLLLQRC
FT                   LDAGRAHGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASSEAAARSAGRSLDGAFS
FT                   RDIHALVDDVIALRMLVEATLDFPEEEIDFLEAADARGKLAHIRERLAHVLGDARQGAL
FT                   LREGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDKVAQTIQIEGIPLHIIDT
FT                   AGLRETEDEVEKIGIARTWGEIERADVVLHLLDARSGLGPGDEAIAARFPDGVPVVRVL
FT                   NKTDLTGAPASVTRTGGGAARADVCEVRLSAKRGDGIDLLRGELLRIAGWQAGAESVYL
FT                   ARERHLIALRAAQAHLARAAEHAEQNAQALDLFAEELRLAQERLNSITGEFTSDDLLGV
FT                   IFSRFCIGK"
FT   gene            317807..319051
FT                   /gene="intA"
FT                   /locus_tag="BURPS1710b_0308"
FT   CDS_pept        317807..319051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intA"
FT                   /locus_tag="BURPS1710b_0308"
FT                   /product="Integrase or site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48930"
FT                   /db_xref="GOA:Q3JXH9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH9"
FT                   /protein_id="ABA48930.1"
FT                   /translation="MCTNAMPKISTPLNDTRIKALKPKAARYTVSDGGGLVLEVMTSGS
FT                   KFWRYRYSLHGKQQPVVTIGEYPAVSLTAARERARRYAEIVAGGVSPVADARKDRGAVK
FT                   SLDTIHEFAEYWIEQQMMGKSAEYLRTTRRALEKDIYPAIGGKSVSDVTPGDVLAICDR
FT                   IKKRGAPKMALSTRNILKRIYEYAIARQLVTSNPAQAIVARFVATQASRDRVLSPNEIG
FT                   RVLRAVYASSIRRPLKLAIHLLVLTMVRKSELIEARWDEFDLDASIWRIPAERMKKDRE
FT                   HWVYLAPQAVAMLRELHATRTSHQYVFPSSRGADRPIAKSTLNQAVRALDMDVQHFVLH
FT                   DFRRTASTHLHEMGQPSDAIEKALAHSIKGIKGVYNRAEYADERRRITALWADFVDAQI
FT                   DEGRKVVIGKFGSAA"
FT   gene            complement(319699..322566)
FT                   /locus_tag="BURPS1710b_0309"
FT   CDS_pept        complement(319699..322566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0309"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49691"
FT                   /db_xref="GOA:Q3JXH8"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH8"
FT                   /protein_id="ABA49691.1"
FT                   /translation="MSNAPMSEFERASVALGYVPADDRDTWRQAGMALKAEFGEEGFTL
FT                   WNEWSQGAQNYNARDARDVWKSFKGGKITINTLFHLAKQGGFDPRAHRAKPVDPAERER
FT                   QKAERAAREAAELVELIEKQQAASALAESIWSAAEPAPAGHPYLVRKRIPADALRVYRG
FT                   NLSIGTAACDSALVIPARDADGTLRTLEFILTDGQKRYLPNGRKAGCFSLIGDAVSSVL
FT                   LIGEGYATCATLAAATGYPVAVAFDTGNLHAVATALRGQYPDARIVVCADDDHTTNGNP
FT                   GVTKARAAADAVGGAVTVPDFGPNRPAAGTDFNDLAAHLGPDAVVVAVRAALTSAGSSD
FT                   ADRGKARSPVEKPAKRPKTARAQDGKSRFVVDDKGVWFHGFNNQGDPLPPHWVSTRIDV
FT                   IAETRNEMNSEWGYLLEFTDRDGILKRWAVPAGLFAGDGTELRRMLLDMGVKLGVTQIA
FT                   RTQIANYVQMAQPDERVRCVPRVGWHHGAFVLPDRVIGTGKEALIYQADTPIQSQFKER
FT                   GTLDDWQREVAAYCVGNSRLLFCVATAFAGPLLHFSGLQSGGFHLLGTTSKGKSTGGVI
FT                   AASVFGSPDYVRSWKATDNALEAVATQHSDALLILDEIGQVEPRLVGDVIYMLANESGK
FT                   ARASRSGSAKPVLTWRLLFLSNGEKSVSALMAEGNKPMKGGIEVRLPAIPAEVGEMGVV
FT                   EKLHGFPTPAALIEHLERHAGIHYGTAGPAFIEWASSQAGELAEHLRIRVDELVGQWVP
FT                   DGSHSQVARVAKRFCLVAVAGELATAHGLTGWPQGEAVEAARRCFEGWLELRGGTGNSD
FT                   EAEAVRQVQHFLAAHGDNRFVWMNRAQDDHRPNVPHRAGFKQHVKRDERRTPIASDREY
FT                   YAEFGGKMSADDAESVETEYLIEAAVFRKDVCAGFDHKIVAKALMKRGVLMPRSDGYPY
FT                   RHEYIPGHGKFMVYRVLPSIFTLEL"
FT   gene            complement(322691..323032)
FT                   /locus_tag="BURPS1710b_0310"
FT   CDS_pept        complement(322691..323032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50600"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH7"
FT                   /protein_id="ABA50600.1"
FT                   /translation="MSQYVRTAVIEGFDNAPPLDTSAPIELQFAVDLGAVCADAWLELK
FT                   GEVRLHDYAAFQVDAFVRGLNASMHDNGDIDTHHVTVSGHAFVAGLMGRVQQHLFAALG
FT                   VTRYPRTTH"
FT   gene            complement(323823..324302)
FT                   /locus_tag="BURPS1710b_0311"
FT   CDS_pept        complement(323823..324302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH6"
FT                   /protein_id="ABA47650.1"
FT                   /translation="MTVNLTQARECMSTQPSVNARRAWLDACAAFEDARVTCGNPDLLR
FT                   MAAFLERVATALWASDSRACHLAAIHATQIARLLVAPGTLSPASRIVLASELEGASLDL
FT                   GEALDDASRPLADPTVQQIDAITGVLWSSGNDECARAAVRLQRIAVMLVESGLSA"
FT   gene            complement(327895..328728)
FT                   /locus_tag="BURPS1710b_0312"
FT   CDS_pept        complement(327895..328728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0312"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49467"
FT                   /db_xref="GOA:Q3JW57"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JW57"
FT                   /protein_id="ABA49467.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(328752..329015)
FT                   /locus_tag="BURPS1710b_0313"
FT   CDS_pept        complement(328752..329015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0313"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50209"
FT                   /db_xref="GOA:Q3JXJ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ0"
FT                   /protein_id="ABA50209.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(329314..330201)
FT                   /locus_tag="BURPS1710b_0314"
FT   CDS_pept        complement(329314..330201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0314"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH3"
FT                   /protein_id="ABA51025.1"
FT                   /translation="MRIFVLPCLSAAMLVSACNHSSKPETSAVATSAPQHASTSAAGSA
FT                   NTPAALPVPAAMPAPPPHQYAMEQDGTYGYEPTLSEDDVRSGKATKPLVMMRYVGRRDG
FT                   TYVLLLIDPDNENYATRVTCQAPCNFAKLQTMSGTMVLKTETIRVAPNSLIGAMLDDAL
FT                   SGQLRPYGQTVTMPRPTAVPSTAQPADQSAPQDSSPQSDLQRTSFDCSKVGSIPEYLIC
FT                   HDPELAASDRELANIYQQAKDAVPDKAAFAARTRRQWNFRQRNCRDKPCLVSWYAYQKE
FT                   TLTKIAQTGDVNAQ"
FT   gene            330569..331726
FT                   /locus_tag="BURPS1710b_0315"
FT   CDS_pept        330569..331726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0315"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48055"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH2"
FT                   /protein_id="ABA48055.1"
FT                   /translation="MKTIWKFFGLAAAVSVLLAGCGGGGDNSGQTGTLHVAMTDAPSCG
FT                   FDHIYVTVAKVRVNMSAQAGDNDSGWTDVALAAPQKVDLLSLTNGVLADLGRNALPAGQ
FT                   YQQVRLVLAQNQGNTLANSIVPTGGTEQPLATPSATQSGYKIITPFTVQPNTLVDLVLD
FT                   FNACKSIVQRGNGTYALKPVVTATPTVVSGAIDGYVSPTEAGATVYAEQNGHVIKGTLA
FT                   DSTGHFVLTPLVQSSTNGNYDIVITQNNVSTGIVRSVPVVVNTTTSVSTSSAPITLPAS
FT                   TMNMVSGTATASADAILRALQMVNSLPYEIASTNANLDTGAYALTLPTAAPIVGTYSGS
FT                   LPVAMSAAPSAAGQYTIEADAANGATQQQPANITAGSVSNVNFGF"
FT   gene            complement(332289..332471)
FT                   /locus_tag="BURPS1710b_0316"
FT   CDS_pept        complement(332289..332471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49976"
FT                   /db_xref="GOA:Q3JXH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH1"
FT                   /protein_id="ABA49976.1"
FT                   /translation="MEAIVIEQVILGVFLVLPLLIVAVLYSDELWQEHRLQHPRDEHTP
FT                   HIDWRHPWRILRRGH"
FT   gene            332462..333181
FT                   /gene="speG"
FT                   /locus_tag="BURPS1710b_0317"
FT   CDS_pept        332462..333181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="BURPS1710b_0317"
FT                   /product="spermidine n(1)-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50195"
FT                   /db_xref="GOA:Q3JXH0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH0"
FT                   /protein_id="ABA50195.1"
FT                   /translation="MPPSRGGEPSVHFRLCIKARSHFPPTHPSMHSALARVSILPACRP
FT                   RMTQGQLTMQIQNEQHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFTELSQLY
FT                   DQHVHDQRERRFVAFDSDGELVGLVELIELDYIHRRGEFQIIIAPNRQGRGFATRATRL
FT                   AVEYAFKVLNLRKLYLIVDKSNVAAIRVYEKCGFKHEAELIEEFFGNGQYHNALRMCIF
FT                   QRDYFAAQPGAELHARE"
FT   gene            333668..334015
FT                   /locus_tag="BURPS1710b_0318"
FT   CDS_pept        333668..334015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0318"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG9"
FT                   /protein_id="ABA51000.1"
FT                   /translation="MLKRTGLFLALTGGIVAFSVAQANGDASLKPQQEIQLTKNAWGCL
FT                   SKDNLDSVLNHERDGKAQAKQQYFDDYRCLSVPEGQRFRVVSVDKGDVQFVSAENSDQQ
FT                   GLWTDARFIKQ"
FT   gene            complement(333973..335478)
FT                   /locus_tag="BURPS1710b_0320"
FT   CDS_pept        complement(333973..335478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG8"
FT                   /protein_id="ABA50179.1"
FT                   /translation="MHRPAARRTDRLHSVGLPLEGDVPDEIPHPRDRSRGAARRRSGGD
FT                   DPFLLRRAGLPRRKRAAGTGARSIARRTLADRSARGWRADRSGRQRSAGKGTEHGSSVP
FT                   ARRAVRCGRAAHAPRRTWRAARRRGAALRRGRLWAVALPVRSGRQHGRTEGAAGSRRAL
FT                   KAHAGEPATGLTAANVGSRESGVGSRESGVGSRKSEVGSRGAGSRADEKARRAGRHPAA
FT                   ERRPAARAPSGVFARLQRRPLDRDRIMRRARQPGGAILDRALQTHRALGEAAERRRDAV
FT                   GERRHLHVAQPLDLAARALPPDVGRASAVRDHVHAAGSAACLRDTALVGLPDVDPYLDR
FT                   PRQVFLPKIGLVGIRQPLAELEPLVREQRERGDTHHHPLVRFGRVTGDGERVIGIVVPI
FT                   HVGDLQLRLVDRRFERHSASQPARAVDSVRGVMIPNARCARDVARNCRRRRQRAAAVNA
FT                   RRPDARRAVRFRRGPAFRGPGRDSAGERPRYCLMKRASVQRPC"
FT   gene            334231..334785
FT                   /locus_tag="BURPS1710b_0319"
FT   CDS_pept        334231..334785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0319"
FT                   /product="YaeQ protein"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF07152"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47521"
FT                   /db_xref="GOA:Q3JXG7"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG7"
FT                   /protein_id="ABA47521.1"
FT                   /translation="MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIA
FT                   AFALFAHERLEFCKGLSDTDEPDLWQKDLTGAIEVWIDVGQPDERRIAKASGRAGRVNV
FT                   IAYGGRTSDIWWQGARGKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWL
FT                   SSATHDPVAIEWTTLKAREDA"
FT   gene            complement(334989..335405)
FT                   /locus_tag="BURPS1710b_0321"
FT   CDS_pept        complement(334989..335405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0321"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48832"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG6"
FT                   /protein_id="ABA48832.1"
FT                   /translation="MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQL
FT                   RAGRSLIDLLAVGAPIDRAGSGAPGKGRNMDHLCLRVEPFDAAALRTHLAAHGARPGDE
FT                   ARRYGADGYGPSLYLFDPEGNMVELKGPPEAVAP"
FT   gene            335807..336901
FT                   /locus_tag="BURPS1710b_0322"
FT   CDS_pept        335807..336901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0322"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01035; match to protein
FT                   family HMM PF02805; match to protein family HMM PF02870;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50624"
FT                   /db_xref="GOA:Q3JXG5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG5"
FT                   /protein_id="ABA50624.1"
FT                   /translation="MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASR
FT                   LPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQL
FT                   SDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSR
FT                   LYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLV
FT                   DELRTGFANAQIAESPERIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRI
FT                   PYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRK
FT                   AALLDAEARRAAGESVESAVDHAA"
FT   gene            336808..337839
FT                   /gene="alkA"
FT                   /locus_tag="BURPS1710b_0323"
FT   CDS_pept        336808..337839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BURPS1710b_0323"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="identified by match to protein family HMM PF00730;
FT                   match to protein family HMM PF06029"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49044"
FT                   /db_xref="GOA:Q3JXG4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG4"
FT                   /protein_id="ABA49044.1"
FT                   /translation="MGLAAQGGAPRCRGAPRGGRIRRIRRGPRSLSAAVEPAAVRPDSV
FT                   VLELPFKSPYDWPRVLRFFAGRAIPGVEAVGDGAYRRTVDHHGAIGTLTVRKHPRKRCL
FT                   VALVEGDAARHADAAFAARLSTMFDLQADPAAIGAHLARDAWFAPLVGAAPGLRVPGAW
FT                   SGFELIVRAIVGQQVSVKAATTIVGRLVERAGERLAPHAPGAIGWRFPEPAALAACDVS
FT                   RIGMPGKRAAALQGVARAVASGDVPLEAYASDPAGVRAALLALPGIGPWTVEYVAMRAW
FT                   RDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSA
FT                   RGG"
FT   gene            337965..339611
FT                   /gene="gshA"
FT                   /locus_tag="BURPS1710b_0324"
FT   CDS_pept        337965..339611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="BURPS1710b_0324"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50159"
FT                   /db_xref="GOA:Q3JXG3"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG3"
FT                   /protein_id="ABA50159.1"
FT                   /translation="MPRIAEPALASMPNNMTSRQTDLLQQRLAVLSTSPTREQLPDGLR
FT                   GIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLKRL
FT                   DELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRT
FT                   MQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGA
FT                   SPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYL
FT                   DALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHAL
FT                   ASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFG
FT                   RVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDTHARAIAAQRAK
FT                   LDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSL
FT                   AEQAELEGKNAGSFDAFVAAYRAYTLNRFSV"
FT   gene            complement(339625..341073)
FT                   /gene="rpoD"
FT                   /locus_tag="BURPS1710b_0325"
FT   CDS_pept        complement(339625..341073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="BURPS1710b_0325"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF04539; match to protein
FT                   family HMM PF04542; match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51026"
FT                   /db_xref="GOA:Q3JXG2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG2"
FT                   /protein_id="ABA51026.1"
FT                   /translation="MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFA
FT                   HDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDT
FT                   TASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADP
FT                   ALGRARAALQRARARGDEGARACARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPE
FT                   KSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLR
FT                   AIEKFEHRRGFKFSTYATWWIRQAISRAVADRARTIRVPVHVGDEARRVRKAADRIERR
FT                   SGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLF
FT                   DALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIE
FT                   KRALQTLRVTAEACNAHDFLDVQP"
FT   gene            complement(341336..342067)
FT                   /locus_tag="BURPS1710b_0326"
FT   CDS_pept        complement(341336..342067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51012"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG1"
FT                   /protein_id="ABA51012.1"
FT                   /translation="MRADWLRLYASHAASDAARHVASRGRRFSPRKARRRTPARRPGAR
FT                   AAVAAHAAGHSTGDIAMEEAYARRALLLHLGSVLQILSRLEGAPDNQSIEALLAANGML
FT                   ADVPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGW
FT                   KAYAATLREVSPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRER
FT                   AAASVESATPAGAPVRRESYE"
FT   gene            341504..342052
FT                   /locus_tag="BURPS1710b_0327"
FT   CDS_pept        341504..342052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG0"
FT                   /protein_id="ABA50765.1"
FT                   /translation="MRLGSIRACGVEAGRDLAQRRRVRFPSGIVAREQMLANGQRERGA
FT                   VEWVLEQQLRPQAKRAQRAGREFAHGHVLHDVLDERHVGEHAVGREQRLDRLVVGRSFE
FT                   AAQDLQHAAEVQQQRAPCVSFFHGDVSGRVAGRMRGNGRPRPGAAGGCPAAGLTGAETP
FT                   PARCDMSCRVARGVRCIQA"
FT   gene            complement(342458..343027)
FT                   /locus_tag="BURPS1710b_0328"
FT   CDS_pept        complement(342458..343027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0328"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50441"
FT                   /db_xref="GOA:Q3JXF9"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF9"
FT                   /protein_id="ABA50441.1"
FT                   /translation="MKIERYSKGLTVISLTTALWSLGLPVAPAAPASDARAQTPCGRGD
FT                   GMGPGMMGGGYGRGMMGGYGMGPGMMRGDGMGPGMMMGFGGWPSGLDLTSEQRAKINRI
FT                   QDDTRKAHWALMGDMMDQQAKLRDLYDAPKRDGAAIDETSRAIGSLRQKMIDASVDARK
FT                   KMEAVLTSKQLDKLRAYEKQADDMSW"
FT   gene            complement(343130..344098)
FT                   /locus_tag="BURPS1710b_0329"
FT   CDS_pept        complement(343130..344098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0329"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48343"
FT                   /db_xref="GOA:Q3JXF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF8"
FT                   /protein_id="ABA48343.1"
FT                   /translation="MRRIDLLSALETFVCAVEEGSLSQAARRLAKTPSAVTKAIAGLEA
FT                   TLGVQLLERTTRRLALTESGRLYLATATDVLRRLADGARQLSERDDEPRGLLRVTAAHS
FT                   FGHAILAPLCAPFAQAFPRVRIELSLSDHYVDIVGEGFDLALRMGNYDLPSQIVKPIGS
FT                   NRGLLCASPGYLARRGRPTAPADLAQHDCVIYRHPTLANTWTFERGGVRARLEPKGPLV
FT                   TDDYGLALAAALYGAGVLPCPQWSVVDALEAGRLVPLLVDWRFESASFGEDRICAAYPS
FT                   SRRGSTKIRRLVERVQARLADSEARVAHVLGDALCADLARR"
FT   gene            343172..344845
FT                   /locus_tag="BURPS1710b_0330"
FT   CDS_pept        343172..344845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF7"
FT                   /protein_id="ABA48797.1"
FT                   /translation="MRDARFAIGEPRLDALDEAADFRRAAPARRIGGANPVLAERCALE
FT                   APVDEQRHEPARLERIDDAPLRARQHARAVERGGKREAVVVGDERAFRLEARAHAAALE
FT                   RPGVRERRVAVDHAVMLREIGRRGGPAAAREIAGARAQQAAVRADRLDDLARQIVVAHP
FT                   QREIEAFADDVDVMIGQRQFDPHTRKGLRERRAERREDRVAERMRGRDAQQAARLVVAL
FT                   GQLPRAVREPAQHVGRGREIEPSAFRQREPARRALEQLHAERRLEAGDRFRHRRRRFRE
FT                   PARRLAEAAFLDRADEGFERGQQIDSPHSFLKGTGDVRNKITNRFFSLLTIIGGTFADA
FT                   ARERPPFFFGIVKGEIDEAHRVARRRARIARVRRGARGRRQRAQHLQLGRVFRARHDRR
FT                   LREGNRHQGAARRVRQQRSAANEADDGQQRLRSRVSVKRFSRTADSGGPLPEARQIEAA
FT                   EPHEPRSGDRRARRRSRSRQPVQRAVHARHVRARAECREGEAGARRPAAREHARADLQS
FT                   CVCGEARALRHRVQRCGQRSVSARAALHRPRSEHDRSARL"
FT   gene            344241..345335
FT                   /locus_tag="BURPS1710b_0331"
FT   CDS_pept        344241..345335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0331"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49661"
FT                   /db_xref="GOA:Q3JXF6"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF6"
FT                   /protein_id="ABA49661.1"
FT                   /translation="MKRIAWLAAVLASLACAAARAADGNVLNIYNWAEYFAPDTIADFE
FT                   KETGIKVRLDVYDSNEALQTKLTTGNSGYDLVFPSNDFLARQIQAGLYRKLDKSRLPNL
FT                   TNLDPAIVARAAEVDPGNQYSVPYMQGTFGLGLNVAKVKQALGGPLPANTLELIFNPAY
FT                   AAKLERCGIAFNDAGSEVFPLALRYIGRDPNTTDPRDYEAALDMMKTIRPTIRQFIATP
FT                   VMNDLATGDVCVVTGYSGAVLVAARRAAEAKNGQQIVYSLPSAGAPFWFDSMAIPKGAA
FT                   HADHALRFIDYILRPDVVAKISNKVMYPNPNRVATPLVDRRLTANPAIYPDAATMRTLW
FT                   VKRPMPPQAMRMQTRYWTRFKTGY"
FT   gene            345424..346476
FT                   /gene="hdah1"
FT                   /locus_tag="BURPS1710b_0332"
FT   CDS_pept        345424..346476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdah1"
FT                   /locus_tag="BURPS1710b_0332"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48929"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF5"
FT                   /protein_id="ABA48929.1"
FT                   /translation="MYVVPHGTLNLGEHFDSPLRLAYTKQLLDAVGMTERLTRVAFARA
FT                   TDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSASTEDVARLAAGAACAAVDAV
FT                   MTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARHAQAAHGVERVAIVDWDVHHG
FT                   NGTQQAFYDDPSVLFVSLHEAANFPVDGGEARETGGGAGAGYNANVPLPSGTGDAGYRH
FT                   AFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQRDGFRHMARALRQAAGGACGG
FT                   RIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQFVQYPLGEGERAAVKAARAAL
FT                   APYWPTLHRS"
FT   gene            complement(346139..347962)
FT                   /locus_tag="BURPS1710b_0334"
FT   CDS_pept        complement(346139..347962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF4"
FT                   /protein_id="ABA50731.1"
FT                   /translation="MEFRPIKESDLGSTYDIRFPVTENRILPHQIHLLERDRVLEQLRS
FT                   GFGVLAIEGDAAVGYCTATGSGGPGKRSWRTAPKHCHAGPRRLRERAALAVAAPMAARS
FT                   RPRGCVTCKAPSAERRSSSETSCASARTGRRALRPILGFRRASASRPSSLAPRAAEPSA
FT                   DNDGPRAQTDSPRGHARLFFADAIGNARARSRRPLTASSHAIRRALAQRPITLRPPIPE
FT                   HAPAAPPIRERIEIEFGRRDRLAVPIAFDDHLAVRARDERAAVKHDLARCAALDADPIA
FT                   RGNRHQVRGRMPALRVVPMRARIDRRIVRLAADRARVQQQLRARERHCPRALRKPLIPA
FT                   DPDADPPVCGIPYAKARVARREIVFLRVARAVRNVRLSIDAERAAVRVEDRDRVELRLA
FT                   GALEEAHRQHDAELARERREAHKPRMAFIRLREREMRGVLVDAEIRRLEQFLQQHDLRA
FT                   ARGRVAHESLGARQVCVDVPVASHLRDGNGRLSHCARLRIDAAWANTAPARRGRPSPRR
FT                   ARLRRADTGRTGADRRTARSSRRAPRARRASRSADTAGCSRPPAASRCAPRMRRPPLAA
FT                   MRAPCAGTRRAARACGRADRTRSHPAPPTRE"
FT   gene            346487..347362
FT                   /locus_tag="BURPS1710b_0333"
FT   CDS_pept        346487..347362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0333"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50045"
FT                   /db_xref="GOA:Q3JXF3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF3"
FT                   /protein_id="ABA50045.1"
FT                   /translation="MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELF
FT                   ETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIF
FT                   DADGRALGIYRKTHIPDGPGYTEKYYFTPGDTGFRVWDTAYGRIGVGICWDQWFPECAR
FT                   AMALAGAELLLYPSAIGSEPHDASIDSRAHWHNAQRGHAAANLMPVAASNRVGVERGAS
FT                   GEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRA
FT                   LSEGAADRVR"
FT   gene            348361..349452
FT                   /locus_tag="BURPS1710b_0335"
FT   CDS_pept        348361..349452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0335"
FT                   /product="Phage portal protein"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01540"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51116"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF2"
FT                   /protein_id="ABA51116.1"
FT                   /translation="MSSWRRRASTTASSACSNVTSSAATTLRNRPRQIRAPARAEVFTF
FT                   DDPTPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTF
FT                   RPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVRRKADFSGFVYV
FT                   NGWQERHEFAPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHA
FT                   GFILYMTDAAQKQDDVDNMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKD
FT                   EFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAEL
FT                   NDWLGDEVVRFDDYEIPPAPVAA"
FT   gene            complement(349526..349810)
FT                   /locus_tag="BURPS1710b_0336"
FT   CDS_pept        complement(349526..349810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0336"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50060"
FT                   /db_xref="GOA:Q3JXF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF1"
FT                   /protein_id="ABA50060.1"
FT                   /translation="MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVF
FT                   RALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA"
FT   gene            complement(349807..350289)
FT                   /locus_tag="BURPS1710b_0337"
FT   CDS_pept        complement(349807..350289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0337"
FT                   /product="unnamed protein product"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49280"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF0"
FT                   /protein_id="ABA49280.1"
FT                   /translation="MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVAD
FT                   KGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWLALYRIDGQIDDWTIVNGIR
FT                   RGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK"
FT   gene            complement(354044..354119)
FT                   /locus_tag="BURPS1710b_0338"
FT   tRNA            complement(354044..354119)
FT                   /locus_tag="BURPS1710b_0338"
FT                   /product="tRNA-Lys"
FT   gene            354311..354715
FT                   /locus_tag="BURPS1710b_0339"
FT   CDS_pept        354311..354715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0339"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48902"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE9"
FT                   /protein_id="ABA48902.1"
FT                   /translation="MDENTVRDLLDRLLAPWVRSLSLTPVSISEESVTLRLPFSGEFRH
FT                   SGGVICGQVFMAAADTAMVVAISAALGEFRPMTTVALNTHFMRPVRKGDVLVTARVLRM
FT                   GRNLVFGEIELFDEDGKMAVHATSTYALVS"
FT   gene            354753..355622
FT                   /locus_tag="BURPS1710b_0340"
FT   CDS_pept        354753..355622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0340"
FT                   /product="Patatin-like phospholipase family protein"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49922"
FT                   /db_xref="GOA:Q3JXE8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE8"
FT                   /protein_id="ABA49922.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVRPALDLRPRVIAGISAGAATA
FT                   CMLYTRDSRWVMRYYEEALRHNRRNVHWGNLLRAEPVFPHYRIYRQALLDIYGEPFAKL
FT                   AGAPDIRIGVSHVPRWLGARSAVAAGLIAYNIEKYVRKTLHPTLGRSLGFRPEFVRAQD
FT                   CARVDELADLVLQSSCTPPFTPVLRRDGRPVLDGGMVDNVPVGALDASPGAVLVMVTRR
FT                   YPRPQTFVVDGGGQRRLYVQPSSKVPISSWDYTSPHQMQHAYDLGRRDGERFVGAMPQC
FT                   LDEDGAVR"
FT   gene            complement(355743..356759)
FT                   /gene="serA1"
FT                   /locus_tag="BURPS1710b_0341"
FT   CDS_pept        complement(355743..356759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="BURPS1710b_0341"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50822"
FT                   /db_xref="GOA:Q3JXE7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE7"
FT                   /protein_id="ABA50822.1"
FT                   /translation="MKIAILDDYQDAVRKLNCFEMLADHEVKIFNNTVRGLGQLASRLA
FT                   EVEALVLIRERTHITSQLLGKLPHLRMISQTGRVSTHIDLEACTERGIAVLEGTGSPTA
FT                   PAELTWALIMAAQRRIPQYVANLKQGAWQQSGLKTSAMPPNFGLGQVLRGQTLGIWGYG
FT                   KVGRLVAGYGKAFGMNVLIWGREHSLEAARADGFEAAESREAFFEQADVLSLHLRLHDD
FT                   TRGVVKLDDLLRMKPTSLLVNTSRAELLEENALVSALARNRPGMVAIDVYESEPILQGY
FT                   SLLRMENVICTPHIGYVERESYELYFSAAFRNILAFDAGDLSSVANPDALTQGRVRR"
FT   gene            357198..358253
FT                   /locus_tag="BURPS1710b_0342"
FT   CDS_pept        357198..358253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0342"
FT                   /product="LysR family transcription regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47883"
FT                   /db_xref="GOA:Q3JXE6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE6"
FT                   /protein_id="ABA47883.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRVVAPVVFGL
FT                   HNLAPVLQTYTQRFPKVIPDLTLVDRQVDLVEEGFDVGIVITRQMRSASIVTRRLTTGC
FT                   MVVCATPSYLEKHGMPTHPEQLVEHPCLSLPSEYWGDERVFTGPDGEVRVRPSNVVVAN
FT                   NTEMLRQFAMLGMGVAILPSYLIGSDIARGKLVRLLSDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQSPDTMLGEQWATQGVAGQHVDALPADALAERSSADPALSPRLPRA
FT                   PRARTVVPSPL"
FT   gene            complement(358475..361192)
FT                   /gene="topB"
FT                   /locus_tag="BURPS1710b_0343"
FT   CDS_pept        complement(358475..361192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BURPS1710b_0343"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49147"
FT                   /db_xref="GOA:Q3JXE5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE5"
FT                   /protein_id="ABA49147.1"
FT                   /translation="MTRFFAHAGRHLGVVCYKAVVKGPASGSPGLSIHTVMSKALIIAE
FT                   KPSVANDIARALGGFTKHDEYYESDEYVLSSAVGHLLEIAAPEEYEVKRGKWSFAHLPV
FT                   IPPHFDLNPIAKSESRLKVLTKLIKRKDVDRLINACDAGREGELIFRLIAQHAKAKQPV
FT                   QRLWLQSMTPAAIRDGFAHLRTDMDMQPLADAARCRSEADWLVGINGTRAMTAFNSKGG
FT                   GFFLTTVGRVQTPTLSIVVEREEKIRRFVPRDYWEVRAEFVCAGGFYEGRWFDPKFKKD
FT                   EFDPEKRDSRLWSLPAAETIVAACRDHLGTVTEESKPSTQLSPLLYDLTSLQREANSRF
FT                   GFSAKNTLGLAQALYEKHKVLTYPRTDARALPEDYLGTVKSTLEMLKESNNYLPHAKQV
FT                   LDKNWVKPNKRIFDNSKISDHFAIIPTLQAPKSLSEPEQKLYDLVVKRFLAVFFPAAEF
FT                   KVTTRITEVAGHHFKTEGKVLVEPGWLQVYGRDAEGADANLVPVQKGEKVKTDKIAAHG
FT                   LTTKPPARYSEATLLSAMEGAGKLVEDDELREAMAAKGLGTPATRAAIIEGLLGEKYLV
FT                   REGRELIPTAKAFQLMTLLRGLGVKELTAPELTGEWEYKLSQMERGNLQRDAFMQEIAR
FT                   MTQTIVKRAKEYDSDTIPGDYATLETPCPNCGGQVKENYRRFACTKCEFSISKIPGSRQ
FT                   FEIAEVEELLRKKEIGPLSGFRSKMGRPFSAILKLTFDDETKNYKLEFDFGQEQGGEEG
FT                   EAPDFSAQEPVGACPKCKGRVFEHGMSYVCEHAVANPKTCDFRSGKVILQQEITREQMA
FT                   KLLENGRTDLLPNFKSSRTGRNFKAYLVKQPDGKIGFEFEKKEPKPAAAKKTAARSSAA
FT                   ADDAAADSGEKAEKKAAPARKTAARKTPARKTGS"
FT   gene            complement(361295..361666)
FT                   /locus_tag="BURPS1710b_0344"
FT   CDS_pept        complement(361295..361666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0344"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49991"
FT                   /db_xref="GOA:Q3JXE4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE4"
FT                   /protein_id="ABA49991.1"
FT                   /translation="MPALNLDTDEGRIAERLRNPDTLLVACLCAEWCGTCREYRATFDR
FT                   LADTHPGACFAWIDVETHADRLDELDVENFPTLLIEDANAVRFFGTVLPHAAIVERMLA
FT                   DLTALPGAPHAPKLRNLFD"
FT   gene            complement(361726..363030)
FT                   /gene="smf"
FT                   /locus_tag="BURPS1710b_0345"
FT   CDS_pept        complement(361726..363030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="BURPS1710b_0345"
FT                   /product="SMF family protein"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47594"
FT                   /db_xref="GOA:Q3JXE3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE3"
FT                   /protein_id="ABA47594.1"
FT                   /translation="MIGQSPWARARGIRSISDDENFITALRSPQAALFEEFIMSPRALT
FT                   RAELSGWLRLAGASGVPAAACAALLGAFASLEALFAASHAELAALVGDAAAQSVLAPPA
FT                   ADFEQRVDAALAWLDEPGNALVTRHDPAYPGPLAELYDPPPLLYIKGRVALLHARAVAI
FT                   VGSRGATPQGLADATRFARELSDAGLAIVSGLARGIDGAAHRGGLDGASGTVAVIGTGA
FT                   DLVYPACHHALAHEIAERGALVSEWPLGTPARSAHFPQRNRLIAALSGGVLIVEAALRS
FT                   GSLITARLANEMGRDVFAIPGSIHAPLSQGCHALIRDGAKLVETAADVLDEFGLDPARP
FT                   VNSKRGAPAAASADADLDDDTRRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELA
FT                   GRVAALPGGRYTRIDGAQAEPAQARGTSAVLHSGA"
FT   gene            363043..363648
FT                   /locus_tag="BURPS1710b_0346"
FT   CDS_pept        363043..363648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0346"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48414"
FT                   /db_xref="GOA:Q3JXE2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE2"
FT                   /protein_id="ABA48414.1"
FT                   /translation="MARVVESILRPARASRQSAERPMRAGRSSPDTEIMALLNILHYPD
FT                   KRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEDKNEL
FT                   RVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGEPFELDCEGLLA
FT                   VCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKLERAM"
FT   gene            363680..364663
FT                   /gene="fmt"
FT                   /locus_tag="BURPS1710b_0347"
FT   CDS_pept        363680..364663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BURPS1710b_0347"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47683"
FT                   /db_xref="GOA:Q3JXE1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXE1"
FT                   /protein_id="ABA47683.1"
FT                   /translation="MTHSLRVIFAGTPEFAAAALAAIHEAGFPVPLVLTQPDRPAGRGM
FT                   KLQASAVKRYAFERGMAVAQPPSLRRAGKYPAEAVAALDLLHATPHDVMVVAAYGLLLP
FT                   QEVLELPRHGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLMQMDAGLDTGAMLHEA
FT                   RVAIAPDDTTATLHDKLAAAGARLVVDALVELERTGALAATPQPADGVTYAEKIGKHEA
FT                   ALDWRKPAAALARQVRAFDPFPGGAGTLDGATLKLWAADAVPGRDDAAPGTIVDIGPDG
FT                   VVIACGEGALRVTQLQKPGGKRLPAREFLAGAPLAVGQRFAPADAA"
FT   gene            364784..365419
FT                   /locus_tag="BURPS1710b_0348"
FT   CDS_pept        364784..365419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0348"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48968"
FT                   /db_xref="GOA:Q3JXE0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE0"
FT                   /protein_id="ABA48968.1"
FT                   /translation="MFGITHLGLFMAAVFLLNITPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHVLACAFGLTAVLAASATAFTVIKVVGAAYLVYLGVRLIFAKQEPAAERPA
FT                   RRGADKSLRQLFMQGFLTNVLNPKVVLFFVSFFPQFVSVDSNHKVLAFLTLGAVFLAMS
FT                   TVWSCTVAWVAGTVTRRFAGKPGVKKWLDRGVGSAFVGLGVKLATSTR"
FT   gene            365529..366386
FT                   /gene="htpX"
FT                   /locus_tag="BURPS1710b_0349"
FT   CDS_pept        365529..366386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BURPS1710b_0349"
FT                   /product="HtpX-2 endopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47921"
FT                   /db_xref="GOA:Q3JXD9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXD9"
FT                   /protein_id="ABA47921.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDEATAPQFYRMVRELATRANLPMPRVYLIDENQPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFQTAEEHPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMDMART
FT                   GRFD"
FT   gene            366724..368283
FT                   /gene="sun"
FT                   /locus_tag="BURPS1710b_0350"
FT   CDS_pept        366724..368283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="BURPS1710b_0350"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01189;
FT                   match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51179"
FT                   /db_xref="GOA:Q3JXD8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD8"
FT                   /protein_id="ABA51179.1"
FT                   /translation="MLRTPPLRAPARVSPIPGALQYRADRPRAGPRRLPTTRPARPCAA
FT                   GTADPMTQTRPSRSRASGAPSRAPRLSALHLVPDSLGFALDGAAQAVDAVDRGAALPAA
FT                   LAAVHAALPSNAQAASRGAIQDIGYRAMRRRGTADWLIAQLVAKAPPAHVHALLVCAFA
FT                   LLVDDEHAAYAPFTVVDQAVTAIGARRECSFAKGLVNAVLRRFLRERAAWLERLQADRR
FT                   ALWNYEPWWIDAVERAWPDAWQRILAAGDAPGPLTLRVNARRMTADAYLDTLRAERIDA
FT                   EKIGLHAIRLASARPVERIPGFADGIVSVQDAGAQLSAEWLGARDGMRVLDACAAPGGK
FT                   TGHILELAHAEVVALESDPARAPRIGENLARLSLTADVRVGDAADPAQWHDGRPFDRVL
FT                   ADVPCSASGIVRRHPDIRWLRRAADIPALVAEQRRILSALWPLVKPGGELLYVTCSIFP
FT                   EEGELQARWFGDACQDAVRLDAPGQLLPQGATGGAPAVGGSGESGRHVDHDGFFYARFQ
FT                   KR"
FT   gene            368280..368870
FT                   /locus_tag="BURPS1710b_0351"
FT   CDS_pept        368280..368870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0351"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50310"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD7"
FT                   /protein_id="ABA50310.1"
FT                   /translation="MTIKRFFPLRLAAVLWVALTLCLAAVPAARADTIAVQRASLQSDG
FT                   SGWSLDARFDFELNSSLEDAVNKGVPLYFTTDFELSRARWYWFDEQPVSVSQTIRLSFQ
FT                   PLTREYRVSTGGLQLGFPSLKEALAVVKHVTSWHVIDKGQVRPGETYTASVRMQLDTAL
FT                   MPKPFQVDAVNNRDWNLVSDWKRFIFTVAERAK"
FT   gene            368917..371280
FT                   /gene="atoS"
FT                   /locus_tag="BURPS1710b_0352"
FT   CDS_pept        368917..371280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoS"
FT                   /locus_tag="BURPS1710b_0352"
FT                   /product="sensor kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49475"
FT                   /db_xref="GOA:Q3JXD6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD6"
FT                   /protein_id="ABA49475.1"
FT                   /translation="MIVSTVAITALLLLVLLAAASANTEFFDRYYSWLYSANIIVALVF
FT                   MLVVLGLVGMIVARLRKGKFGTRLLAKLAVFFTLVGVVPGGIIYIVSYQFVSRSIESWF
FT                   DVNVETALTAGLNLGRGMLDTSLADLQTKARLMSEQLSSADANTNGTTLTLLRLRDQFG
FT                   VQDATIVEPGRGTGASPDVHIIAQASGNFAALIPDDMPTPLMLSQAREHGVFAAIEGEV
FT                   DGDPRARGSKGALRLRVVQRIPDSSTSLLQPAERFLQLTQPVSPTLARNADAVQRAYRE
FT                   YQEKSLGRSGLRKMYIGTLTLALFLATFIAMMIALALGNQLARPLFLLAQGTKEVAEGD
FT                   YTPKREIKTRDELGFLTQSFNAMTRQLSEARLAVEKNRVALEHSKTYLESILANLTAGV
FT                   FVLDRQFRLTTANRGAERIFRQPFNSLIGTTLDQIGVVAEFGAMVRKAFADREAAGRGG
FT                   GEDRGHWQQQFAVEVPGETEPLTLLVRGTRLVSTAAAPGQPDDPQTSGYVVVFDDISDV
FT                   ISAQRSVAWGEVARRLAHEIKNPLTPIQLSAERLQMKLSDKLSQPDADVLKRGATTIVN
FT                   QVAAMKRMVDDFRDYARTPPAVLVNLQLNDLVSEVLTLYGVGEGKSTIVVEQTPLPVIR
FT                   GDATQLRQVIHNLLQNAQDSVADVEHPRVLLETKTVEYGDPDANGKTRVAVRLTVSDNG
FT                   PGFPARILTRAFEPYVTTKAKGTGLGLATVKKIVDEHGARIDLRNRMHGDVVEGAQVSI
FT                   LFLQLADDTAGAGGGTNGGTAPAKTRATVQTKAA"
FT   gene            371281..371964
FT                   /locus_tag="BURPS1710b_0353"
FT   CDS_pept        371281..371964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0353"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50651"
FT                   /db_xref="GOA:Q3JXD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD5"
FT                   /protein_id="ABA50651.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVDVAENAQAARDYRLRQA
FT                   PDLVLLDIWMPDTDGVTLLKEWASQGQLTMPVIMMSGHATIDTAVEATKIGALDFLEKP
FT                   ITLQKLLKSVEHGLARGAAPLPASAAAKPAAGAAVASAAALPTLGDDPAVALAGQTTAA
FT                   IPFDIPLREARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVELGKKP
FT                   AEGAA"
FT   gene            372025..372100
FT                   /locus_tag="BURPS1710b_0354"
FT   tRNA            372025..372100
FT                   /locus_tag="BURPS1710b_0354"
FT                   /product="tRNA-Phe"
FT   gene            complement(372418..373911)
FT                   /locus_tag="BURPS1710b_0356"
FT   CDS_pept        complement(372418..373911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD4"
FT                   /protein_id="ABA49515.1"
FT                   /translation="MNEASGSGNVQVLVRLHRQPPPRMTLAPIDREPGVELARRAVHRL
FT                   HEEMLEVELRVIGKALVVLRHHHLQFVALRDDERRIRLRAHADPVDRFEHGQRAVRLDR
FT                   DREARRVQRVDERLIELQHRLAARADDEAIRLARRPERRDPRRERSGILELAAVLAVGA
FT                   DEVGIAEAAHRAVAVRFAPRPEVAAGEPAEHGRTAGVRALALQRIENFLDRVRHAASFR
FT                   LAPLAFRCSMNLVAARATRVRRASRASGGRLRHAFAAQIGVIAALAQLACRAFATAEAP
FT                   VMQLRALADIARVRLDADQLDERRAAQLLGEPPRIGLVEPHQRRFQHEARVHAEIERDL
FT                   QRLHRVVAAVRIAGEIGLAHAADERAQPAPISDRRGDRHEQQVAARHERVRQAVRRRLD
FT                   LDRARHRGIADRAEHRQIDQVIVAQLVRPLRKTPLQRIAHALATFELDAVALAVIEAER
FT                   LDGLIALERPGHTCGRILAAGKQYERAVLSVCPNHRDTP"
FT   gene            372433..373167
FT                   /locus_tag="BURPS1710b_0355"
FT   CDS_pept        372433..373167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0355"
FT                   /product="exsB protein"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48970"
FT                   /db_xref="GOA:Q3JXD3"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXD3"
FT                   /protein_id="ABA48970.1"
FT                   /translation="MIRTDAKDGALVLFSGGQDSATCVAWALERYQTVETLGFDYGQRH
FT                   RVELECREGVRDALKRRFPQWSHKLGDDHLIDLSVLGSISDTAMTRAIEIETASNGLPN
FT                   TFVPGRNLLFMTIAAAIAYRRGLRALVGGMCETDFSGYPDCRDDTMKALQVALNLGMDT
FT                   RFVLETPLMWLDKADTWRLAEQLGGAPLVELIRVETHTCYVGERSELHDWGFGCGECPA
FT                   CKLRKRGYDAYLRGESVTEAPA"
FT   gene            373261..373893
FT                   /locus_tag="BURPS1710b_0357"
FT   CDS_pept        373261..373893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0357"
FT                   /product="GntS"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47900"
FT                   /db_xref="GOA:Q3JXD2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD2"
FT                   /protein_id="ABA47900.1"
FT                   /translation="MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRDGAV
FT                   CRFCDTDFVGTDGENGGKFKDAASLAARIASLWPAGEAYRFVVCTGGEPMLQLDQPLVD
FT                   ALHAAGFTIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYA
FT                   KLDFEHFLVQPMDGPSRELNTRLAIDWCKRHPRWRLSMQTHKYLNIP"
FT   gene            373913..374365
FT                   /gene="queD"
FT                   /locus_tag="BURPS1710b_0358"
FT   CDS_pept        373913..374365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queD"
FT                   /locus_tag="BURPS1710b_0358"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /note="identified by match to protein family HMM PF01242"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51097"
FT                   /db_xref="GOA:Q3JXD1"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD1"
FT                   /protein_id="ABA51097.1"
FT                   /translation="MLITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLRGDLVETEG
FT                   APDRGMVMDFADVKALAMEHLVSKWDHAFLVYARDEIVRSFLEKMADHKTVVLDRIPTV
FT                   ENLAAIAFDILANVYDAHYGVNLRLERVRLYETPNCWADVERDPRV"
FT   gene            374786..375571
FT                   /gene="hpcH"
FT                   /locus_tag="BURPS1710b_0359"
FT   CDS_pept        374786..375571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcH"
FT                   /locus_tag="BURPS1710b_0359"
FT                   /product="HpcH/HpaI aldolase family protein"
FT                   /EC_number="4.1.2.-"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50968"
FT                   /db_xref="GOA:Q3JXD0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD0"
FT                   /protein_id="ABA50968.1"
FT                   /translation="MSTLTHSLKARLRDGDEPLFGLWLTLASEAATEALAHAGFDWLCI
FT                   DMEHAPNDSRDVAAQLRALAAAHLPSEPVVRVPAREPWFVKRALDAGARTLMFPGVETA
FT                   DEAAHAVRLTRFQAPDAPDGLRGVAGIVRAAAYGMRRDYVQTANAQIATIVQIESARGV
FT                   DEAERIAATPGVDCVFVGPADLSASLGHLGDTKHPDVAAALEHVLAAGRRAGVPVGIFA
FT                   ADTAGARQSLEAGFRVVALSADVVWLLRATRQALQEVRG"
FT   gene            complement(375211..376347)
FT                   /locus_tag="BURPS1710b_0360"
FT   CDS_pept        complement(375211..376347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49777"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC9"
FT                   /protein_id="ABA49777.1"
FT                   /translation="MSVRRPGRLRRRRAARPRLLRGRELAILERRRVVALRGGGRIVRA
FT                   GDVEIAHDAVAAALVERRGHVLRNRLARVGRALVPGKRLPVVARRTAPVEKLVRERELG
FT                   LHVPLLRGLQEPVVRGRRIARDEFAVVEHPAVHVLRLRHPRIGRAPQPAQSFRHVRRHA
FT                   LTVDQHHRVIERGETVAARRRIVKLHERRAQIARVVVGHRHFGLALRVEPARRARRLRE
FT                   RAARRRTERRRGERTDYRAAQHTRRARGERRAAAFPAHPRTSCSACRVARSSHTTSADN
FT                   ATTRNPASRDWRAPAVSAAKMPTGTPARRPAASTCSSAAATSGCFVSPRCPRLADRSAG
FT                   PTNTQSTPGVAAIRSASSTPRADSICTIVAICAFAVCT"
FT   gene            375568..376344
FT                   /locus_tag="BURPS1710b_0361"
FT   CDS_pept        375568..376344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0361"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49832"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC8"
FT                   /protein_id="ABA49832.1"
FT                   /translation="MSGKRRGAPLSTRTPRVLRGAVIGSLAAAALGAAAGGALAQAPGA
FT                   PSRLDPQRETEVAVADYNAGNLRAALVQFHDAAARGNRLAAFDYAMMLINGEGVTANVP
FT                   EGLRWLRRAADAGMTQAQYVYGRMLDDGEFVARDPAAAHDWFLKAAQQGHVQAELALAN
FT                   QFLDGRGTPRDNRQAFAWYKRAADAGEPVSQYVTASFYERGGDGVVRNLDIARAYYAAA
FT                   AAQGDDAAALKYRELTAAQKAGPGGASAPKATGPSY"
FT   gene            complement(376618..377766)
FT                   /gene="mrdB"
FT                   /locus_tag="BURPS1710b_0362"
FT   CDS_pept        complement(376618..377766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="BURPS1710b_0362"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49226"
FT                   /db_xref="GOA:Q3JXC7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC7"
FT                   /protein_id="ABA49226.1"
FT                   /translation="MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASVDV
FT                   PGRVEDQLRNIMLTFVLMWMIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRRESSLRWYDFVVAFAILMVPVGLIAKQPDLG
FT                   TAVLVFAAGLFVIYLAGLSFKLIVPVLVAGVLAVGSIAVFEERICQPEVVWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRLMKS"
FT   gene            complement(377778..380189)
FT                   /gene="mrdA"
FT                   /locus_tag="BURPS1710b_0363"
FT   CDS_pept        complement(377778..380189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="BURPS1710b_0363"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48182"
FT                   /db_xref="GOA:Q3JXC6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC6"
FT                   /protein_id="ABA48182.1"
FT                   /translation="MTEFKDTQQQLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHG
FT                   KYALQAEENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLADTLDNTINALA
FT                   EVVQIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRWRFPGVDVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISKRDQDRIDAMSDENDSDPETYDPRRDANNYKGTDYIGKVGV
FT                   EQSYETELHGITGFEEVEVTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFAGK
FT                   RGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPP
FT                   GSTYKPFMALAGLALGKRTPGWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSND
FT                   TYFYMLARDLGVTAIANFMKPFGFGQLTGIDIQGEARGILPSPEWKKKTFKKAAQQKWF
FT                   DGETISLGIGQGYNSFTILQLAHATATLANDGVIMKPHLVKEVENPISRARHLTVPKES
FT                   GVIPLKQSDLDVVKRGMENVVESPSGTAFKVFRGAPYLAAGKTGTAQVFSLQGGNYRGH
FT                   LLAEHLRDHALFIAYAPVDHPQIALALIVENGGWGAQSAGPIARRVLDFYLLERKNPST
FT                   EAAAVAAAASATEPVNAPVIGDATKPVGIAAGFKALPQPVPPASASGADGASGASGAGG
FT                   EPTEHANAGGNPAGGGIAGGAAGTANNGSGAAAPGGMPGANGAAMGVPPASRRLPPRKP
FT                   RRTPASDAAISAAASRDDPRKPSSGAPKTPAQNDNHAVSAARPAAGGIDE"
FT   gene            complement(380373..380885)
FT                   /gene="mreD"
FT                   /locus_tag="BURPS1710b_0364"
FT   CDS_pept        complement(380373..380885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="BURPS1710b_0364"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by match to protein family HMM PF04093"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49284"
FT                   /db_xref="GOA:Q3JXC5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC5"
FT                   /protein_id="ABA49284.1"
FT                   /translation="MSRPQYILQPVNPYFIVFSLAAAFLLNLMPWGRVPGVPDCVALVL
FT                   LFWNIHQPRKVGMGVAFALGILMDVHDAGLLGEHALAYTLLSYGAITIHRRVLWLPLGV
FT                   QIFYVAPLLVIAQLVPFVIRLLMGAAFPGWSYLVDGFVEAALWPVASHLLLMPQRRPVD
FT                   PDDTRPI"
FT   gene            complement(380882..381955)
FT                   /gene="mreC"
FT                   /locus_tag="BURPS1710b_0365"
FT   CDS_pept        complement(380882..381955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="BURPS1710b_0365"
FT                   /product="rod shape-determining protein"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48228"
FT                   /db_xref="GOA:Q3JXC4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC4"
FT                   /protein_id="ABA48228.1"
FT                   /translation="MEYSPPPLFKQGPSALARLIFFVVLAIALLVSDARFNTLEIVRGV
FT                   LGTVLYPLQRAALVPRDLIVGAAELATSSTALRHENQQLRDRNLKLSLQANQAGQLAAD
FT                   NAHLRAVLELRQQIAAQATPVEIQYDTGDPFSQKIIIGHGSQAGIQDGAPVVNEDGVIG
FT                   QVTRVFPLQSEVTLVTDRDLAIPVQVLRTGLRSVIYGTPKGDALDLRFVPTSADLLAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFAHVVCAPIAAVRGAREMLVLHYRNDIPP
FT                   PPVTDDAASDAKAAKGKKATKGADKSAKAADKGADKDKGAKPAAAPPVPARSRPAGPAQ
FT                   PAAPLKPATAPSPGAPR"
FT   gene            complement(382075..383118)
FT                   /gene="mreB"
FT                   /locus_tag="BURPS1710b_0366"
FT   CDS_pept        complement(382075..383118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="BURPS1710b_0366"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50488"
FT                   /db_xref="GOA:Q3JXC3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC3"
FT                   /protein_id="ABA50488.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            383483..383782
FT                   /gene="gatC"
FT                   /locus_tag="BURPS1710b_0367"
FT   CDS_pept        383483..383782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BURPS1710b_0367"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49700"
FT                   /db_xref="GOA:Q3JXC2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXC2"
FT                   /protein_id="ABA49700.1"
FT                   /translation="MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE"
FT   gene            383895..385385
FT                   /gene="gatA"
FT                   /locus_tag="BURPS1710b_0368"
FT   CDS_pept        383895..385385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BURPS1710b_0368"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48820"
FT                   /db_xref="GOA:Q3JXC1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXC1"
FT                   /protein_id="ABA48820.1"
FT                   /translation="MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDA
FT                   ELTLAQAKAADAALANGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVV
FT                   ARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCALL
FT                   LNAMAGFDERDSTSLERADEDYTRHLGKAWAAGGDAGKPLAGLRIGLPAEYFGAGLADD
FT                   VRAAIDAALKTYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAA
FT                   EYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAF
FT                   KSCDVIMGPASPTVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAK
FT                   RPVGLQIIGNYFDEARMLQVADAFQRATDWHVQEPAGV"
FT   gene            385388..386860
FT                   /gene="gatB"
FT                   /locus_tag="BURPS1710b_0369"
FT   CDS_pept        385388..386860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BURPS1710b_0369"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47986"
FT                   /db_xref="GOA:Q3JXC0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXC0"
FT                   /protein_id="ABA47986.1"
FT                   /translation="MTQWEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLAL
FT                   PGVLPVLNRGAVERAIRFGLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGG
FT                   QITIQVPANEKAGKQAYSKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIV
FT                   TEPEMRSAAEAVAYAKALHGLVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEI
FT                   KNLNSFRFLEDAINYEVRRQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYF
FT                   PDPDLMPLVIGADWIARVKGEMPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEA
FT                   LVAKAGAANAKLAANWLMGDVSSQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIA
FT                   KEIFVTIWDEKAADEGAADRIIEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKD
FT                   KAFNALVGQAMKATKGKANPQQVNELLKKKLG"
FT   gene            386987..387826
FT                   /locus_tag="BURPS1710b_0370"
FT   CDS_pept        386987..387826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0370"
FT                   /product="DUF344"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51142"
FT                   /db_xref="GOA:Q3JXB9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB9"
FT                   /protein_id="ABA51142.1"
FT                   /translation="MAKQPSLDDYRVPYHTREKEAAAFTFDAFDPAAKPFSSGSKETDR
FT                   ERLSAVALQLDTLQERLHTQRHKRMLLVLQGMDSSGKDGTVRAVFHEVDPLGLRIVSFK
FT                   APTPVERSHDFLWRVHAQAPAAGELTIFNRSHYEDVLVPRVTAEIDKAECERRYRQIRQ
FT                   FEEMLAESGTRLVKCFLHISKDEQRARLQARIDDPNKHWKFDISDLEARKHWDAYQAAY
FT                   RDALAATSAEHAPWYVIPADSKTHRNVMIAELLLRELTAMKLEYPPAKPELAGIQIQ"
FT   gene            387859..388629
FT                   /gene="xth"
FT                   /locus_tag="BURPS1710b_0371"
FT   CDS_pept        387859..388629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="BURPS1710b_0371"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48475"
FT                   /db_xref="GOA:Q3JXB8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB8"
FT                   /protein_id="ABA48475.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFEWLGEQNADCVCVQEIKVSADDLP
FT                   AEFVEPHGLRSYFHHAQKKGYSGAGLYSRREPDDVIIGYGSSEFDAEGRYVEARFGKLS
FT                   VVSVYVPSGSSGDERQQAKYRFMDEFMPHLAELKAKREVILCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLTKLFDDVGYVDVFRTLDPRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGVAGTAKNTSIFRDIKFSDHAPLTVDYDYK"
FT   gene            complement(388933..389997)
FT                   /gene="adhC"
FT                   /locus_tag="BURPS1710b_0372"
FT   CDS_pept        complement(388933..389997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="BURPS1710b_0372"
FT                   /product="NADP-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.2"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49011"
FT                   /db_xref="GOA:Q3JXB7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB7"
FT                   /protein_id="ABA49011.1"
FT                   /translation="MSTTYAYAATSATTPLAPFEFARRALRDLDVQIEILYCGVCHSDL
FT                   HQARNEWKNTTYPVVPGHEIVGRVTAVGAQVTRFEAGELVGVGCLVDSCRTCPNCAQGL
FT                   EQYCENGFVGTYNGRDRATGDITYGGYSTQIVVDEAFVLRVPDTLDPAGAAPLLCAGIT
FT                   TYSPLRQWGAGPGKKIGIVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHE
FT                   VVISKDDAQMNAHLNSFDFILNTVAAQHDLNPFIGLLKLDGTMTLVGAPEHDHPSPRVF
FT                   NLIYKRRRLAGSLIGGIAETQEMLDFCAQHGITSDIEVIPMSQINAAYERMLTSDVKYR
FT                   FVIDIGSIRPQRAA"
FT   gene            390186..391151
FT                   /locus_tag="BURPS1710b_0373"
FT   CDS_pept        390186..391151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0373"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF06719"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50100"
FT                   /db_xref="GOA:Q3JXB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB6"
FT                   /protein_id="ABA50100.1"
FT                   /translation="MQYEGSPMSFEPLFADGGARLQRRILALFGQLAPNEGYTHAALDG
FT                   VRFIRSNRPVPRMPVLYDPSIVVVCQGRKRGYVGEQSFVYDAQQYLVLSVPLPFECETF
FT                   ATPDEPFLAISIRIDLAVIAELAILLDETHGASVSEPRGIYSTPLDAPLADAVLRLLEA
FT                   LASPADTRVLGPAIMREIGYRVLTGAQGDAIRAALAQQHHFGRVARALRRIHADLSGEL
FT                   DVETLASEAGMSLAVFHAQFKSVTATSPMQYVKATRLHHARLMMVQDGLNAGAAAARVG
FT                   YASASQFSREFKRLFGRSPSDEVRWVQAGGRQPVALEAGE"
FT   gene            complement(391525..392577)
FT                   /locus_tag="BURPS1710b_0374"
FT   CDS_pept        complement(391525..392577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0374"
FT                   /product="peptidase, M48 family family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47864"
FT                   /db_xref="GOA:Q3JXB5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB5"
FT                   /protein_id="ABA47864.1"
FT                   /translation="MQAKLRVARAALTFVGGVALGVAGPVLGFELCMAEPMLVADNGAP
FT                   PVPSAPAVATPAAPAAAPAAGNPQPYALGDQQVRYGNAIVFRSLIPSPLLEQLTDNEYR
FT                   QTVQDAAQRKRLLPPNNARVKRLRTIVMRLAPYAVKWSERVKGWNWEIEVLRSRSIRAF
FT                   CLPGGKVLVDSGLLERLRLTDDELGVLFAHEIAHALREHARSSLGEQQAASLGTGATPL
FT                   PPLFGLSEPLPAPLGVVERFASVRYDPTDETEADVIGGDIAARAGFDPRAAITLWDKLA
FT                   VATRADKDNGFIHAHPYDTRRRNDLRKRLADLMPLYRKALVKNADARANAAGAGAAAGA
FT                   KQRGAAAANR"
FT   gene            complement(392567..393880)
FT                   /gene="ampG"
FT                   /locus_tag="BURPS1710b_0375"
FT   CDS_pept        complement(392567..393880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="BURPS1710b_0375"
FT                   /product="MFS family, muropeptide transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48920"
FT                   /db_xref="GOA:Q3JXB4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB4"
FT                   /protein_id="ABA48920.1"
FT                   /translation="MTKPPHDAPALNAHEDHPGWRAFLNTHMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRFIPRLPGWRPGRRRGWMFV
FT                   TQLLVAGAIAALGFVSPRESIWTVAALTTLVAFFGASADIVIDAYRRELLRDTEQGLGN
FT                   AVHVNAYKVAALIPGSLSLILSDHLPWDAVFALTAAFMLPGILMTLVVREPDVHGAPPK
FT                   NLSEAVIMPFREFIGRDGWRGALLVLGFIFLYKLGDTMATTLSTSFFLDLGFNKTQIGV
FT                   IAKTTAFWASLAGGIIGGVWLVKIGIARGLWIFGVLQIVSTLGFAWLAKAGPDPVLMAA
FT                   IYGFETFSTGLTLAAFTAYIASTTDPRYTATQFALFTSLASVPRTLASASSGFIVAQIG
FT                   WFDYFLVCAALGIPGMLLLFKIAPWNGSMSGNEAARAG"
FT   gene            complement(393892..394506)
FT                   /gene="metW"
FT                   /locus_tag="BURPS1710b_0376"
FT   CDS_pept        complement(393892..394506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="BURPS1710b_0376"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="identified by match to protein family HMM PF07021;
FT                   match to protein family HMM TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49540"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB3"
FT                   /protein_id="ABA49540.1"
FT                   /translation="MNQQALNTLSARADFRAIARWVEPRSTVLDLGCGDGSLLSLLTEE
FT                   LEVSGYGVEINDAGVLASVKNGINVIQQNLEDGLRLFEDHSFDFAILSQTLQTIHQTAA
FT                   ILRETARVGRECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGVAILDRVVLHEGQPIRWGVNWRGSLAVYRVKRRQP"
FT   gene            complement(394503..395648)
FT                   /gene="metX"
FT                   /locus_tag="BURPS1710b_0377"
FT   CDS_pept        complement(394503..395648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BURPS1710b_0377"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50518"
FT                   /db_xref="GOA:Q3JXB2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXB2"
FT                   /protein_id="ABA50518.1"
FT                   /translation="MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAVRSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMNIDPATGTPYGARFPVVTVEDWVHAQARVADALGIERFAAVMGGSLGGMQALAWSLL
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFNGDLSAALAHTKAKYLIASFMTDWRFAPARSREIVKALLDNR
FT                   RSVSYAEIDAPHGHDAFLLDDARYHNLVRAYYERIAEEVGA"
FT   gene            complement(395997..396689)
FT                   /gene="ttk"
FT                   /locus_tag="BURPS1710b_0378"
FT   CDS_pept        complement(395997..396689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="BURPS1710b_0378"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48324"
FT                   /db_xref="GOA:Q3JXB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB1"
FT                   /protein_id="ABA48324.1"
FT                   /translation="MQPTHPHDPAVTAAAENERSAATASRTRPKPGERRVHILQTLASM
FT                   LEAPKSEKITTAALAARLDVSEAALYRHFSSKAQMFEGLIEFIEETFFGLVNQIAANEP
FT                   NGVLQARSIALMLLNFSAKNPGMTRVLTGEALVGEHERLAERVNQMLERVEASIKQCLR
FT                   VALLEAQAHAAGGGAPPPVPLPDDYDPALRASLVISYVLGRWHRYAKSGFTKAPGEHAD
FT                   AQLRLILQ"
FT   gene            396779..398086
FT                   /locus_tag="BURPS1710b_0379"
FT   CDS_pept        396779..398086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49821"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB0"
FT                   /protein_id="ABA49821.1"
FT                   /translation="MAGQVPGDPDGADAEPLVALQVAARILDEDGVRQARVRRAHRPAQ
FT                   HRGVGLRAPCAAIAHLLDRDHALEQAVDLQLAQHRARIGFGGVRQHDLAAGQRSDEPRE
FT                   PALGAHHRRQVGERVDDLQEIVRIDRVMAREAEERRAVAARVVGAQMIGVRALDFQRID
FT                   DVLRHRPVDRREDRMRRVVQRVVEIEEPDGAARLRAGAPPARSLGRLLARRRRGGAARL
FT                   AARAQCERIIVPNGCSVRISSSTECSMRPSTIWTDFTPLFAASSADEIFGSMPPEIVPS
FT                   SKSASISRADRSVSRLPSLSITPGMLVIITSFSAFSTVASLPATRSALMLYDRPSSPKP
FT                   IGEITGMNASSCSAFTTAGLIASTSPTWPMSTYSPGLSRSGIISLRAWMRPPSLPVRPT
FT                   AWPPKWLISVTMSCCTSPPSTHSTTSIVSSSVTRIP"
FT   gene            complement(397456..398511)
FT                   /gene="argB"
FT                   /locus_tag="BURPS1710b_0380"
FT   CDS_pept        complement(397456..398511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="BURPS1710b_0380"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48851"
FT                   /db_xref="GOA:Q3JXA9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXA9"
FT                   /protein_id="ABA48851.1"
FT                   /translation="MRIAQENLTFPAAAPDFDTPAAHRPNGQKPHAALRHSCTIPPVST
FT                   FRTRAAAMSEPIDLSQISPALKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGF
FT                   ARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGE
FT                   VQQDIVTLINHFGGHAVGLTGKDGGLIHARKLMMPDRDNPGEYVDIGQVGEVEAINPAV
FT                   VKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLVMMTNIPGVMDKEG
FT                   NLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHSVLLEILT
FT                   EQPFGTMIRSH"
FT   gene            complement(398532..400079)
FT                   /locus_tag="BURPS1710b_0382"
FT   CDS_pept        complement(398532..400079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0382"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA8"
FT                   /protein_id="ABA49685.1"
FT                   /translation="MAALRAVDGRRAERVAQGGRDARPVIANLELDFVACAVVRNRCRQ
FT                   RNAIAARARGIVEQDGQDLADRDRIVERDAHGLRPPLLEQHVRMAQPPMLDERVEPLAD
FT                   GFAARPLRRAASQARERRRALRHLLLEHLQVRIVAREPRVRAGGLAQFLGQHRDRRQRG
FT                   AHLVRDGGRLHAERDRALVAQQRLLRLAERRVALAQRARHPRDEPRDEPDAHHEVHPHA
FT                   RTKIIEQVRGIIQVERHRIEAEREVARNRERRQPDHQVPRQHRGRDRERRQVQRNERVR
FT                   GPARQEEQRRQRAEVDPQLAEQLEIGLGPRAQHAHPRERVEHDFERDHHQHRGQRQMDA
FT                   EISLYDGDRDELADDREIAQPEQMAQVDASGSGDSLHPRSLPSQSSRSGRAGPSPAVLA
FT                   ATRRAISSARHAGHRQRAPVAGCAPAGIAGIAAHQQVNGRVRAPQSNALPQRGQRLLIR
FT                   PGVAAGSVIANGPGQAGMWAKRSRNEHRRRPQRPIRRRDAAARSSLAAGSRAATCQA"
FT   gene            398680..398931
FT                   /locus_tag="BURPS1710b_0381"
FT   CDS_pept        398680..398931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48216"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA7"
FT                   /protein_id="ABA48216.1"
FT                   /translation="MTEPAATPGLISKRCPRCGSAFDCGARTRPFTCWCAAMPAMPAGA
FT                   QPATGARCLCPACLADEIARRVAASTAGEGPARPERED"
FT   gene            398949..400229
FT                   /locus_tag="BURPS1710b_0383"
FT   CDS_pept        398949..400229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0383"
FT                   /product="sensor kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48994"
FT                   /db_xref="GOA:Q3JXA6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA6"
FT                   /protein_id="ABA48994.1"
FT                   /translation="MQRITTTGRVNLSHLFWLRNLAIIGQLVTIAVVQTYFGVHLPLPA
FT                   MLMVIALEIVFNALTWVRVLRARPETNFELLGQLWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMIWLAAFAVACYLALGFDSVPLNLDNPANLFDYFRAGMWVNFMV
FT                   SVGLIAWFVARMSSALRQRDAALGEAQQALLRDERAVALGVQAATVAHEMGTPLSTIAM
FT                   LTEELREAARTDAGLARYDADLKVLEEQMSQCTSALARLRSRASERPSREPVGEWLDTF
FT                   VEHWRLRHPHVLFEQRGPQPVGVALDDTVAVGQILTILLDNAARASRDRVTLAATIAHD
FT                   GARDEIEFEVCDNGPGIPAALRDTLGAAPVDSTQGGHGVGLYLAFSSAARLGGSIELAD
FT                   AQPRGTRAILRLPVARQVAAEMANENG"
FT   gene            400249..400791
FT                   /locus_tag="BURPS1710b_0384"
FT   CDS_pept        400249..400791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0384"
FT                   /product="response regulator protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49423"
FT                   /db_xref="GOA:Q3JXA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="PDB:3RQI"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA5"
FT                   /protein_id="ABA49423.1"
FT                   /translation="MSDKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGA
FT                   EKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVESILAALQTNASEVQAEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALN
FT                   MHRRTLQRKLAKKPVRQ"
FT   gene            complement(401209..402552)
FT                   /gene="hslU"
FT                   /locus_tag="BURPS1710b_0385"
FT   CDS_pept        complement(401209..402552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BURPS1710b_0385"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51182"
FT                   /db_xref="GOA:Q3JXA4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXA4"
FT                   /protein_id="ABA51182.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFR
FT                   KRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIK
FT                   EALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGV
FT                   QRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLS
FT                   VKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRL
FT                   YTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDHALGEVSKDEDLSRYVL"
FT   gene            complement(402562..403206)
FT                   /locus_tag="BURPS1710b_0386"
FT   CDS_pept        complement(402562..403206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0386"
FT                   /product="ATP-dependent protease hslV"
FT                   /EC_number="3.4.25.-"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47467"
FT                   /db_xref="GOA:Q3JXA3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA3"
FT                   /protein_id="ABA47467.1"
FT                   /translation="MKAMRVEPAGQARSRAPQHAAAPRAPRLSRLSRGIQMEQFHGTTI
FT                   LSVRRGDKVALGGDGQVTLGNIVMKGGARKVRRIYNNQVLVGFAGGTADAFSLLDRFEA
FT                   KLEKHQGNLTRAAVELAKDWRTDRLLRRLEAMLIAADATTTLVITGNGDVLDPEGGICA
FT                   IGSGGSYAQAAARALAENTDLSPREIVEKALGIAGDMCIYTNHNRIIETIE"
FT   gene            complement(403353..403769)
FT                   /gene="dksA"
FT                   /locus_tag="BURPS1710b_0387"
FT   CDS_pept        complement(403353..403769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="BURPS1710b_0387"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48600"
FT                   /db_xref="GOA:Q3JXA2"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA2"
FT                   /protein_id="ABA48600.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQAEILRNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIESGDYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            404223..405440
FT                   /locus_tag="BURPS1710b_0388"
FT   CDS_pept        404223..405440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50312"
FT                   /db_xref="GOA:Q3JXA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA1"
FT                   /protein_id="ABA50312.1"
FT                   /translation="MAGERRAPPVAHAPLTRRRRAAAASPRTMRRGLCEAGVEAVGDEV
FT                   ARQVDADEHHLVGLLLGRQPLRGEIAAHHLMHALEHDLAVDALHVQHALVAQHPLAVDL
FT                   QNAAEEILELVRIERAIVAVDERLDLVVVVRVVMIVVAVPVIVLAMAVIVIAMRVIVVV
FT                   IVVMRVRVIVFREEVRIDLELRVQVEAAQVEDLLDVRIAEVHDLDRRLRVHVQQAVLEL
FT                   GHRLVVDEVRLRDEQAIGEADLALHDFVLVELRVRMLRVDERDDRVEQEFVGDLAVDEE
FT                   RLRDRARIREARRLDHHAVEVERAVALFRGEVGERAREVAANRAADAAVAHLDDLLGRI
FT                   LDEDLVVDVLFAELVFDHGDLHAVLFVQDALEQRGLAAAEKAREDGDGNGHVVGRLWFV
FT                   KRGQNG"
FT   gene            complement(404319..405395)
FT                   /locus_tag="BURPS1710b_0389"
FT   CDS_pept        complement(404319..405395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0389"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48725"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA0"
FT                   /protein_id="ABA48725.1"
FT                   /translation="MAIPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEENID
FT                   NEILVQDSTEQIIQMSNGCICCTIRGDLARALADLAAKKRDGTFDFDRVVIETTGLANP
FT                   GPVAQTFFIDSEIADEFLLDAVITLVDAKHANAQLDEHEVVQRQVGFADRLFITKADLV
FT                   DDEAVSELKHRLLHMNPKAAIKVVNFGDADIKEIFDLRGFNLNAKLEIDPDFLAEDDHA
FT                   HAHHDDHDHDHAHCDHDHGHCEHDHGHGHHDHHHAHHDDKIKSFVYRNDRPFDPNKLED
FT                   FLGGILQIYGERMLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWLPAEKKTNKMVFI
FT                   GVDLPRDLITDGLDACLA"
FT   gene            complement(405573..406850)
FT                   /locus_tag="BURPS1710b_0390"
FT   CDS_pept        complement(405573..406850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0390"
FT                   /product="predicted SAM-dependent methyltransferases"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50385"
FT                   /db_xref="GOA:Q3JX99"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX99"
FT                   /protein_id="ABA50385.1"
FT                   /translation="MHTVTLKPSKDKSLLRRHPWVYANAIDRVDGKPAPGATVIVRAHD
FT                   GRFLARAAYSPHSQIRLRVWSFDENEPIDHAFFKRRVQRALAHRRAMISGTDAVRLVFG
FT                   EADGLPGLIVDYYVAARGAAHTGDAAARAAEGGAAAPVAPGDGEGRGQLVCQFMAAGVE
FT                   HWKGAIVAALVAATGCPNVYERSDVSIREKEGLEQTTGVLAGDAPPDTLIANENGVLYH
FT                   VDVRNGHKTGFYVDQRENRALVAQYARDRDVLNCFCYTGGFSLAALKGGAKRVVSIDSS
FT                   GDALALAQRNVAANGFDAARAQWLDADAFKTLRRLVDEGERFDLIVLDPPKFAPTRDSV
FT                   DRAARAYKDINLSGLKLLRPGGLLFTYSCSGAIDMDLFQKIVAGAAADAKVDARILKRL
FT                   GAGVDHPLLTAFPEGEYLKGLLLQIA"
FT   gene            405636..407339
FT                   /locus_tag="BURPS1710b_0391"
FT   CDS_pept        405636..407339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48730"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX98"
FT                   /protein_id="ABA48730.1"
FT                   /translation="MIDARAEPLEDARVDLRVGRRARDDLLEQVHVDRAGARVREQQAA
FT                   RAQQLQAAQVDVLVRARRAIDAVARRRELRRIEHDQVEALAFVDEAAQRLERVGVEPLR
FT                   ARGVEAVRGDVALRERERVARRIDRHDPLRAALERREREAARVAEAVQHVAIARVLRDE
FT                   RAVLALVDVEARLVAVAHVDVIQHAVLVRDQRVGRRVAREHAGRLFEPFLFADRHVRAL
FT                   VDVRAAGGRDERRDDRALPVLDARRHELADELAATLAVARRDRRGRAAFGRARGGVAGV
FT                   GGASRRDVVIDDEPRQPVRLAEHEPHRVRARDHRAAMRERALHAPLEERVVDRLVLVEA
FT                   PHAQPDLRMRAVRGAREEAPVVRAHDDGRAGRGLAVDAVDRVRVDPRVAAQQGFVFRRL
FT                   ERNGMHVGIEMAARGAAECDSGIRRFSDAARAAARVSRAFSRADARCRKSSRDAGSRAT
FT                   YRPASPRCSRARAAPAPRAGRRSIAARASRTSGAVRADERSPECPPRAPRASRARARRR
FT                   ATSGCRAPRGRAVADRASRIRRAPRARRAARRAPCGRRAPCAPCRPCRAR"
FT   gene            complement(406939..407871)
FT                   /gene="xerC"
FT                   /locus_tag="BURPS1710b_0392"
FT   CDS_pept        complement(406939..407871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BURPS1710b_0392"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02224"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47917"
FT                   /db_xref="GOA:Q3JX97"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX97"
FT                   /protein_id="ABA47917.1"
FT                   /translation="MTAKPIADPIVDYLSNLRHVRKLSDHTLRAYAHELDELKKLANGR
FT                   PLDSLTAVDMRSAVARAHAGGLSARSISHRLSAWRAFYRWFSQHVEMNANPVAAVRAPK
FT                   RAKTLPKALSVDDTAALMDAPTAGTAESLRDHAILELFYSSGLRLAELIGLDIEYVKDG
FT                   AYRSAGWLDLAEAEVTVRGKGDKERKVPVGRKALDALHAWLAVRGEFVKHDPRPLFLSV
FT                   RGNRMSPGVVRERVKRAALAAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASI
FT                   SATQVYTSLDFQHLAKIYDSAHPRAKKRD"
FT   gene            complement(407909..409564)
FT                   /locus_tag="BURPS1710b_0393"
FT   CDS_pept        complement(407909..409564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0393"
FT                   /product="Protein of unknown function, DUF484 family"
FT                   /note="identified by match to protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50035"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX96"
FT                   /protein_id="ABA50035.1"
FT                   /translation="MPAAYNSAHETLVHQDARRGQRLRRARRLHPRAAPAHRRAGARAR
FT                   RPPLRDRRRSVAARRKADRRRRRFQIPDLQLRRRRSRALRQRRALLRQVRPRPRAHRQG
FT                   ERARRGEARRDHADDAGQRRGRRRHGRARVRAGARAVRRERPRRPPRGRRHALAAARER
FT                   RDALDLGRVDGQSARGADRRRRRGVRGARRRAGDRARSAFPAARERGLHADRVASRSEP
FT                   ARLRARRGRNARVRHGRVRGRRGRHPARATRFARHGPYARRHADDLVERRVRRARAAHD
FT                   GRPRDHRLRRRDRAARLTFNSQTFHLPKPERSAMNDREVADYLLANPEFFAQHAELLAT
FT                   IKLANPHGKAAVSLQERQMEMLREKNKHLERRLAELLRYGHENDGLAAKFNRWTARVIA
FT                   ERDPYALPRAIAGGLADVFDVPQTALRLWDVAETYAQADFARNVGEEVRLFTNSLATPY
FT                   CGANTGFEAAQWLTPVAAPPAADDGEAPAASGAAESVALIALRASAEGEGAGAFGLLVL
FT                   GSPDPRRFHDGMGTDFLTQIGTLASAALTRLLPH"
FT   gene            complement(409580..410464)
FT                   /gene="htrB"
FT                   /locus_tag="BURPS1710b_0394"
FT   CDS_pept        complement(409580..410464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="BURPS1710b_0394"
FT                   /product="Lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50012"
FT                   /db_xref="GOA:Q3JX95"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX95"
FT                   /protein_id="ABA50012.1"
FT                   /translation="MLGRLGTQLAVAFLKFLAVLPYGLTARLGDGLGWLLYQIPSRRKR
FT                   IVHINLQLCFPDWSDARREEIAGRHFRHAIRSYVERSVQWFGSAKKLEKLIQVDSAIDL
FT                   TDPNLPPTLFLGLHFVGIEAGSIWLNRSLQRRCGSLYQPFSNPTLEAIAKAARGRFDAE
FT                   MVGRADSARVVLRWLRDRKPVMLGADMDYGLRNSTFVPFFGVPACTLTAVGRLARTGHA
FT                   QVVPFIGEVLPDYQGYRLKVFKPWENYPTGDDDLDARRMNAFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGEPGVY"
FT   gene            410730..411917
FT                   /gene="metK"
FT                   /locus_tag="BURPS1710b_0395"
FT   CDS_pept        410730..411917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BURPS1710b_0395"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50835"
FT                   /db_xref="GOA:Q3JX94"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JX94"
FT                   /protein_id="ABA50835.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANIDYIQIARDTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACDETPELMPLPIHLSHRLVERQANLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSIDTVVLSTQHAPEIDLPALREAVIEEVIKPTLPADLIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRALIQVSYAIGVAEPTSVMVNTFGTGRVSDETITKLVREHFDLR
FT                   PKGIIQMLDLLRPIYEKTAAYGHFGREEPEFSWEAADKALALAEAAGVEPAVQVA"
FT   gene            complement(412084..412437)
FT                   /locus_tag="BURPS1710b_0396"
FT   CDS_pept        complement(412084..412437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48607"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX93"
FT                   /protein_id="ABA48607.1"
FT                   /translation="MPFRLTSRLHRTPKSAPSAPHRIVRALRHHSARSSVLAERARQHQ
FT                   PRLDGLRAWLHAFLSLMSAHAAARRTALRSLLQKPALRLRAPSLHRASVAPRRINRPRR
FT                   LATSTGWFVFAAR"
FT   gene            412654..413574
FT                   /locus_tag="BURPS1710b_0397"
FT   CDS_pept        412654..413574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0397"
FT                   /product="Phytanoyl-CoA dioxygenase (PhyH) family"
FT                   /note="identified by match to protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49141"
FT                   /db_xref="GOA:Q3JX92"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX92"
FT                   /protein_id="ABA49141.1"
FT                   /translation="MAGARPTVPLRYIKFAATIARRFSLRGMVASMSRTSVLQSFIDNN
FT                   DADHPMSSLHPELIHTQVQTLRERGFVVAPGLVAPERCAQLKTIAERQLREAAQPLEFE
FT                   ADLRYPGAPESRHAPGGHTVRRLLDAYARDAAFAERATAPEIGAWMRAYFDETPVLSRA
FT                   HHNCVMTKHPAYGSLTGWHRDVRYWSFERPDLVSVWLALGPETDDNGALWLVPGSHDAE
FT                   FGPERFDEAKFFRGDVPANRRLIEQAVCPALAAGDVVFFHCNTLHSAGQNRSDQVKFSL
FT                   VFTYHGDSNRPVPGSRSASKPEVRF"
FT   gene            413736..414104
FT                   /locus_tag="BURPS1710b_0398"
FT   CDS_pept        413736..414104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48155"
FT                   /db_xref="InterPro:IPR002002"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX91"
FT                   /protein_id="ABA48155.1"
FT                   /translation="MSRGDALRRQSRRRPRLPPEETGGPHAAARFVSASGRRVRQRLPL
FT                   GIDSPISPTSVATTPPAISMIVFVEGEPVKKRATPSLIEWNDWPPKYSSTTPPTMSATE
FT                   IARVMKILAETDDEDAAV"
FT   gene            complement(413855..414148)
FT                   /locus_tag="BURPS1710b_0399"
FT   CDS_pept        complement(413855..414148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0399"
FT                   /product="Predicted membrane protein-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49415"
FT                   /db_xref="GOA:Q3JX90"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX90"
FT                   /protein_id="ABA49415.1"
FT                   /translation="MQQRRAAMDAAAALPYTAASSSSVSARIFMTRAISVALIVGGVVL
FT                   LYFGGQSFHSINDGVARFFTGSPSTKTIMLIAGGVVATLVGLIGLSMPSGKR"
FT   gene            414236..415279
FT                   /locus_tag="BURPS1710b_0400"
FT   CDS_pept        414236..415279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0400"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50117"
FT                   /db_xref="GOA:Q3JX89"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX89"
FT                   /protein_id="ABA50117.1"
FT                   /translation="MAYEAASERYADMQYRVSGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   REILRTAFDLGITHFDLANNYGPPYGSAETNFGRLLREDFKPYRDELLISTKAGWDMWP
FT                   GPYGSGGGSRKYVLASLDQSLRRMGLDYVDIFYSHRFDAHTPLEETASALASAVQQGKA
FT                   LYVGVSSYSAASTREIAKLLAEYKVPLLIHQPAYNMLNRWIERELLDALDETGSGCIAF
FT                   TPLAQGLLTSKYLNGVPADARINKPGGGSLKEAHLSAENLEHVRKLNEIAQRRGQSLAQ
FT                   MALAWVLRDSRVTSALIGASRAEQVRENVAALAHLAFSDDEIAEIDRYATEGGINLWEK
FT                   PSTDQAI"
FT   gene            complement(415366..415551)
FT                   /locus_tag="BURPS1710b_0401"
FT   CDS_pept        complement(415366..415551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0401"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50788"
FT                   /db_xref="GOA:Q3JX88"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX88"
FT                   /protein_id="ABA50788.1"
FT                   /translation="MSTYFTIADFILLIPMALAGALFLGAVPCATEFRHNVLRVLGAML
FT                   GVAVAVLLVEGLPALI"
FT   gene            complement(415819..416682)
FT                   /locus_tag="BURPS1710b_0402"
FT   CDS_pept        complement(415819..416682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0402"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48037"
FT                   /db_xref="GOA:Q3JX87"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX87"
FT                   /protein_id="ABA48037.1"
FT                   /translation="MASVRPALAAHGATSLFVLLWSSGAIFAELGLRHASAFAFLIARF
FT                   ALASLVLLVLSLARRRWLPPRGARRATLATGVLLTGGYSILYLLALERGLAPGILATIL
FT                   GVQPILTLAVLERRMSPARLAGLALALTGLSLVVYRSAAGGAAPAAGTACALGALLAIT
FT                   AGALLQKRVRAAPIDVLPLQNALGLALCALIAPFEPISFEASWAFALPLAWLGIVISVF
FT                   AQLLFYRLMQRGDLVNVTSLFYLVPVVTALMDAAWLGNRLAPLEIAGMIAILAGLALAF
FT                   RRAARD"
FT   gene            complement(417019..418632)
FT                   /locus_tag="BURPS1710b_0403"
FT   CDS_pept        complement(417019..418632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0403"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47693"
FT                   /db_xref="GOA:Q3JX86"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX86"
FT                   /protein_id="ABA47693.1"
FT                   /translation="MLPGRKYPNCASMTRQSARIPLFIVHGIAKARADDKRAANSPDAS
FT                   SPPPRRAACEAVRRSIIPRRARPPSDDSFGIRKCGQKPTRRLTKRRRTGNRRIVEACLA
FT                   WRISVTVPPGAPRPAAVGRANSAHAAQGASPVGAAPYLERGSRGYWHASVALLFAGYAT
FT                   FSLLYYVQPLLPEFSRAFGVSPAQSSLALSFATAALAAAVFVAGFVSEALSRHRLMTAS
FT                   LTASSLLTLAAAFAPHWHQLLILRALTGLALGGVPAVAMAYLAEEVHPDGLGLAMGLYV
FT                   GGTAIGGMAGRVITGILTDLFSWRIAVGAIGVLGLASMLAFRMLLPPSRHFVPRRGLNL
FT                   AHHRTSLAHHLRGQRELPVLFAMAFVLMGSFVTLYNYIGYRLLAPPYSMGQATIGAIFV
FT                   VYLVGVVASPLSGRLADTLGRGRVLIASLAVMLGGVALTLLHPVAAIVAGVACVTFGFF
FT                   AGHAVASGWVGRLAQHGKGQAAALYLLAYYLGSSVVGSLGGRFWSTLGWPGVAALVGAL
FT                   LALGVVAAAWLRARERGGAA"
FT   gene            418662..418874
FT                   /locus_tag="BURPS1710b_0404"
FT   CDS_pept        418662..418874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX85"
FT                   /protein_id="ABA47769.1"
FT                   /translation="MHVGSIVCTTHIAVPKGARGIVQRILGDMAMVTWYAGVPGESKEL
FT                   NTEPFFLEDLIDTGESVLPAGAALH"
FT   gene            418906..419946
FT                   /locus_tag="BURPS1710b_0405"
FT   CDS_pept        418906..419946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0405"
FT                   /product="Phosphotransferase enzyme family domain protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50810"
FT                   /db_xref="GOA:Q3JX84"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX84"
FT                   /protein_id="ABA50810.1"
FT                   /translation="MRSMNDATSESNAAGACAGLPFAGLTPERVLDALDSVLIPAGSRT
FT                   DGRLLALNSYENRVYQAGIEDGAPIVAKFYRPQRWSNDAILEEHTFVAELAAREIPAVP
FT                   PLAFDGRTLHEFDGFRFAIFERRGGRAPELDRRDTLEWLGRFIGRIHAVGATKPYAARP
FT                   TLDLRTFGYEPRDFLMSHDFVPDDVRPAYEAAVALALEGVERAYERAGDVRMLRAHGDC
FT                   HPSNVLWTDAGPHFVDFDDSRMAPAVQDLWLLLPGDRPGASRALTDLLAGYEDFCEFDP
FT                   RELHLIEALRTLRLIHYAAWLARRWDDPAFPAAFPWFNTHRYWEARVLELREQIGAMQE
FT                   GPLWPV"
FT   gene            complement(419858..421999)
FT                   /locus_tag="BURPS1710b_0407"
FT   CDS_pept        complement(419858..421999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50002"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX83"
FT                   /protein_id="ABA50002.1"
FT                   /translation="MPATPVSQRRRHEERSARFSHARRAVARPARRLSARAVPVVGDAR
FT                   RPPARAAQDAAREPRCARRRDQRGLRPSREGRSADVRDLARERGNRRGAQARQALDQAE
FT                   EPDDEQVAAPRAREGDATAARRRRHRRAVELPGAARRGPAHLRARRRQSRDRQDVRTDA
FT                   AHVAAVRGTDLENLRARSRRGGQRRCANRRGVQRAAVRSSALHRLDERRPARDARGRRA
FT                   PHARHARAGRQVARDRRAARALRRGGRRRHHRQDAERGPDLHRARLCARAARQGSRIRR
FT                   ARARADGSALSESVDEPGLYVDHLRAPLRTAAAARERSAAGGRATPSAHGRGARSRAAP
FT                   PAARARHAGARCVAVDAGRDLRAAAADRSVRHARRCDRLRERAAAAARAVSVRRRPHDH
FT                   RARDARHDLGRRDGQRHADAHRVRHAAVRRRRRERDGRVPRLRRLRHVLEDEARAHAAA
FT                   PEHARDDRAAVRQALRGDPQADAEVLTRASQAKGRPRSMPPAHARAPRSTALDGARGRA
FT                   SGNRRAAGGRRGRRRGGIRPRVDAARRRGRLPIGVRDAGQARRADARVSPGQRQSVIRR
FT                   AEGRAAQIADGEPLTRRVAALEAPHARGKCKEKNRARARRPRSPAARPLVRKTDILCEA
FT                   NANANANASAGAAANAGGPAAHHVAGHARGARGRCRPNGRRARCAPERGITRATTALPA
FT                   SRRSARAIRARALPNSDAC"
FT   gene            complement(420229..420498)
FT                   /locus_tag="BURPS1710b_0406"
FT   CDS_pept        complement(420229..420498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0406"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48321"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX82"
FT                   /protein_id="ABA48321.1"
FT                   /translation="MLGRRARRRSTARAAGRRATGGQPAGGADEGAAASGRASMLHVEG
FT                   VVYRSVCATPARPVELTLAYRQDNDNPLFGAPKDVPRKSLTASR"
FT   gene            420373..421944
FT                   /locus_tag="BURPS1710b_0408"
FT   CDS_pept        420373..421944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50173"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX81"
FT                   /protein_id="ABA50173.1"
FT                   /translation="MQHRRAAGCRRAFVRAARRLPAGCPTPGRARRRAPSSAAPEHAPA
FT                   ASSAGGPSLAMRASELQHQLEDRREALAVRRRDHRARVQARLREHGLHLRERDEAVVAV
FT                   VRAHPARADAAERQRAARDVHQRVVDRHAARDRVAHHALDGRAVFVEQIQRERPRPRVH
FT                   VGDRIVERVVRNDRQQRPEDLFLHQLRRIGRLRDEHGRQAAQRGIGRRVRERMELRARL
FT                   LRFAREPLQPCEVALGDDRRIVRVRRQIRIEPSHPRARARDEFGFLAARHEHIVGRDAG
FT                   LARVQRLAGDDGVDRRVEARARPDDHGRLAAQLERDGREVLGGRAHHVPADVRRAGEEQ
FT                   MIERQPAERRADLRIAVDHRDVIAREGFRDQFLEQLRRARRQFGHLDDRAIAGGERADE
FT                   RARGEQHRVVPRHDDADDAERLWHHLRARGAQPLVHRPALRLDPALAVLERLVDFLFRE
FT                   PDLGHQHFFLRAMAEVRVDRGGERIAVLEQHLAQRAQVVGARRPRRVRRAQIGGALVAQ
FT                   QRVERG"
FT   gene            complement(420547..421965)
FT                   /gene="calB"
FT                   /locus_tag="BURPS1710b_0409"
FT   CDS_pept        complement(420547..421965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="calB"
FT                   /locus_tag="BURPS1710b_0409"
FT                   /product="coniferyl aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48328"
FT                   /db_xref="GOA:Q3JX80"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX80"
FT                   /protein_id="ABA48328.1"
FT                   /translation="MKNDLPGLATLDALLRDQRAAYLRAPYPSWATRADHLRALRKMLL
FT                   ENRDALAAAINADFGHRAKEEVLMSEIWLAKEEIDEALKHGKRWIKPKSRTMNKWLRPA
FT                   RAKVMPQPLGVVGIVVPWNYPVLLAAGPLICALAAGNRAIVKMSELTPRTSQLFEELIS
FT                   KTFARDHVAVVNGDAQIGAAFSGLPFDHLLFTGSTNVGRHVMRAAAEHLTPVTLELGGK
FT                   SPVIVGPRARFDAAVDAVITGKTLNAGQTCIAPDYVLVPRGKEAEFVARARARMARLYP
FT                   NLSTNPDYTSIISERHFARLQRLASEAQQAGAQLHPLTDAAPDPALRRLPPVLVTQAPD
FT                   ASQLMQEEIFGPLLPIVPYDTLDDAIAYVNARPRPLALYLFDEDRTTIERVMRDTISGG
FT                   VTVNDTLMHIACGTLPFGGVGASGMGAYHGYDGFVTFSKMKPVLTQPRLNTRAMIAPPY
FT                   GKRFAAILKLMLKF"
FT   gene            complement(422000..423679)
FT                   /gene="aidB"
FT                   /locus_tag="BURPS1710b_0410"
FT   CDS_pept        complement(422000..423679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="BURPS1710b_0410"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47753"
FT                   /db_xref="GOA:Q3JX79"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX79"
FT                   /protein_id="ABA47753.1"
FT                   /translation="MQQDLMTATHRVTNQAPPLSDYNAFETDAALVEAVRRYGASWRQT
FT                   ALSHDGAALTAPDVLALAELANRHAPELETHSPRGERIDALEFHPSWHQLLARLRAEGL
FT                   HALPFSDPRPGAMAARCAGYFLHAQLESGSLCPLTMTFASIPVLQREPALFATLRDKLY
FT                   AREHDARDAPLPQKRSMMVGMGMTEKQGGSDVRSNETHAYPLGAGGRGQAYRLVGHKWF
FT                   FSAPQCDAHLVLARTAEQAGISCFYVPRFSPDGSKNAVHVQRLKDKLGNRSNASSEVEF
FT                   LNAYGVMIGDEGRGVPTIIEMANYTRLDCVIGSAALMRAALVQAIHHARHRSAFGRLLA
FT                   DQPLMRNVLADLALESEAATVLFMRLAHAFEEDAAARSPQARGWRRIVTPAAKFWVCKR
FT                   TLEFTGEAMEVWGGNGYVETGPMARFYREAPVNSIWEGSGNVMCIDVLRAIEREPDAAA
FT                   ALFDEWRDAARHSAPLAGALAELTRLLSLEPEPREACARRIAQRIALVAQASLLLRDGP
FT                   YAVAQAFVATRFGHDSSETGRVFGTLPATIDHAALVERAFPA"
FT   gene            423914..425557
FT                   /locus_tag="BURPS1710b_0411"
FT   CDS_pept        423914..425557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0411"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50435"
FT                   /db_xref="GOA:Q3JX78"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX78"
FT                   /protein_id="ABA50435.1"
FT                   /translation="MQYDYIIVGGGSGGASLAGRLADACPDATIALIEAGGHTERNLLV
FT                   NMPVGIAALVPFKLGTNYGYETVPQPGLGGRRGYQPRGRGLGGSSAINAMIYTRGHPLD
FT                   YDEWEQLGCTGWGWRDVLPYFRRAEGNARGANEWHGADGPLTVSDLRFRNPFSERFIAA
FT                   AHEAGYPLNDDFNGEHQEGVGFYQVTHRDGSRCSVARAYVYGRTRPNLHVIVDATVLRV
FT                   VFDGKRATGVEFARAGRTEQLAARAEVILSAGAFNTPQLLMCSGVGPAAQLRRHGVALV
FT                   HDAPDVGENLIDHIDFIINKRVNSSELVGICMRGIAKMTPALFSYLSGRRGMMTSNVAE
FT                   AGGFIKSEPGLDRPDLQLHFCTALVDDHNRNMHWGFGYSLHVCALRPKSRGNVALASGD
FT                   ARVAPLIDPRFFSDERDLDLLVTGAKAMRRILCAAPLASQGGRELYTDPGDTDAQLRAA
FT                   IVAHADTIYHPVGTCRMGTDARAVVDPQLRVKGVDGLRVVDASVMPTLIGGNTNAPTVM
FT                   IAERAADFIVAARNGQAAPTRERVAATHGG"
FT   gene            complement(425597..427630)
FT                   /locus_tag="BURPS1710b_0412"
FT   CDS_pept        complement(425597..427630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0412"
FT                   /product="Flagellar hook-length control protein, putative"
FT                   /note="identified by match to protein family HMM PF02120"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49854"
FT                   /db_xref="GOA:Q3JX77"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX77"
FT                   /protein_id="ABA49854.1"
FT                   /translation="MRSSTARSRCTRASNRSCSRAFANARRTRRASPRSMRCSNPKEAD
FT                   RHGSIVSAPAPARTRTGRPRHRGQAARPRAARAHRRAGAARRADALPRRIPRALRRIRA
FT                   IGHAGRQLAQLPGIPRYARRGDRAAAARARRRANAHRRGAPRVAGEKAHARLVRDPAGA
FT                   RRAAGRAARREARAARRRRTRGQGAAHARGRGQVSAPSNPNTRSDMPPLPLIGMLLGAA
FT                   STMIKSSAGAPGASSGDASSAAPFAQALKQSVQTQRQTGANADASNAGHAANAATADTA
FT                   AASSPASGAGDRTTASAGDTKASGKPDDQDDDKHAAQPASADAAALAAAASLQAQLQAR
FT                   PDAQAAQAAQAAAGATAAQAGAGDAAHPPATSAASAAAGDTDASAPAGAQQPIGDALNA
FT                   ALSKLTGAGRTGTAAVQGAQPAGRNGDASAPLAANGAAFDKLLAGAKAPAAQAAPTDAS
FT                   GANPATALANAAANAAPPDASGALAALQDAADSARATLAASSAPAALQQAAPAALAANA
FT                   SAAAAPAAPSLAPPVGTPDWTDALSQKVVFLSNAHQQSAELTLNPPDLGPLQVVLRVAD
FT                   NHAHALFVSQHAQVRDAVEAALPKLREAMEAGGLGLGSASVSDGGFASAQQQQTPQRQS
FT                   SDGSATRRAFGASTADAALDELAAASSGGAARRAVGMVDTFA"
FT   gene            complement(427039..427491)
FT                   /gene="fliJ"
FT                   /locus_tag="BURPS1710b_0413"
FT   CDS_pept        complement(427039..427491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="BURPS1710b_0413"
FT                   /product="flagellar export protein FliJ"
FT                   /note="identified by match to protein family HMM PF02050;
FT                   match to protein family HMM TIGR02473"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50938"
FT                   /db_xref="GOA:Q3JX76"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX76"
FT                   /protein_id="ABA50938.1"
FT                   /translation="MAQSFPLQLLLERAQDDLDTAAKQLGRAQRERTDAQAQLDALMRY
FT                   RDEYRVRFAESAQSGMPAGNWRNFQAFLDTLDAAIEQQRRVLAAAQTRIDAARPEWQAK
FT                   KRTLGSYEILQARGARQDAQRAAKREQRDADEHAAKVLRMRADAAK"
FT   gene            complement(427497..429077)
FT                   /gene="fliI"
FT                   /locus_tag="BURPS1710b_0414"
FT   CDS_pept        complement(427497..429077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="BURPS1710b_0414"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026; match to protein
FT                   family HMM TIGR02545"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47716"
FT                   /db_xref="GOA:Q3JX75"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX75"
FT                   /protein_id="ABA47716.1"
FT                   /translation="MVSDVCGGALGRDELDELDALERELALASRGPEHEDAAAHGDGFG
FT                   AHHHAPPRPLAMGAPSSRATLANPHLAHWRAHLDGIRERNARALPLRPCGRLTRAAGLV
FT                   LEAIGLRLSVGAECTIELPAGSALPYAQAEVVGFAGERLFLMPTTAVAGVLPGARVWPL
FT                   ESAPVADPLAGAKRLPVGWEMLGRVVDASGRPLDNLGPLASKVDAPLTAPSINPLDREP
FT                   IHHVLDVGVRAINGLLTVGRGQRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERG
FT                   REVKEFIEQILGEDGLARSVVVAAPADVSPLLRMQGAAYATTLAEYFRDQGKHVLLLMD
FT                   SLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTE
FT                   GDDQQDPIADSARAILDGHVVLSRSLAEAGHYPAIDIEASISRAMTALIDDAHLDRVRQ
FT                   FKQMLSRYQRNRDLIAVGAYAPGRDAQLDRAIALYPRIESFLQQGFRECAPYAPSLAAL
FT                   DALFESEGG"
FT   gene            complement(429071..429751)
FT                   /gene="fliH"
FT                   /locus_tag="BURPS1710b_0415"
FT   CDS_pept        complement(429071..429751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="BURPS1710b_0415"
FT                   /product="Flagellar assembly protein FliH"
FT                   /note="identified by match to protein family HMM PF02108"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47967"
FT                   /db_xref="GOA:Q3JX74"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX74"
FT                   /protein_id="ABA47967.1"
FT                   /translation="MSDRASASDKPVTAYQRWEMASFDPPPPPPPDDGGAAAAALAAEL
FT                   QRVRDAAHAEGLAAGHVEGQALGYQAGYEQGRAKGFDEGRAEAHTHAAQLAALAASFRD
FT                   ALAGVERDLADDIATLALEIAQQVVRQHVQHDPAALIAAAREVLAAEPALAGAPHLIVN
FT                   PADLPVVEAYLKDELDTLGWSVRTDTSIERGGCRAHASTGEIDATLATRWERVAAALGK
FT                   VSAW"
FT   gene            complement(429744..430739)
FT                   /gene="fliG"
FT                   /locus_tag="BURPS1710b_0416"
FT   CDS_pept        complement(429744..430739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="BURPS1710b_0416"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by match to protein family HMM PF01706;
FT                   match to protein family HMM TIGR00207"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48193"
FT                   /db_xref="GOA:Q3JX73"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX73"
FT                   /protein_id="ABA48193.1"
FT                   /translation="MNAEGLNKSALLLMSIGEEEAAQVFKFLAPREVQKIGAAMAALKN
FT                   VTREQVEDVLNDFVQEAEKHTALSLDSSEYIRTVLTKALGEDKAGVLIDRILQGSDTSG
FT                   IEGLKWMDSAAVAELIKNEHPQIIATILVHLDRDQASEIASCFTERLRNDVLLRIATLD
FT                   GIQPTALRELDDVLTGLLSGSDNLKRAPMGGIRTAAEILNFMTSVHEEAVIENVKQYDP
FT                   DLAQKIIDQMFVFENLLDLEDRAIQLLLKEVESEALIIALKGAPPALRQKFLSNMSQRA
FT                   AELLAEDLDARGPVRVSEVETQQRKILQVVRNLAESGQIVIGGKAEDAYV"
FT   gene            complement(430729..432612)
FT                   /gene="fliF"
FT                   /locus_tag="BURPS1710b_0417"
FT   CDS_pept        complement(430729..432612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="BURPS1710b_0417"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50977"
FT                   /db_xref="GOA:Q3JX72"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX72"
FT                   /protein_id="ABA50977.1"
FT                   /translation="MTALRIIAPCQCPPALPSRHSARSGDTRRMDSQANSLINPDARSS
FT                   LAGASPQAAAAAGALPGAAAGGADFGLGGFAERIPGLSRMKTNPRLPFLIGAALAIAAI
FT                   VALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRL
FT                   KLAAMGLPKGGSVGFELMDNQKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHL
FT                   AIPKPSVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQD
FT                   GNLLTQTASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIE
FT                   QTSESYGPNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQP
FT                   AGPAATPVSDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQP
FT                   LAADKLAQVQQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDI
FT                   AKWLGVAAAAAALYFMFVRPALRRAFPPPAEPAAAAVPALDGPDDMLALDGLPSPDKKQ
FT                   LAEEDEEHPALLAFENERNRYERNLDYARTIARQDPKIVATVVKNWVSDER"
FT   gene            432588..433115
FT                   /gene="fliE"
FT                   /locus_tag="BURPS1710b_0418"
FT   CDS_pept        432588..433115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="BURPS1710b_0418"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /note="identified by match to protein family HMM PF02049;
FT                   match to protein family HMM TIGR00205"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48447"
FT                   /db_xref="GOA:Q3JX71"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX71"
FT                   /protein_id="ABA48447.1"
FT                   /translation="MRLSAARSSPIGRIERGFGRTSAAAAAARLLCFFAIRLLQRSRDA
FT                   GVPPAGPARPGFFCGDHMVAPVNGIASALQQMQAMAAQAAGGASPATSLAGSGAASAGS
FT                   FASAMKASLDKISGDQQKALGEAHAFEIGAQNVSLNDVMVDMQKANIGFQFGLQVRNKL
FT                   VSAYNEIMQMSV"
FT   gene            433248..433682
FT                   /gene="fliS"
FT                   /locus_tag="BURPS1710b_0419"
FT   CDS_pept        433248..433682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BURPS1710b_0419"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49678"
FT                   /db_xref="GOA:Q3JX70"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX70"
FT                   /protein_id="ABA49678.1"
FT                   /translation="MFTPGHAGASAYARVGVETGVMGASPHRLIAMLYQGARQAIAHAR
FT                   LHLQQGNVAARGEAIGKAIRIVESGLQQALNLEVGGDIASRLDSLYTYMCRRLLQANVD
FT                   ASEPMLIEVDGLLATLEDAWTGIAPEVARMNAQAVTEQAR"
FT   gene            434115..435617
FT                   /locus_tag="BURPS1710b_0420"
FT   CDS_pept        434115..435617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51123"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX69"
FT                   /protein_id="ABA51123.1"
FT                   /translation="MTGIDTAAAAILASRIDSLLDAIQPAAGGAAAPQVGTSGAPPASA
FT                   APRPAASGPPPASAQTALSEVGLTLDAISRYGGAATPAVVGAAPLLPAAPTAVAAQAAS
FT                   LDPLLATPDARAGNPAAATAPGAQAAQAAPQAALPASPAAALSLALVQAVAQSGLFYES
FT                   HLAQWLAGQRTTAELAREPQARLASGAEPDAQAGAQPGQMGDALDDALADLLAVRLPLP
FT                   QGGRDAPARGAARPPGQPAGGADEGAAASGRAPTNAAAPARSVDAYAALADADGKPGAP
FT                   SAQTALARAGMPPTGADTPASIAASLHAATLPIVRQQLDLLATDQFRWIGEAWPGARLD
FT                   WTIEPDEQHGRERPAPDADFPDARGWRTRLTLALPSLGTIDAELVLNGEQLAARLRASE
FT                   AGAARLAPHGEALRARLQALGLQVSGLSIRAIDGVPDSFDAAAARAAASAYARAAAGGE
FT                   AVAKDGFGGAAGATGGAGGAGVEHRASSSSPVETDDDWEFAQ"
FT   gene            435614..435931
FT                   /locus_tag="BURPS1710b_0421"
FT   CDS_pept        435614..435931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0421"
FT                   /product="flagellar biosynthetic protein FlhB domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47941"
FT                   /db_xref="GOA:Q3JX68"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX68"
FT                   /protein_id="ABA47941.1"
FT                   /translation="MSGPPRKRAAVLAYDAKGGDTAPRVVAKGYGLVAERIIERARDAG
FT                   LYVHTAPEMVSLLMQVDLDARIPPQLYQAVAELLAWLYALERDAGDGGGAQPAFPPLPK
FT                   R"
FT   gene            436124..436870
FT                   /locus_tag="BURPS1710b_0422"
FT   CDS_pept        436124..436870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0422"
FT                   /product="PepSY-associated TM helix family"
FT                   /note="identified by match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47548"
FT                   /db_xref="GOA:Q3JX67"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX67"
FT                   /protein_id="ABA47548.1"
FT                   /translation="MFCANGSRSVNAPESIEKHSGVVVPYPGSPRKLDAFELAERRRRS
FT                   RRATFIKWLRKVHGWVGLWGAALGLLFGVTGVLLNHRAPPLKISSGEPQVSQLQLALPS
FT                   PAPATPHAMAAWIRRELAFDGRLGRVRKEPAQPVAWGGRRVEQPEHWQFGLFGPRSNVQ
FT                   VEYWKGNGYVSVKRTDNAFLTALNNLHRGVGMNLFWVLLMDTIAGSMVLLSLTGVLLWT
FT                   ELNKRRTVGVVLVAGSVAAALAAGLT"
FT   gene            complement(436967..437983)
FT                   /locus_tag="BURPS1710b_0423"
FT   CDS_pept        complement(436967..437983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0423"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48594"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX66"
FT                   /protein_id="ABA48594.1"
FT                   /translation="MDLEVLRTSARWLDEGRRALLVTVVRTWGSSPRPEGAMLAVRDDG
FT                   LVVGSVSGGCIEDDLIARVQASGVAHWTRPEAVKYGVTAEEAHRFGLPCGGTIELVLEP
FT                   LTPASGIAALCDALEHGRLVTRTLALATGEATLASASATDGLHFDGARLVTVHGPRYRM
FT                   LVIGAGQLSRYLCQIAAGLDYQVTVCDPREAYTDAWDVPGTRIVRTMPDDTVLDMRLDR
FT                   RSAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNSQARRERLREFDLSAAELARLR
FT                   GPAGIYIGSRTPPEIAVSILAEVTAAKNGVSLPTILQVEGAKAAREIEANSGVACGM"
FT   gene            complement(438191..439594)
FT                   /locus_tag="BURPS1710b_0424"
FT   CDS_pept        complement(438191..439594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0424"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49613"
FT                   /db_xref="GOA:Q3JX65"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX65"
FT                   /protein_id="ABA49613.1"
FT                   /translation="MSLFRKKNVDRMIAGAQAAGLKKALGAVDLTFLGIGAIIGTGIFV
FT                   LTGTGAVQAGPALMLSFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWI
FT                   IGWDLMLEYGLAASAVSVGWSGYLQSLLQGFGVSLPTALTAAPGALPGVVTYFNLPAFV
FT                   VMLVITTLLSIGIRESTRVNNIMVFIKVAVVLLVIAVGVFHVTPANWKPFMPHGWNGVF
FT                   GAAAVMFFAFIGFDAVSSAAEEVKNPKRDLPVGIIASLGVCAFLYVAVAAIATGIVPWA
FT                   QYANVSHPISYALQVAGEKWVAGFIDLGAVIGMLTVILVMSYGQTRIIFAMSRDGLLPA
FT                   ALSRVHPRFATPFLTTWLVGLFFGLIAALIPLNVLAELINIGTLAAFSMVSIAVLVLRR
FT                   THPDLPRAFRCPGVPLVPILAVAACLFLMLNLQPVTWIAFLTWLVIGLFVYFAYSRSRS
FT                   KLAHGAQQH"
FT   gene            complement(439836..440492)
FT                   /gene="vsrD"
FT                   /locus_tag="BURPS1710b_0425"
FT   CDS_pept        complement(439836..440492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsrD"
FT                   /locus_tag="BURPS1710b_0425"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50666"
FT                   /db_xref="GOA:Q3JX64"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX64"
FT                   /protein_id="ABA50666.1"
FT                   /translation="MSLQILLVDDHAIVRQGIRQLLIDRGIAREVKEAECGGDALVIAE
FT                   KSEFDVILLDISLPDMNGIEVLKRLKRRLPSTPVLMFSMYREDQFAVRALKAGAAGYLS
FT                   KTVNAAQMVSAISQVAAGRKYVSPAMAEALAEYVSFENEPLPHEKLSDREYQTLCMIAS
FT                   GKRLTDIAHALSLSVKTVSVYRTRLLEKMKLSNNAELTFYVMSNRLVDMNPAIGA"
FT   gene            complement(440489..441343)
FT                   /locus_tag="BURPS1710b_0426"
FT   CDS_pept        complement(440489..441343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0426"
FT                   /product="sensor kinase protein, putative"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48307"
FT                   /db_xref="GOA:Q3JX63"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX63"
FT                   /protein_id="ABA48307.1"
FT                   /translation="MDTPSVAPSIASAPASSSSGLAPEVGIPFVSRCASRAPTAERLGA
FT                   RVAQLSAELVAADESARRHLAGELHDGLGADLTAARFALANVETWLPDDAPDAARRALA
FT                   LAQQALDAATAANRRLIDGLRTPALEAGLVGTLAAWIGAHGARTGLRTSFVCAADARVT
FT                   QLSADGALAVFRVAQEALANVAKHAHASAADVRIDVDDTHLSLVVTDDGVGVGVGAAAA
FT                   RRRGGYGLGSMRARCEALGGTLELASPRAGGAGTALRARFAWHALIAARMPAAARKVRK
FT                   EAR"
FT   gene            complement(441757..442572)
FT                   /gene="fpr"
FT                   /locus_tag="BURPS1710b_0427"
FT   CDS_pept        complement(441757..442572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="BURPS1710b_0427"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49148"
FT                   /db_xref="GOA:Q3JX62"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX62"
FT                   /protein_id="ABA49148.1"
FT                   /translation="MGPFWGPLYASVSESMSKFDTATVLSVHHWTDTLFSFTCTRDQAL
FT                   RFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPV
FT                   LIGKKPTGTLVADNLLPGKTLWLLSTGTGLAPFMSIIRDPDIYERFEKVVLTHTCRLKG
FT                   ELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTREEFENEGRITDLIASGKLFTDLDVP
FT                   PFSPERDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD"
FT   gene            complement(442740..443393)
FT                   /locus_tag="BURPS1710b_0428"
FT   CDS_pept        complement(442740..443393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0428"
FT                   /product="LysE type translocator"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48629"
FT                   /db_xref="GOA:Q3JX61"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX61"
FT                   /protein_id="ABA48629.1"
FT                   /translation="MNLLPILLQIAAVYLVALVTPGPNIFMISQLSLSGRRGLGAVSAL
FT                   GVGTASLTWATLAMLGVAAVLHQLAWLYEAIRIGGAVYLAYFGIKLLRASAQRDPAPAA
FT                   GLADDAGALPSPPATRDYLRAYRTGLFTCLTNPKSCVFWTSVFAAMMPAHVPLWFSGAT
FT                   LLTIGAMSGGWYCGVAYLFANPRAQRGYRRVRRPLDALCGAALVGLGAKLAADR"
FT   gene            complement(443459..444271)
FT                   /locus_tag="BURPS1710b_0429"
FT   CDS_pept        complement(443459..444271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0429"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49878"
FT                   /db_xref="GOA:Q3JX60"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX60"
FT                   /protein_id="ABA49878.1"
FT                   /translation="MHVPQTAPLAEPLPVADEITAVSWNLHKGRSPLGFTAWEAMRSWV
FT                   ASTHADVYFLQEAMARRMPRPVLAAGFGAPMAEPVDDIWHCQATEIARALDWQIALGPN
FT                   VFKPSWRHGNAILSPHPLDLGGRWDISAHRFERRGLLVARATLAGGAPVTLLCAHLALT
FT                   RAARLRQMHWIAHWIERNARTGPLVLAGDFNDWRNDSIPLFGEIGLSEVATLLGESGRT
FT                   FPAFSPALALDKMFVRGMTPLEWRAPGDETAWLSDHLPYVARLRLDPA"
FT   gene            443498..445048
FT                   /locus_tag="BURPS1710b_0430"
FT   CDS_pept        443498..445048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX59"
FT                   /protein_id="ABA47763.1"
FT                   /translation="MVGQPRGLVAGRAPFERRHAAHEHLVERERGRERRERAARLAEQR
FT                   RHFRQADLAEQRDRIVAPVVEVAREHERPRARVALDPVRDPVHLPQPRGAREREMRAQQ
FT                   RHGRAAGERRARDEQAAALEAVRGDVPAAAEIERMRRQDRVAVPPGRLEHVRPERDLPV
FT                   ERARDLGRLAMPDVVDGLRHRRAEARREHRPRHAPRHRFLQEIDVRVGRRHPTAHRFPR
FT                   GEAERRAPLVQIPADRCDFVGDGQRLGERRGLGNVHGRSVLDDACAHAVDELRVALGER
FT                   PVGPLRGARVQARMACDDPPRQRKRAWRAGGRRRAFVGERFLRVDRERDRAVLDVQRRD
FT                   GDRARQAGAGSIGRRRGRGCRGAARRRRDGQAVRVRAGLADGGLLLERIDRLAVAYHLD
FT                   LPIDHGLRRALRMRGAGKRAREAGFKHEFSGAGGPGGGTGEHLALKRNHRTSDRAGLCS
FT                   VQLSHAAPLSGTSTTCARRADFSSVGRRGKRARRRRGRPMRRRRARRRTANGGAKRTT"
FT   gene            complement(444278..444688)
FT                   /locus_tag="BURPS1710b_0431"
FT   CDS_pept        complement(444278..444688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48822"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX58"
FT                   /protein_id="ABA48822.1"
FT                   /translation="MVRDGQTIDAFEQKTTVGQARSDTHSLPIAPAAGCAATSAAASAA
FT                   DAPGSGLSRTITVAPLYVEDGAVALAIDAQETLADERATPPAGAPCTFALPRRIVASHP
FT                   GLNARAAQWTDWTLAERNPQLVYRVRARVVED"
FT   gene            444865..445056
FT                   /locus_tag="BURPS1710b_0432"
FT   CDS_pept        444865..445056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0432"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50450"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX57"
FT                   /protein_id="ABA50450.1"
FT                   /translation="MLGSTFARGAVIGNIDDMCATRGFFKRRAARQTGAATARAADAAA
FT                   PRTAADREWRREAHDVNS"
FT   gene            445202..446182
FT                   /gene="lon1"
FT                   /locus_tag="BURPS1710b_0433"
FT   CDS_pept        445202..446182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon1"
FT                   /locus_tag="BURPS1710b_0433"
FT                   /product="ATP-dependent protease domain protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48187"
FT                   /db_xref="GOA:Q3JX56"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX56"
FT                   /protein_id="ABA48187.1"
FT                   /translation="MTTAMVKQELAVASFSTVYDIERIETALNDLNEGASDALRATYEK
FT                   MLKTGNLRFCVKPTRMPAFDSLAQALPNFAEPLDDVRKQVALCLETDDRLELMPILLLG
FT                   EPGIGKTHFAKALAKMLGTAYHYVPMSSLTAGWVLSGASSQWKNAKPGKVFDALVNGCY
FT                   SNPVIAIDEIDKAGSDAQYDPLGALYALLEHDTASAFVDEFAEVPIDAGNVIWIATAND
FT                   ASAIPEPIMNRMNVYEIEPPDASGARRIAQTIYGEIRNAHAWGQRFPAALGDDALDVLA
FT                   AMPPRTMRRVLLHAFGAARLDGRDAVAPRDIRTDESAGRRRPIGF"
FT   gene            446254..447375
FT                   /locus_tag="BURPS1710b_0434"
FT   CDS_pept        446254..447375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0434"
FT                   /product="oxidoreductase, FAD-binding family protein"
FT                   /EC_number="1.2.1.19"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49281"
FT                   /db_xref="GOA:Q3JX55"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX55"
FT                   /protein_id="ABA49281.1"
FT                   /translation="MTIERIDCVVIGAGVVGLAIARELAARGRETLILEAADAIGTGMS
FT                   SRNSEVIHAGLYYPRGSLKASLCLHGRDLLYDFCETHGVPHRRCGKLVVATSPAQAKQL
FT                   KAIAARAEENGVLDLLTLSRDEVQALEPELECLEALFSPSTGIIDSHQLMLALLGDAER
FT                   DGASCALRSPVESIDAAGGRFVVRTGGEAPAAIAAACVINSAGLDAQALAKRIRGLDSR
FT                   WVPPLYLARGNYFSLSGRAPFAHLVYPVPDRAGLGVHLTLDLAGDARFGPDVEWIDALR
FT                   YDVDPRRAESFCTSIRAYWPGLPEGSLRPAYAGIRAKVSGPGEPAADFVIQGTAQHGVR
FT                   GLVNLFGIESPGLTAALAIAQRVGDMAARTRHT"
FT   gene            447510..447824
FT                   /gene="hpiS"
FT                   /locus_tag="BURPS1710b_0435"
FT   CDS_pept        447510..447824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpiS"
FT                   /locus_tag="BURPS1710b_0435"
FT                   /product="high potential iron-sulfur protein precursor"
FT                   /note="HiPIP; identified by match to protein family HMM
FT                   PF01355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48294"
FT                   /db_xref="GOA:Q3JX54"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX54"
FT                   /protein_id="ABA48294.1"
FT                   /translation="MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGY
FT                   KADATKVDKAKFPKYAAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA
FT                   "
FT   gene            448057..449349
FT                   /locus_tag="BURPS1710b_0436"
FT   CDS_pept        448057..449349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0436"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47640"
FT                   /db_xref="GOA:Q3JX53"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX53"
FT                   /protein_id="ABA47640.1"
FT                   /translation="MASIAASTKTAGQVLNRRAVVAAVIGNALEWYDFTVFSFMTVVIA
FT                   QLFFPTSSEYSSLLLTTATFGVAFFMRPIGGIVLGLYADRAGRKAALSLVILLMTFGIF
FT                   LIAVAPPYAAIGIGGPLLIVLGRLLQGFSAGGEFGSATALLIEAAPLSRRGYYGSWQMA
FT                   SQAAALLFGSLVGAAVTRGLSTEALHAWGWRVPFLIGLVIGPVGFYVRRHLVDSEAFLQ
FT                   ARERGEHVTLGEVFARHGRAVVCGLGAVIALTVTVYVLISYLPTFAVKQLKLPYAQSFY
FT                   AVIIGNLLLTALSPVAGAWSDRIGRKGLSLWALGLTLVMIYPLFAWLDASPSIARLIAV
FT                   QAMLSVTLAGYYGPFGAMIAELFPANVRSTGLSLAYNVAVMVFGGFGQFIVTWLIKTTG
FT                   TPLAPTYYVMAGLALSLVALAFVPAERDALD"
FT   gene            449678..451402
FT                   /gene="dppA"
FT                   /locus_tag="BURPS1710b_0437"
FT   CDS_pept        449678..451402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="BURPS1710b_0437"
FT                   /product="dipeptide ABC transporter, periplasmic
FT                   didpeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50993"
FT                   /db_xref="GOA:Q3JX52"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX52"
FT                   /protein_id="ABA50993.1"
FT                   /translation="MVFSPACSSYESSSNIRLRRPRPALNRRPGGNMEHNRLLRALRAT
FT                   AIAGVAAASFGIAGSAFAQIPNKTLVYCSEGSPAGFDSAQFTTGVDFTASTFPIYNRLV
FT                   EFERGGTKVEPGLAEKWDISADGKVYTFHLRHGVKFHTTDFFKPTREFNADDVAFTFER
FT                   MLDPNQAFRKAYPVSFPYFTDMGLDKLIVKIEKLDPYTVRFTLKEPNAPFIQNLAMEFA
FT                   SILSAEYADQLMKAGKAADINQKPIGTGPFIFRSYTKDATIRFDGNPDYWKKGAVKISK
FT                   LIFSITPDPGVRVQKIKRNECQVMSYPRPADIATLKADSNVDMPSLPGFNLGYLAYNVQ
FT                   HKPVDKLEVRQALDMAINKKAILESVYQGAGQAASAPMPPTQWSYDKNLKAAAYDPAKA
FT                   KALLAKAGYPNGFPITLWAMPVQRPYNPNAKLMAEMIQADWAKIGVQAKIVTYEWGEYI
FT                   KRAHAGEHDTMLIGWNGDNGDPDNWLGTLLGCEAVKGNNFSEWCYKPFDELIQKGRVTT
FT                   SQDGRTKIYMQAQQIFAQQLPFSPIANSTVYQPVRKNIVDMRIEPLGYARFDGVSVK"
FT   gene            451514..452524
FT                   /gene="dppB"
FT                   /locus_tag="BURPS1710b_0438"
FT   CDS_pept        451514..452524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="BURPS1710b_0438"
FT                   /product="dipeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49970"
FT                   /db_xref="GOA:Q3JX51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX51"
FT                   /protein_id="ABA49970.1"
FT                   /translation="MFRFVLRRVGMVIPTFIGITVLAFALIHLIPGDPIEVMMGERGVD
FT                   PTMHAQALHRLGLDEPLPMQYLHYVGRALHGDLGTSIITNTSVMGEFLARFPATVELSL
FT                   CALAFALALGLPAGVFAALRRGTIVDHGVMGTALTGYSMPIFWWGLILIMVFSATLGWT
FT                   PVSGRIAVEYEIPHTTGFMLIDTLLSGEEGAFASAVSHLILPAIVLGTIPLAVIARMTR
FT                   SSMLEVLREDYIRTARAKGLSPARIVVVHALRNALIPVVTVIGLQVGTLLAGAVLTETL
FT                   FSWPGVGKWLIDAIGRRDYPVVQGGILMIATLVIVVNLVVDLLYGVLNPRIRHTR"
FT   gene            452623..453540
FT                   /gene="dppC"
FT                   /locus_tag="BURPS1710b_0439"
FT   CDS_pept        452623..453540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="BURPS1710b_0439"
FT                   /product="dipeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47935"
FT                   /db_xref="GOA:Q3JX50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX50"
FT                   /protein_id="ABA47935.1"
FT                   /translation="MSNMQNAMPSQAAPASGRVLALREFWANFSRNRGAVGAGIVVLAL
FT                   VAVALLAPVLAPHSPIEQYRDYVKIPPAWLAGGNWQFVLGTDEAGRDILSRLMYGARMS
FT                   FWIGFVSVVLALIPGVVLGLVAAFFQKWADTPVMRVMDVLLALPSLLLAVAVVAIIGPG
FT                   LTNTMFAIAIVALPAYVRLTRASALGELQKEYVTASRVAGAGTPRLMFSQVLPNCTAPL
FT                   IVQATLGFSSAILDAAALGFLGLGVQPPTAEWGAMLASARDYIDNAWWIVTMPGLSILI
FT                   SVLAINLLGDGLRDALDPKLKRMA"
FT   gene            453542..454534
FT                   /gene="dppD"
FT                   /locus_tag="BURPS1710b_0440"
FT   CDS_pept        453542..454534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="BURPS1710b_0440"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48578"
FT                   /db_xref="GOA:Q3JX49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX49"
FT                   /protein_id="ABA48578.1"
FT                   /translation="MSDLLTIRNLAVNFSGLPAVDRINLSIARGEVVGVVGESGSGKSV
FT                   TMMALMGLIDAPGIVTADEVTFDGVDLLKASAKARRRIIGKDVAMVFQDALTSLNPSYT
FT                   VGYQIKEVLKLHEGLRGDALNKRALELLDQVGIPDARNRIGTFPHQMSGGMNQRVMIAM
FT                   AVACNPKLLIADEPTTALDVTIQAQIMDLLVTLQKERGMALVLISHDLAVVSEVAQRVA
FT                   VMYAGEIIETNRVPDIFAHPHHPYTEALLAAIPEHNAGAKRLAALPGMVPGRDDRPSGC
FT                   LFAPRCKYVVDDCMKARPTLAELAPGTGMRARCIKPLNLEAPHTQGGAR"
FT   gene            complement(454270..455775)
FT                   /locus_tag="BURPS1710b_0441"
FT   CDS_pept        complement(454270..455775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX48"
FT                   /protein_id="ABA48973.1"
FT                   /translation="MPGAGIGACGSGAAATLPAASAPAGGHASPPVAHAPASTALASER
FT                   ARQRRGARAACVAARRTPLRERRAASRAATASGIRLPHLLGAMAGDKPAVDVAQLRLLD
FT                   AAPLDRVRAALMERAAGRRVERRRHLALQLDLDLAIRLEDRGRRRHQRARVRVPRPRVD
FT                   RLLVAELRDAAEVHHHHIVGDVLDDREVVRDEHVARFELLLQIHEEIQDLRLDRHVERG
FT                   HRLVGDDDLRIEDHRARDRDALALPAREHVRIALRVLGAQAHRAHDLRDALRALGGREP
FT                   RVDRERLGKRLLDRLARIERGERILEHHLHAAAQRGDRLPVRARDVAAVDRQVPRARRL
FT                   DHRELPRERRLAAAGFADDGERLAAREGERHAVQRLHGAVAEHPAPHRVVLRELVGHQH
FT                   HVVARGGFARFVDCVHRAPPCVCGASRLRGLMQRARMPVPGASSASVGRAFMQSSTTYL
FT                   QRGANRHPLGRSSRPGTIPGSAASRFAPALCSGIAASNASVYG"
FT   gene            454531..455547
FT                   /gene="dppF"
FT                   /locus_tag="BURPS1710b_0442"
FT   CDS_pept        454531..455547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="BURPS1710b_0442"
FT                   /product="dipeptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49633"
FT                   /db_xref="GOA:Q3JX47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX47"
FT                   /protein_id="ABA49633.1"
FT                   /translation="MNAVHETRESAARNDVVLVADQLAKHYAVRRGMFGHGTVKALNGV
FT                   SFSLARGKTLAVVGESGCGKSTLARQLTMIEPPSAGHLSIDGRDVAGADRETVAALRRR
FT                   VQMVFQNPFASLNPRKTVEQTLAEPLAINTRLTAAERAQRIAQIMRTVGLRPEHAKRYP
FT                   HMFSGGQRQRVAIARAMILDPQIVVADEPVSALDVSIQAQILNLFMDLQEQFKTSYVFI
FT                   SHNLSVVEHIADDVMVMYFGSVAELGDKKTIYARPRHPYTRALMSATPAIFEADRKIQI
FT                   KLQGEMPSPLNPPSGCAFHQRCPYAVERCRVEEPKLRDVDGRLVACHRAEEVGEANA"
FT   gene            455540..456688
FT                   /locus_tag="BURPS1710b_0443"
FT   CDS_pept        455540..456688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0443"
FT                   /product="GumN family protein"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51098"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX46"
FT                   /protein_id="ABA51098.1"
FT                   /translation="MPEAVAAREAARRSRNGVRRAATHAARAPRRWRARSLASAVLAGA
FT                   CATGGLAWPPAGALAAGSVAAAPLPQAPIPAPGMSLPGFHAPPPSTSNGTVASGAVRTQ
FT                   PARMPFYVATKGKVTIYVLGTLHVGDPADYPANQPFRRPILAALAASPTLALELSPDDL
FT                   LESQDDVSKYGVCNYACLPRLLPPPLWQKLANRLRGNPAALAGIRNMRPWLASLVVETY
FT                   DSLSAGLQTEYGTEAQLQNVFLRKKGGKVVGLETLAEQMRAFTGLTLAQQREMLAQDMV
FT                   QTPAQNAADVRALHRLWRIGDADAIAAWANAKTERLARARSIADSIDNKIVYERNRRFV
FT                   ARMTAIAAPNRPLFVAIGSLHLGGPKGVLELLRQQGYRVDAG"
FT   gene            456888..458564
FT                   /locus_tag="BURPS1710b_0445"
FT   CDS_pept        456888..458564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50007"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX45"
FT                   /protein_id="ABA50007.1"
FT                   /translation="MPARFRRAGSGCLHARRGQHHNKPPCRHVRPFDGRSAVRPGQADA
FT                   GGGGRIFHLERRVRARRCAAVGRRAARIGRPIEAKAPEGAFFMAARARSPKHQNIQQDD
FT                   VRREQRERGGKLHLDHAVLVGQFEQRGGHHVEVRGHRRHQRAAVAGEHPDRDHHGRIAM
FT                   EHVDEDRHADAARHHGERGEAVAHHHREERHADAVHGDRDEPVVEVHVRGGHVGDRLAD
FT                   ARVREHQPEHAEHLRQHGRPRQRVDQPPRLLQRLADRIARDPAREPEGDHAADAETDQR
FT                   DVLRIDERRAADVQMAGREGDRDRHERDRERRHEQPVADARGARAARIVGRQLRSRRRH
FT                   AAETRDQRHHDHERADELDGQLVADEEDERVQQPEAARGEAARVRAVRDDRRAHREQHE
FT                   ADEPEQVTDRERHARPPLSAAAFAPFEAACGAALARSSRSSRRSSSHSRAPWITNADTA
FT                   VGMPHSATRIGSTAMPASFRNVTISTIAPNATKISSPKKRPTLSVAAAYARSRWRIASG
FT                   SGPKRFSVAPSAIGAISGRTICGWPPRPVRPTAAVSSRTSR"
FT   gene            complement(457167..458123)
FT                   /locus_tag="BURPS1710b_0444"
FT   CDS_pept        complement(457167..458123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0444"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF06166"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47461"
FT                   /db_xref="GOA:Q3JX44"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX44"
FT                   /protein_id="ABA47461.1"
FT                   /translation="MTLTIGYLFWLVGLVLLAVGATIVTDRAHPRRFTAGGFWLLYALV
FT                   FLVGDKLPVELVGALVIVMALIAGFGGVTAARPKLPSDDARRASAARIGNRLFVPALTI
FT                   PFVTVAITLAASHLHVGGAPLVDPKNVTLIGFGIGCVIALGFACWITRDSVGQSLQEAR
FT                   RLIDALSWAAVLPQMLGMLGLVFSDAGVGKAVAHVTTAYVNLDYRLIAVAVYCIGMALF
FT                   TMVMGNGFAAFPVMTGGVGVPILVDVFHGDPAVMVAIGMFSGYCGTLMTPMAANFNMVP
FT                   AALLELPDKNGVIKVQFPTALALLATNIVLLNVLMFR"
FT   gene            complement(458120..459136)
FT                   /locus_tag="BURPS1710b_0446"
FT   CDS_pept        complement(458120..459136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0446"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49220"
FT                   /db_xref="GOA:Q3JX43"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX43"
FT                   /protein_id="ABA49220.1"
FT                   /translation="MTSCTRRAVPAARTIRRHGEGRRAPRPARQPAPSPGSGARARRTR
FT                   ARPAVPSGRQSREGPSARRPRADRKPPRAARRRRASTHVRRMFMQGTVSLWPLIGVAVI
FT                   VVGFALRFNPMLIVATAAIVTAASAHFPPERILAAIGAGFLKTRNIPLIILLPLAVIGL
FT                   LERHGLRERAQAWIASIRAATAGRLLILYLLVRELTAAVGLTGLGGHPQMVRPLIAPMA
FT                   EGATENRFGPLPDAIRHRLRAYAAATDNVGLFFGEDIFVAFGAIVLMVTFLKEAGIAVE
FT                   PMRVALWGIPTAVSAFVIHGARLWLLDRRLERELRASAAPHAASNGANAAADNGGRA"
FT   gene            complement(459482..460270)
FT                   /locus_tag="BURPS1710b_0447"
FT   CDS_pept        complement(459482..460270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0447"
FT                   /product="LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50675"
FT                   /db_xref="GOA:Q3JX42"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX42"
FT                   /protein_id="ABA50675.1"
FT                   /translation="MNALGTNVMEIDLNADLGEGCGSDEALLDLVTSANIACGWHAGGA
FT                   QAMRDCVRWAVEKGVSIGAHPSFHDPENFGRKEMDLPASEIYAGVLYQLGALSAIAQAE
FT                   GGRIAHVKPHGALYNQAAREPEIADAVVSAIHDFDPSLAVFGLAKSGFVDAARQAGLVA
FT                   VEEVFADRGYRADGSLVPRSQPGALVDDENEMLARTLEMVRGQRVRAVTGEWVPLNAQT
FT                   VCLHGDGPHALAFAKRIRDALEAAGIDVHAPGALHAGERA"
FT   gene            complement(460305..461384)
FT                   /locus_tag="BURPS1710b_0448"
FT   CDS_pept        complement(460305..461384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0448"
FT                   /product="urea amidolyase homolog"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50800"
FT                   /db_xref="GOA:Q3JX41"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX41"
FT                   /protein_id="ABA50800.1"
FT                   /translation="MNSRQATGGIEVLRAGPLSTIQDLGRRGYRHLGVAQSGALDSLAL
FT                   EVGNRLVGNRPDAAAIEITLGPASFRFPRATRIAITGTEFGATLDGAPIYSWWSVPVAA
FT                   GQTLSLPVAKRGMRGYLCIAGGIDVLPMLGSRSTDLASRFGGLGGRVLRDGDRLPTGAP
FT                   PAGAPACVAPDAPEFGVKAPAWCAFARVDEAPRRHKHAHAVWAMPVRVLPGPQYASFTA
FT                   AAKHAFWDEEWIVTPNSNRMGYRLAGVKLERAESADLLSHAVLPGTIQVPGNGQPIVLM
FT                   NDAQTTGGYPRIGAVIRADLWKLAQARLNLPIRFVRVTDKAARDALAAERAYLRQIDIA
FT                   IEMHEEALQRALAARAAAA"
FT   gene            complement(461381..462151)
FT                   /locus_tag="BURPS1710b_0449"
FT   CDS_pept        complement(461381..462151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0449"
FT                   /product="conserved hypothetical protein TIGR00370,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02682;
FT                   match to protein family HMM TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50745"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX40"
FT                   /protein_id="ABA50745.1"
FT                   /translation="MYAKVVRATPRQIFLARSYRHFIDNVFFTRLNAVCFPSMTTPRIY
FT                   PLGDTALVCEAPPPATLECQRRVWAVASAAAGWPHVVDVVPGMNNLTIVFDPLETTADT
FT                   LAPLMKAAWRDADGVAESGREIEIPVEYGGAFGPDLDAVARHTGLARDEVVRRHAAGTY
FT                   VVFFLGFQPGFTYMGGLDGSLHTPRRAAPRLEVPAGSVGIGGEQTGIYPAAAPGGWQLI
FT                   GRTPLALFDPARTPPTLLQPGDRVRFIVAGVHAG"
FT   gene            462187..462699
FT                   /locus_tag="BURPS1710b_0450"
FT   CDS_pept        462187..462699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49420"
FT                   /db_xref="GOA:Q3JX39"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX39"
FT                   /protein_id="ABA49420.1"
FT                   /translation="MQRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMA
FT                   AAGAKDMTAVEVSLLHHVSHRDRKKKLADICFVLNIEDTHVATYALRKLVARGYVKSEK
FT                   TGKEVFFDATDAGRALCLRYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTA
FT                   ARAAASL"
FT   gene            462902..463546
FT                   /locus_tag="BURPS1710b_0451"
FT   CDS_pept        462902..463546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX38"
FT                   /protein_id="ABA49138.1"
FT                   /translation="MTARGDAPAAAALCGSIVRPIEPRLGDDPVERQIVRFARQLAHAA
FT                   RVVCDAHRHGRRRARPCGERAVVIAAAVAEPEAAVIEADARNQQQLRHEPRARRGLGNP
FT                   VAALAHRRIGRPRMEFERRAGLADHGQRGLPARVAGEPRRDRIARVEFARQRPVEADRA
FT                   RRALRENREHAPRERVVRARRALRVEAAPSKRFAQRALRIRRRGACYAFAH"
FT   gene            complement(462947..463543)
FT                   /locus_tag="BURPS1710b_0452"
FT   CDS_pept        complement(462947..463543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0452"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48490"
FT                   /db_xref="GOA:Q3JX37"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX37"
FT                   /protein_id="ABA48490.1"
FT                   /translation="MSESIARAPAPNPKRTLRETLARRRLDAQRAPRAHDALARRVLAI
FT                   LAQCAPRTVGFYWPLPGEFDARDAIASWLAGDASRQAALPVIGKPRTPLEFHAWTPDAP
FT                   MREGRHRIAEPAAGARLVPELLLIPCVGFDHGCFRLGYGGGYYDRTLAAWPGATPPVTV
FT                   GVAYDACGVRELPREAHDLPLDWIVTETRLYRSDD"
FT   gene            463565..465520
FT                   /gene="slt"
FT                   /locus_tag="BURPS1710b_0453"
FT   CDS_pept        463565..465520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="BURPS1710b_0453"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49877"
FT                   /db_xref="GOA:Q3JX36"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX36"
FT                   /protein_id="ABA49877.1"
FT                   /translation="MSTSLFRVYRAVAAPLVAIALAAVAAACAAQTADEASSNDDRVFV
FT                   QLREAARRNDPVRAAQLAALIPNYPAPSYLEYFQIKPQLFDSAGHARLDAPDAPVLSFL
FT                   SRYDGQAIADRMRNDYLLVLGARHDWRAFDEQYKRFVLDDDTQVKCYALESRASRGENV
FT                   ADMARELLVEPKYYGDACVDLITALATNKQFSSDDVWAQVRLAYEQNYTTLGGKIADAL
FT                   GPRPVGFDQVTSAPPLFLARGVGSDATSRQLALVAITRMARNDPEAAAGQLASLASTLS
FT                   AAEQAIGWGEIGYQATVKRLPQAASWYRKSMDAPLSNPAYEWRVRAALLAGDWPMVRRS
FT                   IEQMPERLRDDTAWIYWRGRALKESGDTLKANQEFERIAGQFNFYGQLAGEELGQKTTI
FT                   PPRTKVTDAEIDAMSKVPGFALAQRFYALNLRLEGNREWNWPLRGMTDRQLLAAAEYGK
FT                   RVDLLDRTVNTADRTTAEHDFSLRYPSPYRDIVERYARTNGLDVEWAYGLIRQESRFIT
FT                   NARSTVGAGGLMQLMPATAQLVAKKLGLGTVSRAQMHDIDTNVQLGTWYLSDIYQKFDD
FT                   SAVLATAGYNAGPGRPAQWRQVLTRPVEGAIFAETIPFNETREYVKNVLSNETYYAALF
FT                   EKKPQSLKARLGFIAP"
FT   gene            complement(465507..466532)
FT                   /locus_tag="BURPS1710b_0454"
FT   CDS_pept        complement(465507..466532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0454"
FT                   /product="200 kDa antigen p200, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX35"
FT                   /protein_id="ABA51155.1"
FT                   /translation="MLEARGRDAELGRDRPRHHARHRQRSEIVARDERLARQHLEHARL
FT                   QPRERVRQPDDPRGAADQPPGIADDLLEPVGARPAELVGPAARRVAHAGVRDRLRDVAD
FT                   VDRLHQRVGHRERQHRKDPLKPRERVDKRVARAEHDRRPEYRDVQRARRGLRAQRDLAV
FT                   ALRAQVHARRVRIGAERAHVKHARHARFDACGGERRGQRDVQPLEALAVRLAVPAAQHA
FT                   DEIDGRLRARDETGELAHVEGGQLDDVDGQRREMPRMLAPARADTHVRAGADEHIDEAA
FT                   TDEARAAEHRDGLALHDRAPSGAPPTRRAGGECDTKRRPAAPGQRVRGTPLRCAARVTA
FT                   R"
FT   gene            465642..466601
FT                   /locus_tag="BURPS1710b_0455"
FT   CDS_pept        465642..466601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0455"
FT                   /product="predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF05368;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48768"
FT                   /db_xref="GOA:Q3JX34"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX34"
FT                   /protein_id="ABA48768.1"
FT                   /translation="MQGQTIAMLGGTGFIGSRLVNVLVGAGAHVRIGARRREHARHLAT
FT                   LPVDIVELSAFDVRELARFVAGAQAAVNLVGVLRGGHGKPYGEGFERLHVALPAALAAA
FT                   CIEARVPRMLHVSALGADPHAPSMYLRSKGDGEIALRAQAAAGALDVTIFRPSIVFGPG
FT                   DAFVNTFARLQRIFPVLPLAMPDALMQPVHVGDVAQAIANACVRDATRGWTYELGGPRT
FT                   YRLEEIVRYAGRLIGRPARIVRLPDALARLQARVFEMLPGEPLVSRDNLASLSVPSVMT
FT                   GPIAPELGIAPASLEHIAPTYVGDAALRSRFSDRRARR"
FT   gene            466656..467312
FT                   /locus_tag="BURPS1710b_0456"
FT   CDS_pept        466656..467312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0456"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47709"
FT                   /db_xref="GOA:Q3JX33"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX33"
FT                   /protein_id="ABA47709.1"
FT                   /translation="MNPMKLVIGDKNYSSWSMRPWVLMKHFGIPFDEVMIGLRLDDTAE
FT                   RIRAHSPSGKVPCLVDDEGGSVWDSLAIVETLAERFPQHALWPRDPAARAHARSVSAEM
FT                   HAGFPALRSEMPLNVRESHPGRGATPAALADVARIDELWRTCVAASGGPFLFGAFSIAD
FT                   AMYAPVVLRFKTYAPPLSPEASAYAARVAELPAVREWIDGARGETRVIDIYGPSR"
FT   gene            467252..468550
FT                   /gene="cca"
FT                   /locus_tag="BURPS1710b_0457"
FT   CDS_pept        467252..468550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="BURPS1710b_0457"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47724"
FT                   /db_xref="GOA:Q3JX32"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX32"
FT                   /protein_id="ABA47724.1"
FT                   /translation="MDRRRARRDARDRHLRAIAMKIYAVGGAIRDALLGLPVRDRDYVV
FT                   VGATPEQMAAQRFRPVGKDFPVFLHPDTHEEYALARTERKTAAGYHGFQFYYAPDVTLE
FT                   QDLVRRDLTINAMAREVSPDGALVGPVVDPFGGQADLRAKLFRHVGDAFVEDPVRILRV
FT                   ARFAARFAEFAVAPDTAALMRAMVDAGEVDALVPERVWQELARGLMEAKPSRMFAVLRE
FT                   CGALARILPEIDALFGVPQRADYHPEVDTGVHVMMVIDHAAKQGYSLAVRFAALTHDLG
FT                   KATTPADVLPRHIGHEGRSVDLLKPLCERLRVPNECRDLALVVAREHGNLHRVMEMGAA
FT                   ALVRLLERADALRKPARFAEALQASEADARGRLGLETKPYPQAERLRQALVAARAVDAG
FT                   AIAQGLAGEPAKIKDAVHRARVRAVAQAVGVAD"
FT   gene            complement(469199..469420)
FT                   /gene="rebB"
FT                   /locus_tag="BURPS1710b_0458"
FT   CDS_pept        complement(469199..469420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rebB"
FT                   /locus_tag="BURPS1710b_0458"
FT                   /product="RebB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50918"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX31"
FT                   /protein_id="ABA50918.1"
FT                   /translation="MAFPTSVNDQITDSVTQANTKVLGDAPAIAMGNLYQATAQALANT
FT                   AHNATNAQQQSYVTALAERRDGGAATTI"
FT   gene            complement(469899..470393)
FT                   /locus_tag="BURPS1710b_0459"
FT   CDS_pept        complement(469899..470393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0459"
FT                   /product="flagella synthesis protein FlgN, putative"
FT                   /note="identified by match to protein family HMM PF05130"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50586"
FT                   /db_xref="GOA:Q3JX30"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX30"
FT                   /protein_id="ABA50586.1"
FT                   /translation="MHHMAHGRSARRHVERNEMRDELLATVNDEHATVEAFASLLAYEE
FT                   KALTTAAPLDALPGIVERKTELLEKLAQLERRRDTLLASLGLPAGKKGMDLAAENDARL
FT                   ANGWQLLQHSAERARHANAINGMLIRIRMDYNERTLSVLRAAPQRNGFYGPDGRVAAVA
FT                   R"
FT   gene            complement(470419..470763)
FT                   /gene="flgM"
FT                   /locus_tag="BURPS1710b_0460"
FT   CDS_pept        complement(470419..470763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="BURPS1710b_0460"
FT                   /product="negative regulator of flagellin synthesis"
FT                   /note="identified by match to protein family HMM PF04316"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49507"
FT                   /db_xref="GOA:Q3JX29"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX29"
FT                   /protein_id="ABA49507.1"
FT                   /translation="MKVDSTPTSNARTLSNASAGAARTQAGQPAAAQTPAGAAGAPTGG
FT                   DANVSLSGLSSTLRSLAASGSADIDTAQVDAIRDAIKSGTLSIDTGKIADGILQTARDL
FT                   LKQPSQAGNR"
FT   gene            complement(470867..472396)
FT                   /locus_tag="BURPS1710b_0461"
FT   CDS_pept        complement(470867..472396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0461"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA, putative"
FT                   /note="identified by match to protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49246"
FT                   /db_xref="GOA:Q3JX28"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX28"
FT                   /protein_id="ABA49246.1"
FT                   /translation="MTTDAGRATRTRFAVALALAGWMGAALAQQAGDGGMIVIPGRGES
FT                   AQTALANANAASARGANGAGAAGPGGADRTASPGGWHAPAAAQAAAAWSGRAGAASGAE
FT                   SAAESGDVRAATEPRTGLIVIEPGPAESNGRIPAAAPSGWHPSAAMPRAESNGGANPVP
FT                   PRTGSNRSAGSASASAGWTAPPGAASQGNPAANVAPAPRVSAASRAPATTDMQRVAPVI
FT                   AQDEGAAPAGRPANARAAAQSWPARDPSVAAGGVIPVSLRAQPAPRTLPVRSAPIRAAA
FT                   TSAAGAQPAAASATAAGAVPAAQQDGESIRRAALAFLQQQAAGLPGKTTVTVAPAFPRG
FT                   LAACTTLEPFLPSGARLWGRTTVGVRCAGERPWTIYLQAKLAVQATYYVAARQIAPGET
FT                   LTAADLVARDGDLTLLPLAVITDAQQAVGATALMRVAAGLPLRRDLLKSAASVSIGQTV
FT                   RVVASGQGFTISAEGSVLNNAAPGQQVRVRMAAGQIVTAIVKDAATVEIPL"
FT   gene            472656..473147
FT                   /gene="flgB"
FT                   /locus_tag="BURPS1710b_0462"
FT   CDS_pept        472656..473147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BURPS1710b_0462"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48186"
FT                   /db_xref="GOA:Q3JX27"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX27"
FT                   /protein_id="ABA48186.1"
FT                   /translation="MLDKLDAEFAFGRQALDVRAYRQELLSSNIANADTPGYRARDVDF
FT                   SSTLARALKQDGAASAGNAAQLPLAQPAGVASGMSMATTSGAHLAGNVKLIPTGGPSDD
FT                   YGRAQYRIPQQPALDGNTVDLDTERVQFADNAVHYQAGMTVMTQQIKTMIAAITSNSSS
FT                   "
FT   gene            473173..474552
FT                   /gene="flgD"
FT                   /locus_tag="BURPS1710b_0464"
FT   CDS_pept        473173..474552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="BURPS1710b_0464"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50945"
FT                   /db_xref="GOA:Q3JX26"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX26"
FT                   /protein_id="ABA50945.1"
FT                   /translation="MPRASRETVECARNAIRSTHAFVDEHFRRRGFRDVGPVAAPERHG
FT                   VEPRERRQRDGPRRQALQGEAGGVRDRADGPRAHRVRPGCRRRAGEQGDRRSVADEDGL
FT                   RPVEPGRRSERLRDDAERRSGAGDGQHDFRVALVPGERRDAQYREAADAQDADDRQLTP
FT                   PFFIDRNTHSRGRRTRMTSSFTTIGGSGTTVNSLPYDTMSSNGQSSGTSGANTTNGTAG
FT                   TNGTSGANSGINVASSLSTTSAADLQTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQIN
FT                   TVSGIAQLNTALTSLSSQLTAGQQTQAAMLIGSNVLAPGNTVPVKSGAASPFGVQLTSA
FT                   VSNLTITVKNASGVVVNTINAGAQSAGTVPFNWTPTDTAGNKLPDGTYTISASYTDTSG
FT                   KQYAPTTLSSAQVLSVIKQADGTPGLVLSNGSTVGFSQVASIFPNTTKSASTGNASSST
FT                   N"
FT   gene            473231..473656
FT                   /gene="flgC"
FT                   /locus_tag="BURPS1710b_0463"
FT   CDS_pept        473231..473656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BURPS1710b_0463"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48217"
FT                   /db_xref="GOA:Q3JX25"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX25"
FT                   /protein_id="ABA48217.1"
FT                   /translation="MPSLMNIFDVAGSAMSAQSQRLNVTASNLANADSVTGPDGKPYKA
FT                   KQVVFATAPMGRARTASGQGVGGVQVSKVIDDPSPMKTAYDPSNPAADQNGYVTMPNVD
FT                   PVQEMVNMISASRSYQANVETLNTAKQLMLKTLTIGS"
FT   gene            474580..475821
FT                   /gene="flgE"
FT                   /locus_tag="BURPS1710b_0465"
FT   CDS_pept        474580..475821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="BURPS1710b_0465"
FT                   /product="Flagella basal body rod protein"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49887"
FT                   /db_xref="GOA:Q3JX24"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX24"
FT                   /protein_id="ABA49887.1"
FT                   /translation="MGYQQGLSGLAGASSDLDVIGNNIANANTVGFKGSTAQFSDMYAN
FT                   SVASAVNNPIGIGTMLASVQQQFSQGTITSSTSSLNVAINGNGFFQMSNNGVTTYSRDG
FT                   TFQRDKNGYIVNSQGLNLMGYAANANGVINTAATVPLQAPTTNIAPTATTKITGQFNLN
FT                   SQDAVPATTPFNYTDPTSYNYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGK
FT                   TPTDLGSVKFSTAGTITGTSTPAGVPTTNVGQFSFSIPTTTGAANPQNLTLDLTGTTQY
FT                   GGKNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNGLVNV
FT                   GNNQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQANAQT
FT                   IKTQQTVDQTLINL"
FT   gene            475848..476609
FT                   /gene="flgF"
FT                   /locus_tag="BURPS1710b_0466"
FT   CDS_pept        475848..476609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="BURPS1710b_0466"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02490"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47889"
FT                   /db_xref="GOA:Q3JX23"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX23"
FT                   /protein_id="ABA47889.1"
FT                   /translation="MDRLIYTAMTGATQSLEQQSVVANNLANASTTGFRAQLATFRAVP
FT                   MNFEDGSGNVDPATTRTYTLSSTPGADFAPGPIERTGNPLDVAVQGPGWLSVMLPDGTE
FT                   AYTRAGNLHVDQNGQLVTANNLPVVGNGGPLAVPPNAQLTIGADGTVSALMPGDPPTAV
FT                   AMIDRLKLVNPDPATMKRGDDGLFRTADGNPADADPAVKVVPNSLEGSNVNPVAAMVSM
FT                   IDNARAFELQTKLIQSADQNEQAANQLLNFS"
FT   gene            476643..477431
FT                   /gene="flgG"
FT                   /locus_tag="BURPS1710b_0467"
FT   CDS_pept        476643..477431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="BURPS1710b_0467"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02488"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47651"
FT                   /db_xref="GOA:Q3JX22"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX22"
FT                   /protein_id="ABA47651.1"
FT                   /translation="MNRSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLL
FT                   YQTVRQPGANSTQQTELPSGLQLGTGVQQVATERLYTQGSLQQTGNSKDVAINGQGFFQ
FT                   VLMPDGTNAYTRDGSFQTNAQGQLVTSSGYQVIPAITIPQNANSLTIGSDGVVSVTQPG
FT                   SNNAVQIGALQIATFINPAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESS
FT                   NVNVVQELVNMIQTQRAYEINSKAVTTSDQMLQTVTQMSR"
FT   gene            477506..478174
FT                   /gene="flgH"
FT                   /locus_tag="BURPS1710b_0468"
FT   CDS_pept        477506..478174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="BURPS1710b_0468"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by match to protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49653"
FT                   /db_xref="GOA:Q3JX21"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JX21"
FT                   /protein_id="ABA49653.1"
FT                   /translation="MRRPGAAALAAAALALAGCAQIPREPITQQPMSAMPPMPPAMQAP
FT                   GSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGF
FT                   LGGLFNKANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQ
FT                   GNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAPW
FT                   "
FT   gene            complement(478108..480336)
FT                   /locus_tag="BURPS1710b_0470"
FT   CDS_pept        complement(478108..480336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50544"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX20"
FT                   /protein_id="ABA50544.1"
FT                   /translation="MYRTVARLASADLLHDRNQLLRVVRIGCVAGLLHSMREAFRVVAR
FT                   VQHARVARIVFQQVRVIGHRMLVRVVCAELRDHAVRLAVHVFGGDGRYRAAGPALRRLD
FT                   AEHVVARFAVRAADLALAPAGFERRLADDEARRNAGGRARRLRGERHLLDERIRLRGVA
FT                   VALQRRRERARRRIAARARERAVAWRPIRVRIRLRERVHRREAAFALRVGRDVRVAQQL
FT                   LGERVGHADALRRHLLRELLIEHRRVHLRRARIEQAVRRRRVAHALQHHLREHRVELAR
FT                   DHLHTLARRSRRGLRAQRVEPLNVEREALRQIVRFRESRHLDDLQVRAKRARRLHRLQD
FT                   RHQIRGRRAERVERLHHVGEVRARRHHPQRAIVLLELDLRLLRHHRLPVRERPRLRHHG
FT                   LRVDDDRQIAVRDRAVLQRHHLVHHDRARARVQDHLRRGPLRAHLEILQPRHERDLLRR
FT                   IGGRGELDRAAVERRRRARAEARVHRGHDALRGAVIHVVQLQLQHAVHLRDRVRHRALD
FT                   DRAAGDAAGRELVHLHAAAVRARARAAHRHVALRERVHLAVGALQRREQQRAAAQALRI
FT                   AERRYRHVDRLTRPRERRQRRRHHHRGDVLQLHVRHRRRAAAVGRAVVDRDAEVREHVR
FT                   ERLRRERRLHRLVARAVEADDEAVADQRVVAHALDLREVLQALRARRGGREREREHARG
FT                   ERAARRRPATRSNEGAHDAREQGTHRLHHGAMLRKKRCSQPIVSASLM"
FT   gene            478264..479373
FT                   /gene="flgI"
FT                   /locus_tag="BURPS1710b_0469"
FT   CDS_pept        478264..479373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="BURPS1710b_0469"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48991"
FT                   /db_xref="GOA:Q3JX19"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX19"
FT                   /protein_id="ABA48991.1"
FT                   /translation="MLALAFAPAAARAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQ
FT                   TMQTPFTTQTLANMLANLGISINNGSANGGGSSAMTNMQLKNVAAVMVTATLPPFARPG
FT                   EAIDVTVSSLGNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQ
FT                   LAAGRIAGGAIVERSVPNAVAQMNGVLQLQLNDMDYGTAQRIVSAVNSSFGAGTATALD
FT                   GRTIQLTAPADSAQQVAFMARLQNLEVSPERAAAKVILNARTGSIVMNQMVTLQNCAVA
FT                   HGNLSVVVNTQPVVSQPGPFSNGQTVVAQQSQIQLKQDNGSLRMVTAGANLADVVKALN
FT                   SLGATPADLMSILQAMKAAGALRADLEII"
FT   gene            479374..480309
FT                   /gene="flgJ"
FT                   /locus_tag="BURPS1710b_0471"
FT   CDS_pept        479374..480309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /locus_tag="BURPS1710b_0471"
FT                   /product="flagellar rod assembly protein/muramidase FlgJ"
FT                   /note="identified by match to protein family HMM PF01832;
FT                   match to protein family HMM TIGR02541"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47565"
FT                   /db_xref="GOA:Q3JX18"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX18"
FT                   /protein_id="ABA47565.1"
FT                   /translation="MTTFTKPNDLSQRFALDVQGFDALRSKATAAAPREGVKMVAGQFD
FT                   AMFTQMMLKSMRDATPSDGLLDSSSSKMYTSMLDQQLAQQMSSKGIGVADALTKQLLRN
FT                   ANVAPDAQGEGGLAAMNALAKAYANSNGAPGNGALAGTRGYSAASALTPPLKGNGNSAQ
FT                   ADAFVEKMALAAQAASATTGIPARFIVGQAALESGWGKREIRGANGESSYNVFGIKATK
FT                   GWTGRTVSAVTTEYVNGKPHRVVAQFRAYDSYEHAMTDYANLLKNNPRYASVLNAGHNA
FT                   EGFAHGMQKAGYATDPHYAKKLISIMQQIG"
FT   gene            480525..481283
FT                   /locus_tag="BURPS1710b_0472"
FT   CDS_pept        480525..481283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0472"
FT                   /product="YcgR protein superfamily"
FT                   /note="identified by match to protein family HMM PF07317"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50725"
FT                   /db_xref="GOA:Q3JX17"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX17"
FT                   /protein_id="ABA50725.1"
FT                   /translation="MNTEQSTSPAASAAAHSGHDYGRRNPLEIGVQLRNLVNRGDFLTV
FT                   QYQGGQLVTRILDVDVGARTFVFDWGALADQNAGILAAPRCVFDASPDGVRVEFSTATP
FT                   RETRYENLPAFEADFPDVLYCMQRREYFRVDAPILDPYVCRGRLPDGETFLFEVHNLSL
FT                   GGLGLRTSDDRVASLEPGMTLPDVELNLNGHGMLSLDLQLVSHRASETPSGARRYQLGF
FT                   RFVSLPGSAENTLQRIITQLEMKRRQLARA"
FT   gene            complement(481466..484876)
FT                   /locus_tag="BURPS1710b_0474"
FT   CDS_pept        complement(481466..484876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0474"
FT                   /product="Planctomycete extracellular domain protein"
FT                   /note="identified by match to protein family HMM PF07595"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51048"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX16"
FT                   /protein_id="ABA51048.1"
FT                   /translation="MRPAAPARGHGAPAPPQSEAGGTRRPLRRNRWRPAGSRAAAKPPA
FT                   GRRRLRVQILEQRQVLHLHERLLRGAQRILQLQELADRGGQVRVGQVRQAVRRLQRVRR
FT                   RHRLHRLHFLQAAADRRLHGQHVRHRVHQLRRRGGHRVRQRGRRGLAIADGRLQRGDHR
FT                   VERREHVGARLRRGRHRERVAHGRLARHRDRLAAEIDALAGRVRLRRGRRRRRDRVVGH
FT                   RVSRRRGRAAERDRELVRVGRIGRIRDADRADRARARVARARGGHGQAAEERHRHEHVR
FT                   AVVALRNRARIGDLHGARAVIARIRDAAARLVRERLRRRLEAREQIVARAVRRVREREQ
FT                   MVARALDLRGKRRAVAVRQPAVARVHQRLVRGVEHVVDARERRVLGLQRGLHDRLVLRV
FT                   LRERRRGRRQLHRLRGRERIVGGRRQADAARYLLVELRDLRLLVVHHVDVQAVELSAGN
FT                   AHRRLPRSVEEAEHGLEYRVRRLDHLRVRLIQLLVLHQVRRFLVLVHARHRLLRLRDLA
FT                   DERRLRGARRLQLARRVADRVHVARVGARERRRAVVHRLRVHELRQRERVAPVVGALVR
FT                   ADRELVAVRGRARQRHAHAVHHARRRRLRRARDRHRRTLRRIVRHGRRRARDVDRRRRR
FT                   ARDRHRRADRKARQRLRRRVVRERRRARRQLVARAHRALRDHARAAVRRDARGEHGRGG
FT                   RDRRAVRDGEREAVERAARGQHGERIARVGRARQRQLQAADRHRRRRGARRRRADDAAR
FT                   RAVRQRVLRAVVRQRVVARRRLRAVDERHGQRRAAGVVLVRVDGRRADRKQAAARIAGH
FT                   VDAERVLRVDLRREADRERAQLRLRGIERLAAEREQAAERAARERHVGQILRGPRLGRA
FT                   GDALRYDRELARIGRRSDGRELIARIADDERLAARQEHAVVAVALHDLHARELRELRHR
FT                   EIALVEELVRRLALRARRRDLLVQLRDLRGVAVDLRDGVGELRIHALAQLRVLLAGGDE
FT                   LARECLRVAHRGLARGRVRRVVRDRLQAGEVVRDRGRDAGRRAADVIVQLRDERVVGRQ
FT                   RAALRLRGVQLVRQVLVVLALDGDGRHALRQIAAARVLAARFRIDGALDGIAGRRRIAD
FT                   VLAGRGETPERGVQAADPEVHEGIGHARS"
FT   gene            481478..483481
FT                   /gene="flgK"
FT                   /locus_tag="BURPS1710b_0473"
FT   CDS_pept        481478..483481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="BURPS1710b_0473"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="identified by match to protein family HMM PF06429;
FT                   match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48595"
FT                   /db_xref="GOA:Q3JX15"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX15"
FT                   /protein_id="ABA48595.1"
FT                   /translation="MSNTLMNLGVSGLNAALWGLTTTGQNISNAATPGYSVERPVYAEA
FT                   SGQYTSSGYLPQGVSTVTVERQYNQYLSNQLNAAQTQGSSLSTYYTLVAQLNNYVGSPT
FT                   AGIATAITNYFTGLQTVANNAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQL
FT                   TDTVTQINSYTSQIAQLNEQIASASSQGQPPNQLLDQRDLAVSKLSQLAGVQVVQSNGN
FT                   YSVFLSGGQPLVVGNASYQLATVASPSDPSELTIVSKGVAGSAQPGPTQYLPDVSLTGG
FT                   ALGGLLAFRSQTLDPAQAQLGALAVSFASQVNAQNALGVDMSGNPGGSLFAVGAPAVYA
FT                   NQNNTGSATLSVSFVDGTQPTTSDYALSYDGAKYTLTDRATGSVVGTATPSSTPPTMTI
FT                   GGLKLSLSSTPNAGDSFTVLPTRGALDGFSLAIANGSAIAAASPVLAAGVATNSGTGVI
FT                   SQGSVSAGYQLPSGTTTLAYNAASKTLSGFPVGTTVTIAGTPPTSINITSATTPVPYDP
FT                   SKGASMTISSTTQPAPSGVMNGVSVSLSGTPADGDQFTIGANKGTNDGRNALALSQLVN
FT                   SKTMNNGTTTLTGAYAGYVNAIGNAASQLKASSAAQTALVGQITQAQQSVSGVNQNEEA
FT                   ANLMQYQQLYQANAKVIQTANSVFQTVLGLFN"
FT   gene            483539..484729
FT                   /gene="flgL"
FT                   /locus_tag="BURPS1710b_0475"
FT   CDS_pept        483539..484729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="BURPS1710b_0475"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48925"
FT                   /db_xref="GOA:Q3JX14"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX14"
FT                   /protein_id="ABA48925.1"
FT                   /translation="MMNDQQAQIAQLYQQVSSGISLTTPADNPLAAAQAVQLSATSATL
FT                   AQYTQNQTIVQTALQTEDTTLTSVNDVLNAAYQALMHAGDGGLSDSDRAALAAQIQGSR
FT                   DHLLTLANTADGAGNYLFAGFQPTTQPFSNKPGGGVTYAGDYGARAVQIADTRTVSQGD
FT                   NGANVFMSVPFLGSLPVPAAGASNTGTGTIGAVSITNPSDPTNTHQFTITFGGTAAAPT
FT                   YTVTDNSVTPPTTTAAQAYSSGQGINLGGQTVAVSGKPAVGDTFTVTPAPQAGTDVFAT
FT                   LDTVIAALKSPVGNSQTASTALTNTMATASTKLMNTMTNVLTVQASVGGRLQEVKAMQA
FT                   VTTTNTLQTTNSLSNLTDTNLPAAISQFLQLQNSLSAAQKAFVQMQNLSLFQYLNP"
FT   gene            485097..486404
FT                   /gene="uraA"
FT                   /locus_tag="BURPS1710b_0476"
FT   CDS_pept        485097..486404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="BURPS1710b_0476"
FT                   /product="uracil permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48330"
FT                   /db_xref="GOA:Q3JX13"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX13"
FT                   /protein_id="ABA48330.1"
FT                   /translation="MADSYFPRWRAQLRDDAARVIAPDERLPWPQTFAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLCILMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYAGGG
FT                   ANPNVPVALGGIVACGVVYALIGLVVAAVGTRWIETLMPPVVTGAIVAVIGLNLAPIAV
FT                   KGVSASTFDSTLALVTVLCVGGVAVFARGMLQRLLILVGVLIAYVIYAVLTNGMGLGKP
FT                   IDFAIVAQAAWFGVPTLHRPVFDPHAMLLIAPVAVILVAENLGHIKAVSAMTGRNLDRY
FT                   VGRAFIGDGLATVVSASMGGTGVTTYAENIGVMAVTRIYSTLVFVAAALIAIALGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNRVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKLGGFALGGIGTATFGAILLYALLRKEKEPGPMV"
FT   gene            complement(486631..487512)
FT                   /gene="gcvA"
FT                   /locus_tag="BURPS1710b_0477"
FT   CDS_pept        complement(486631..487512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvA"
FT                   /locus_tag="BURPS1710b_0477"
FT                   /product="LysR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48462"
FT                   /db_xref="GOA:Q3JX12"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX12"
FT                   /protein_id="ABA48462.1"
FT                   /translation="MARDLPPFPALRAFEAAARHESFSAAGEELHVTHGAISRQIAAFE
FT                   AWLGKPVFHRHGKRVKLTDEGRRYLATVEAAFDSIAGATVQLRETGAARVLRINALPTF
FT                   AMKWLLPRLSRFQREAPNVELKLSTSNAPLGSLDGFDVAIRRGPGRWPNCTSGRFLDES
FT                   VIPVCSAALLKRAPIASADDLARHVLLHSDTRPDAWREWFAAAGAPLKGRKKQSFDHFY
FT                   LALQAAVDGLGVALGPLPLIADELASGRLVTPLPGPRIATRSYWWIAPRETANDVLVGR
FT                   FCAWLDAQAQAS"
FT   gene            487554..487655
FT                   /locus_tag="BURPS1710b_0478"
FT   CDS_pept        487554..487655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47870"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX11"
FT                   /protein_id="ABA47870.1"
FT                   /translation="MESAANGRNLGSWKSRGLPCNLDPNPAAATRAA"
FT   gene            487652..488209
FT                   /gene="chrA"
FT                   /locus_tag="BURPS1710b_0479"
FT   CDS_pept        487652..488209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BURPS1710b_0479"
FT                   /product="possible chromate transport protein similar to
FT                   chrA"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48684"
FT                   /db_xref="GOA:Q3JX10"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX10"
FT                   /protein_id="ABA48684.1"
FT                   /translation="MSVADLFAGFLGLGLISFGGALPFARRALVEERRWLSADEFTDLL
FT                   GLCQFLPGGNVINLSVAVGMRFRGVPGAIAGLLGLVAGPTLVVIALGVLYAKTQQNPAV
FT                   HHLFGGLAAAAAGLLIAMAVKVAKPLRHMRAGACVAVLAFVAIAVLRVPLLPTMLVVTP
FT                   VSIWLASRAPRGANAGAQGVRR"
FT   gene            488206..488736
FT                   /locus_tag="BURPS1710b_0480"
FT   CDS_pept        488206..488736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0480"
FT                   /product="putative chromate transporter"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47907"
FT                   /db_xref="GOA:Q3JX09"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX09"
FT                   /protein_id="ABA47907.1"
FT                   /translation="MSDTLAALAVIFGQLSLLAFGGGNTILPEMQRQVVDVHHWMSAQA
FT                   FTALFALAQAAPGPNMMIVPLVGWHVASWPGLLVSSIAKFGPSSIVTMAALHAWERFKD
FT                   KPWRRYVQQGMMPVTAGLVVASAVLISEASNRSALQWGITAAVAALAYRTRVHPLWLLA
FT                   GGALAGLVGGWFA"
FT   gene            complement(489067..489405)
FT                   /locus_tag="BURPS1710b_0481"
FT   CDS_pept        complement(489067..489405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50603"
FT                   /db_xref="GOA:Q3JX08"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX08"
FT                   /protein_id="ABA50603.1"
FT                   /translation="MTAAKFFLRYTLVPFVAIVLVVVWAFNRESDEIDARQYAALVAAY
FT                   PGFTPDLRDEVNRAMRDGKLAKSDYASIVRDSLNHGYVLDWSSTNVDLNAERGKLLGLV
FT                   KSDAHAPD"
FT   gene            489459..489863
FT                   /gene="phnA"
FT                   /locus_tag="BURPS1710b_0482"
FT   CDS_pept        489459..489863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="BURPS1710b_0482"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49345"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX07"
FT                   /protein_id="ABA49345.1"
FT                   /translation="MRAGEYTFTYSINCKQGCNTMSTLPACPQCAMENTYPDGEHYICA
FT                   DCGHEWPIAGDANAADDDAAAVVKDANGNVLADGDAVVLIKDLKVKGSSITLKMGTKVK
FT                   SIRLVGGDHEVDCKMDAGNFMLKACYLKKV"
FT   gene            489881..490621
FT                   /locus_tag="BURPS1710b_0483"
FT   CDS_pept        489881..490621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0483"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49344"
FT                   /db_xref="GOA:Q3JX06"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX06"
FT                   /protein_id="ABA49344.1"
FT                   /translation="MNLDAASRNLTVASLLTLSGGYLDAYTYVGHGHVFANTMTGNVAL
FT                   LGINVSAGDWAQALHHVPPLAGFVIAVFVAHTLGLAAQKGWVRHTAFISLIVEIGFLAF
FT                   ASAGWPAMSSAWLIPGISFVATLQTLSFTHLENLSYTSVMTTGNLRRAAQLLFAGLIPR
FT                   YDALALHDSGLLAVISLCFLMGAVAGGFVTRLVGDGALWGAVLLLAAAFAEIVRRARHD
FT                   SGAGAARAERAARDAPAERAAHER"
FT   gene            491162..492295
FT                   /locus_tag="BURPS1710b_0484"
FT   CDS_pept        491162..492295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0484"
FT                   /product="outer membrane porin protein precursor"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48309"
FT                   /db_xref="GOA:Q3JX05"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX05"
FT                   /protein_id="ABA48309.1"
FT                   /translation="MKQTTKITGLIGGAVLAIAGQQAMAQSSVTLWGVADVSLRYLSNS
FT                   NAQNDGRFFMTNGAITNSRIGLHGSEDLGGGLKAIFNLESGVNLQDGAFSDSKRIFNRA
FT                   AYVGLTSQYGTVTLGRQKTVLFDLLSDTYDPLTVGNYLENAWLPVALGAGLYADNSVKY
FT                   RGTFGGLTIGAMYSFGTDSTATGAGGFSGQLPGHMGAGNMYGFSLSYVAGPVSVAAGVQ
FT                   QNSDNSNRKQTIYHANVVYAFSKAKIYAGYLHSKDDTGFVDTVLAQQPGLFTSGAPKRT
FT                   GRIDDGPFAGVSWQATPALTLTGAFYYDRMRNATIANGQLDSGNRYTVVGLVEYALSKR
FT                   TEIYGTVDFNKVNGAATVEMPGRSNQTGVAIGLRNIF"
FT   gene            complement(492441..493274)
FT                   /locus_tag="BURPS1710b_0485"
FT   CDS_pept        complement(492441..493274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0485"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX04"
FT                   /protein_id="ABA51131.1"
FT                   /translation="MKKLVTLMIAGALVALPCTTNLNAAQAATRAPAVAGSPGSAIVFV
FT                   NGINNTFDDAIASLQVLKTQLNARDANNAYVYGNAYNATQGTFSDLWQVFKQKSVEGTS
FT                   PADFWRAIDGGTVPAGGMDAALQQKYIDILTKSETPELPDHLNQYRAYLQQNRKVVLVG
FT                   HSQGTLYANFEMNLLITGPERAQGRISSVNVGNAARYLLPGSSYLTSSSDTVIGSLGLV
FT                   QTVMPSNFSLGLHLFTDPLGHSFTKIYLNPSFSAARQILTQVSQQANSAAKAAVR"
FT   gene            complement(493322..494050)
FT                   /locus_tag="BURPS1710b_0486"
FT   CDS_pept        complement(493322..494050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0486"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49809"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX03"
FT                   /protein_id="ABA49809.1"
FT                   /translation="MGARSARSRYGDASPLKRFLVRFASRWWRRRLRERDGQPAAFRNA
FT                   YKTSQQNGEGMRWQYPVAAALAIAAFVWACARIVSTDAAPAAAPAGQTASAAPAALASA
FT                   FTAASSAAPRSAPPPLPPRVTEHIAREYADSAVTREALTQIAYGWNQAVNDVHDPGDAK
FT                   IAGDAIAKGIACALSARVLAKAGVDQQTMLDRIKGTRAVMLDTETDTLAYIRFQSLAGG
FT                   QFFDDPGPASCGFNPTAMPN"
FT   gene            complement(494253..495281)
FT                   /locus_tag="BURPS1710b_0487"
FT   CDS_pept        complement(494253..495281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0487"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50155"
FT                   /db_xref="GOA:Q3JX02"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX02"
FT                   /protein_id="ABA50155.1"
FT                   /translation="MQNEPQRTRSDAHTPRLIKHAGRIAALAGLAISLWLVARDDPHTV
FT                   LALLRAAGIGLVVAAASHLLPMLANAKDWQTLIAPRCRPSLPAMLRLVWIRESVNGLLP
FT                   VARIGGEFASFRLLRAHGLTAPAAVASLVSDMQLTLISQALFALAGVGYLLVHATSDTA
FT                   RVAGMFAWGLAVLAPLLLLFALVQHAKPFERAMHALNRVAGGQLASLVERSAQIDDALK
FT                   AVWRQRGTVVRYLFFWQPLQHLATSLEIWLALHFLGASVSLVDALVIEALIQALSSAAF
FT                   FVPGGLGVQEGGFVLIGGALGLDPATSLGLAGARRIRDLLIFVPGLLAWQHAEASVAAS
FT                   AP"
FT   gene            complement(495316..496563)
FT                   /locus_tag="BURPS1710b_0488"
FT   CDS_pept        complement(495316..496563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0488"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.80"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50942"
FT                   /db_xref="GOA:Q3JX01"
FT                   /db_xref="InterPro:IPR017835"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX01"
FT                   /protein_id="ABA50942.1"
FT                   /translation="MKALAWLTGAVLALLAAELISFGDIGRFVTLLAALLAAPCALAAA
FT                   FGCVYTLVAAALTHRFFARAPREPHACPPVTIVKPLHGVERTLFANLASFCEQRYDGPI
FT                   QFLFGVHDRDDPALRAVDALRTAFPRAHVTIVADARLYGPNRKIANLVNMLPAAAHDVL
FT                   IFADSDVSVGPDYVRHIVGELGEPGVGLVTCVYRGRPDPGFWPRVEALVTSHQFLPGVV
FT                   TGLALKLARPCFGQTIAMRRAMLDAIGGLAQFAHHLAEDHAIGEAVRARGARVVVPPFA
FT                   VEHGCVETRVAQLVEHELRWSRTIRAVDPRGHLGSLLTHPLALALLAGVLSSGAAWAWP
FT                   LVPAALVARVAAKRIVDRATKRPVRDLWLLPLADLIAFGIFVASFSSSRVIWRGFSFDV
FT                   DRDGRLCPTPEKRPNA"
FT   gene            complement(496966..498480)
FT                   /gene="oprB"
FT                   /locus_tag="BURPS1710b_0489"
FT   CDS_pept        complement(496966..498480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprB"
FT                   /locus_tag="BURPS1710b_0489"
FT                   /product="carbohydrate porin, OprB family"
FT                   /note="identified by match to protein family HMM PF04966"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49462"
FT                   /db_xref="GOA:Q3JX00"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX00"
FT                   /protein_id="ABA49462.1"
FT                   /translation="MKKKTLHQMLVKSGVASGLPLLLSLGIVQPALAQASSPAAAPAEN
FT                   AAPPAPATRAPDGVPGGNGATAAQTDAAPTGFWDRSNLFGDMGGLRTKLGDHGITLNLQ
FT                   ETSEYLRNLSGGTSRGGAYDGLTQFGFSVDTEKAIGLPGGTFNVSGLQIHGTSLTARNL
FT                   QLLQTASGIEAEATTRLWELWYQQSFANGRADVKVGQQSLDQEFMVSQYASTFINATFG
FT                   WPVLPAVDMPAGGPAYPLSSLGVRLRAKPSDAWTVMAGVFDGNPAGGVGDAQQLNRHGT
FT                   NFNLRNGALFIGELQYALNAPPADPKAPQAGLPGMYKLGVWYNSERFADPRYDTNGVPL
FT                   ADPASNGVAATHRGNYGFYAVADQMVWRPGADSPRSLNVFARVMGAPGDRNAVDFTLNA
FT                   GVTLKAPFAGRDNDTAGLAVSYAKIGSRARGADGDTGVFQTPGYPVRRAETLIEATYQY
FT                   QVTPWWQLQGDFQYAFRPGGGIPNPNEPGSRIGNEAIVGVRTTITF"
FT   gene            498538..498834
FT                   /locus_tag="BURPS1710b_0490"
FT   CDS_pept        498538..498834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49223"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ9"
FT                   /protein_id="ABA49223.1"
FT                   /translation="MLPAGCGEPAGPASAYENHQLTRMAWFRPTCWPDADSSAPSATAP
FT                   AVAATIAQPAGRGMNGSRARTVGRMASADGARAAAARRRRAKSGPCTNLTARN"
FT   gene            complement(498582..498842)
FT                   /locus_tag="BURPS1710b_0491"
FT   CDS_pept        complement(498582..498842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50287"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ8"
FT                   /protein_id="ABA50287.1"
FT                   /translation="MLFQFLAVRFVHGPLFARRRRAAAARAPSALAMRPTVRARLPFIP
FT                   RPAGCAIVAATAGAVALGALLSASGQQVGLNQAIRVSWWFS"
FT   gene            499879..500019
FT                   /locus_tag="BURPS1710b_0492"
FT   CDS_pept        499879..500019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49846"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ7"
FT                   /protein_id="ABA49846.1"
FT                   /translation="MQFGLLLSQLPHVDESRVHYDAMLSLKAAGEPASASFWQRLKALI
FT                   S"
FT   gene            500138..501796
FT                   /locus_tag="BURPS1710b_0493"
FT   CDS_pept        500138..501796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0493"
FT                   /product="manganese/iron transporter, NRAMP family"
FT                   /note="identified by match to protein family HMM PF01566"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47749"
FT                   /db_xref="GOA:Q3JWZ6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ6"
FT                   /protein_id="ABA47749.1"
FT                   /translation="MSTPTDISQPIALERDAVLDQAHVGDIKGAFGTIAHHDTAPRSGW
FT                   WARVRTLLAILGPGLIVMVGDNDAGAFGTYTQAGQNYGTSLLWTLLLLVPVLFVNQEMV
FT                   LRLGAVTGVGHARLIFERFGKFWGAFSVIDLFILNALTIVTEFIGITFVLDFFGVSKVA
FT                   GVCIAAALTMAAVSTGDFRRFERFAVALCVLSLLLVPVLVSIHPPVHQMARDLFVPTWP
FT                   AHAKRSDVMLLVIGIVGTTVAPWQLFFQQSYVIDKRITPRFIKYEKADLWIGIVLVMIG
FT                   AIAMISFSAALYAGRPEAGGFTDAGGVIAGLAKYAGPTSAMLFAIALLDACIIGAAAVS
FT                   LATAYAIGDVFRIRHSLHRGVSDAKGFYLVYFGIVAAAAALVLMPGSPLGLLTEAVQTL
FT                   AGVLLPSATVFLLLLCNDRAVLGPWVNSARLNLFTGAVVWVLVMLSIILTASVMYPDMS
FT                   GEAMLEVLAGGTLFAALGLAATFVLRRRAGGADRANVAHVDRAARDTWRMPPLDALPAP
FT                   RVTLSTRIWMGVLRGYLVLAVGLVIVKVVQMAFFR"
FT   gene            complement(500141..502324)
FT                   /locus_tag="BURPS1710b_0494"
FT   CDS_pept        complement(500141..502324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ5"
FT                   /protein_id="ABA50926.1"
FT                   /translation="MDVHAAPRLSHSVAPVTSARPLTSRRARRRRMRADARRRTGTHAR
FT                   RPIDDDRASTPHAKQLSSPPPAQLSNYVELFSGGFHSKDSFILTRAGAHIAHTSRTRPP
FT                   APDADASGANGRIVGLAARFVVARPRAGGKRRHRRRRRSPCVMPSRVSPGKGIESVESP
FT                   ERRRRAQSGRAHRLPEKRHLHDLHDHEPHREHQIAAQHAHPDARRQRDARRRQRIERRH
FT                   PPRVARGAIDVRDIRTVGAARTPAQHERRREPERREERAAREHFEHRFAAHVRVHHGGR
FT                   QDDRQHHEHPDHRARKQIQSCRIDPRAEHGAVVAQQQQEHRRARQQHARERLHRFREQA
FT                   ERAARHQHERGRRGDDAEVDQIETLRVRHAAMQRVADPEHVADRIRGRERHGRRADDAR
FT                   VEQRDREQHRARRARILRQARDHAACIGEAARLRAARVERRAERDHRDRADHHEHDADP
FT                   QIRLLVLDEARRDPLVDHVALLEEQLPRRDRRADDADHEQHHVGALRVRGPGRHEQIAR
FT                   HLVHGRMNRYEHRHEQEAQHAERDRETLEAAEVARADGRHRERRRDAHARDLRHAEEIQ
FT                   HERDADELGDDRERVQDEQIDHAECTPELAEALEDEARVADARDGAQTQHHLLVHEQHG
FT                   HEQQQRPQQRRAVVLPRLRIGAERAGVVIADHHDEARAEDREQRAHARPPAAARRGVVV
FT                   RDRAERALDVAHVRLIEHRIALERDGLRDVGWR"
FT   gene            502282..502590
FT                   /locus_tag="BURPS1710b_0495"
FT   CDS_pept        502282..502590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ4"
FT                   /protein_id="ABA48781.1"
FT                   /translation="MLPNVTNAARHERPCNHARSRSTLTVIAMGILNTVGEIAGAVAAV
FT                   EAAEKVDPDAGLLTKAAAAVAGFKGAEALENLVEKKKDDEAADGENTAAPDSDASQA"
FT   gene            complement(502669..503889)
FT                   /gene="tnpA"
FT                   /locus_tag="BURPS1710b_0496"
FT   CDS_pept        complement(502669..503889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="BURPS1710b_0496"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49392"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ3"
FT                   /protein_id="ABA49392.1"
FT                   /translation="MLDRKALQALGCWTGYRLERVEWPQGDSRTLSLYLKPVSQIMYCE
FT                   QCGARCQQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGAARLEKLDWLGRYQRVT
FT                   ERFAKACEKLLQAASVQAVAAFYELGWHTVKSIDKMRLRARVAEPDWSTIRYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWVGPGRSRETARAFFEQLPEGVAERIEAVAIDMTTAYEL
FT                   EIKEQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNR
FT                   HNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRKPAWAEKAWGQWFEQAQQSGI
FT                   AALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEQYFFLKIRA
FT                   AFPGIPR"
FT   gene            504018..505496
FT                   /locus_tag="BURPS1710b_0497"
FT   CDS_pept        504018..505496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48696"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ2"
FT                   /protein_id="ABA48696.1"
FT                   /translation="MTVRARRAARNSKTCYRPVIGVSIRRRYGIRLRSLCHRRGLGRRA
FT                   PEPRRGVLRRARRHRRGRAHRRHLRAARLHPEKAARLRVALQPRCRGRRGLWLDLRHRP
FT                   VFVADAHRGEGPRDRAPERYLRRSAEQVGRRDPYGARDARRRAYGRRRGPACHRPAHRR
FT                   RDRLAAGAAADSRHRARDHVARGARVARAAAADRDRRRRLHRGRVRGHLQRARRRCRPV
FT                   LSRRADPARLRRRRAARVAWRDDEAGCRHPYARDDRGDRARRRRRVDAQARRGRVRAVR
FT                   RGAVCDGARREWRRARARGGRGRARRERRDRSRRLFGDDGAVDPRDRRRHRAPATDARR
FT                   DARRHAARGEPVRRQADRRRSSLRSFRGVQPAGDRDGRAHRGASARRARRARHLQDVVP
FT                   RAAAHVVRPRRKDVHEARRRARQPARRRRAHGRARRGGDHPGHRDRDPGGRDEGAVRRD
FT                   GRHPSNRGRGVRHVAAEGAGRRMTPDWRGARRLV"
FT   gene            complement(504088..505611)
FT                   /locus_tag="BURPS1710b_0499"
FT   CDS_pept        complement(504088..505611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48398"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ1"
FT                   /protein_id="ABA48398.1"
FT                   /translation="MIRADFHARTGESRRPGGLSRRLPAYRARRNRPFVAPVITPAVAH
FT                   RANRASCVVRLLLPQRDELLGRGWMDADRLVELRLRRARPDRDRDALDDLRRVAPDHVR
FT                   ADDALAVARDDELHERLFVAAGQRVPQRAERRLVDVERAELGARLRLGEPDRRDLRLAE
FT                   HRGRNVAMIGGDPLAAEQVRREQHAVARRDGRQLRARGDVADRVDRRHRRRRIGVDFDR
FT                   AVRVARDPDRLEPEPVAIRDAPRRIQHRVVRPVRALGEPERQPAVGAALDRLDRRARMD
FT                   GDTLLRHLAMQRVPHVVVEAAQDLLAAIEQVDIDAEPVEDARELDRDVAAADDRDPLRQ
FT                   LGQLERLARRDRVLDAGNRRQHRPRACRDGDVPGGDTPARDVDRMRADERRAPRMDLDA
FT                   RLVQQIDVDTAQARDLAVLRLDERRPRKQADVEGPAIARGVLDIVAVMRRVDEQLFRDA
FT                   AAQHAGAADALFLGDADARAVGRRDAAQAHAARARADDKEIVVEFHSVV"
FT   gene            504100..505461
FT                   /gene="gor"
FT                   /locus_tag="BURPS1710b_0498"
FT   CDS_pept        504100..505461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BURPS1710b_0498"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01424"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49732"
FT                   /db_xref="GOA:Q3JWZ0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ0"
FT                   /protein_id="ABA49732.1"
FT                   /translation="MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLR
FT                   GCIPKKLLVYASHYSHDVEDAAGYGWTFDIGLFSWPTLIEAKDREIARLSGIYVDLLNK
FT                   SGVEIHTGRATLVGAHTVDVAGRRVTARHIAVATGSRPVLPPIPGIEHAITSREALELP
FT                   ELPQRIAIVGGGYIAVEFAGIFNGLGVDVDLFYRGEQILRGFDDDVRHALHGEMTKQGV
FT                   AIHTRATIEAIERGADGGLTLRLAEGAYGPYDAVLYATGRVANGDGLGLEAVGVARDAN
FT                   GAIEVDAYSATTVPSIHAIGDVTARPQLTPVATRDGMLLAANLFGGKRIAADHRYVPSA
FT                   VFSQPEIATVGLTEAQARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVV
FT                   GAHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA"
FT   gene            complement(505775..507493)
FT                   /locus_tag="BURPS1710b_0500"
FT   CDS_pept        complement(505775..507493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY9"
FT                   /protein_id="ABA47881.1"
FT                   /translation="MRRGRPPPSCRPSGSRRRGPGTARTPGHPRAGASVAALVFLQLRQ
FT                   RRRFARRQQADLRIDAQLVARIGDVEVAHRQLADPVARREHRLHLLHRQALRLVREVGR
FT                   ARADDRIIVAAAQLDRHLARDRARDPALRRLAQHDRLRVEPAALVQQAAETTAVLAVLL
FT                   DRVLVVDAGDEALVCDVQQREPRGLIDAAALRLDDPVLDLVAHPEAVAPADPVRLEQQR
FT                   DRILVLDAVQRDRAPLFEADRHFFLVDLHVVAPERDAHDRIDDLDAALEALEILRLVRR
FT                   AEQVRIGRVRLLGRHLVLETGLAHEFGHFRAAAELVDELLVEPRLVDLQIRIDEQAIAV
FT                   EALDVVALVRAAVAPDVDAVFLHRGNEHRARHGAANRGRIEIRDAGRRNVERAALERRD
FT                   PFGDELRAAVDQARAFGAVLDRALRDRVVVVFVGLAEIGRVCVRNGSLDAHPVQRGARV
FT                   EAAGERNADLLAGREIFKNRGHDENRSISWKGEFRGIQEYRLCPIMRQVSRAAPAGPKW
FT                   GREGGGRGCGVDGGGVWGSRGGQGGRQSRARQARRTSRGDWIKESGARIVGPLGH"
FT   gene            506054..507394
FT                   /gene="argG"
FT                   /locus_tag="BURPS1710b_0501"
FT   CDS_pept        506054..507394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="BURPS1710b_0501"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50402"
FT                   /db_xref="GOA:Q3JWY8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWY8"
FT                   /protein_id="ABA50402.1"
FT                   /translation="MTTILENLPAGQKVGIAFSGGLDTSAALHWMRIKGAVPYAYTANL
FT                   GQPDEDDYDAIPKRAIQYGAEGARLIDCRAQLVAEGIAALQCGAFHISTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQQFI
FT                   DELGGRAEMSEFMRQAGFEYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMG
FT                   VAFWRDDVKIDKEEVTIRFEEGRPVALNGVEYKDAVALLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVARAVTGEVTVELRRGNDYSIIGTRSPNLTYQPERLSMEKVQSMFSPR
FT                   DRIGQLTMRNLDITDTRDKLRIYSQVGLLAAGESSALPKLKEDESGN"
FT   gene            507520..508191
FT                   /locus_tag="BURPS1710b_0502"
FT   CDS_pept        507520..508191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49519"
FT                   /db_xref="GOA:Q3JWY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY7"
FT                   /protein_id="ABA49519.1"
FT                   /translation="MQISHKIAGAPRLAARAARAAGAWASAPAVRINRRTAPRSGVRGT
FT                   DNKTRTETEVDMFQMLPSMTFGRRLSVWWSCMWRQTLASAPVWILGVAIVGLSISRTHS
FT                   AAGRPPSGGAAALAVATFFVCLVVCLPIAGYMVRGGFAAHALTAPERLAFRQALMVGLT
FT                   TFGWAVLAALPISVATMPLRHAGYPLAGQAIGWVLNVAAGLYIVLPRQARRLRLLAGEA
FT                   A"
FT   gene            508281..509006
FT                   /locus_tag="BURPS1710b_0503"
FT   CDS_pept        508281..509006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY6"
FT                   /protein_id="ABA49850.1"
FT                   /translation="MNRAIRMRAAVAAAAFSASLPAGAAGPAIDPGRYLYVEGGSAHGV
FT                   LTVKGNAFEIETIGGNCHTCALSGTFDGRVGIARDGENVCRIAVSGGHGDLRLDTSGSD
FT                   ACRDFCGMRASFDGEYRRPGAACTDRARDVRTERSHRQYAAHDYDAARTTLKALLAECG
FT                   GFMGWIELDRAKSDLALTEYHRGDRAQCVAVLSDTIAYRAQQDHSDAFGLPPCDADNYK
FT                   STGDAILHNLALCQAPAKR"
FT   gene            509241..509576
FT                   /locus_tag="BURPS1710b_0504"
FT   CDS_pept        509241..509576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0504"
FT                   /product="putative cheavy metal binding protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47700"
FT                   /db_xref="GOA:Q3JWY5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY5"
FT                   /protein_id="ABA47700.1"
FT                   /translation="MGTLAFDASCRAALTAAQPIQPPALDLPTVGRSILQSIHIDWRGN
FT                   MKLEVKDMSCGGCANAITQAIQTADSSARVSVDVASKVVDVGSALGIERVVAIIEAAGF
FT                   HPAVLAA"
FT   gene            complement(509552..509695)
FT                   /locus_tag="BURPS1710b_0505"
FT   CDS_pept        complement(509552..509695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49311"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY4"
FT                   /protein_id="ABA49311.1"
FT                   /translation="MLWFRRAARVHRRARRARGDGAAPGLLANRRAPPTACANDYAART
FT                   AG"
FT   gene            complement(510128..512551)
FT                   /gene="silP"
FT                   /locus_tag="BURPS1710b_0506"
FT   CDS_pept        complement(510128..512551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silP"
FT                   /locus_tag="BURPS1710b_0506"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF04945; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50952"
FT                   /db_xref="GOA:Q3JWY3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY3"
FT                   /protein_id="ABA50952.1"
FT                   /translation="MHDAHVHHDRSGDTNERRDPHRPHETKTPGETAVDPVCGMKVPID
FT                   TPRRYDYQGRTYRFCSDKCATAFRASPQRFVGTPKQRAGASAAKPGTVYTCPMHPQIRA
FT                   NAPGACPICGMALEPLTPDAAEDGNPELRSMTRRFELGLVLAVPLVLMTMGAMVLPFDI
FT                   GAGIDALLARWPRPFGMPASWSQWVQAALATPVVLWGGWPFLVRGWKSFVTRRLNMFSL
FT                   IGLGVCVAYLFSVFALLFPDTLPQAFRSGHEIPLYFEASAVIVTLVLLGQVLELRARSR
FT                   TSSAIRDLLQLAPHTAVRVNPDGSEQTVPLDAVVVGDTLRVKPGSKVPVDGIVVAGHSS
FT                   VDESMITGEPVPAEKTEGSPVTGATVNQTGTFVMRAQKIGTDTLLARIVQMVAEAGRSR
FT                   APIQKLADQVSGGFVLAVIVLAALAFAAWAAFGPAPALANALVVAISVLIIACPCALGL
FT                   ATPVSIIVGVGRGAREGVLIKDAEALELMEKVDTVVVDKTGTLTEGRPRVQTIVALGGQ
FT                   SERALLGDAASLEGASEHPLAQAIVEHAARMGAERKPVASFDSVPGKGVKGTLDARTVA
FT                   LGNAHLMADLAIDCTAADADSNRLREAGQTVMYVAIDGQLAGYIGVADPIKETTPDAVQ
FT                   LLKASGTRIVMLTGDNPVTANAVARTLSLDGVKAGVLPEDKYRHVQALQQQGHVVAMAG
FT                   DGVNDAPALAQANVGIAMGTGTDVAMNSARIVLVKGDLRGIARARALSVATMKNIRQNL
FT                   FFAFVYNAVGIPVAAGVLYPWFGITLSPIFASAAMAASSVSVIGNALRLRGAKT"
FT   gene            510488..512905
FT                   /locus_tag="BURPS1710b_0507"
FT   CDS_pept        510488..512905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY2"
FT                   /protein_id="ABA47863.1"
FT                   /translation="MPLLLQRLHVPVLVLGQHARLHAVERQRPGDRVRGDGVVARQHHD
FT                   ARARRLEQLHRVRRRLLDRVGNADITGKLPVDRDVHHRLAGFAQAVRIGVGRRAVDREI
FT                   RHQVRVAERDRAGVEGAFHAFSGHRIERRDGLALGAHPRGVLDDRLRERMLARALEARR
FT                   IAQQRALGLPAERDDRLHARAPLGQRAGLVDDDGIDFLHQLQCFGILDEHALARAAADT
FT                   DDDRHGCREAERARAGDDEHADRHHERVRERGSRTERRPGGERERGEHDDGEHEPAGHL
FT                   IGEFLDRRARAPGLGDHLHDPREQRVGADLLRAHHEGARLVDGRARHRAALGLLGGHRL
FT                   AGDHRFVDARMPGDDDAVDRHLRAGLHAQRVADDDRVERHGLLRAVGIHAHRRVRRELQ
FT                   QVADRARRARARAQLEHLAEQHERHDHRGRLEVERDFVAAAKRLRQRVGEQQRKHAEQI
FT                   RHADAKPDQAEHVQPPRDERLPAAHEKRPAAPQHDGRRERGLHPLRPRCRHSERPRPAR
FT                   EQRVDAGADVERQHHRTHRHQHERHGQHEPELEAPRHRSELGIAVFGGVRRERLERHST
FT                   DRAGTRRVRAYLRVHRARVDRARLRRGCAGPLLRRADEPLRRRAERRRALVAAEAIRAA
FT                   LIVVSTGCVDRHLHSADRIDRRFARRLRFVRAVRIAPFVRVAAAIVMDMCVVHGKRSCR
FT                   VGGCRCLRRRARPERAACRIAAPRHRGGHDSMLRACGRLRAPPARDARARSATPLPGAL
FT                   PARPALPPALARGEQYRVPARAEAPATAIANRAEAFVSGPEQAARMRMAVSL"
FT   gene            513216..513890
FT                   /locus_tag="BURPS1710b_0508"
FT   CDS_pept        513216..513890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0508"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50865"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY1"
FT                   /protein_id="ABA50865.1"
FT                   /translation="MRFHSSAPRAAATWIRLIRAALLAAFALTLSGCGYNAIQVQDEQV
FT                   KASWSEVLNQYQRRADLVPNLVNTVKGYANQERDVLTRVTEARAQVGSIRATPELLSDP
FT                   QAFAKFDAAQGQLTSSLSRLLVVSENYPQLKSDANFRDLQAQLEGTENRITVARNRYIR
FT                   SVQAYNTTIRSFPSNLTAMAFGYKEKPNFSVENEAQIAKPPRVDFGTSSAPAPAPAAGA
FT                   SN"
FT   gene            513887..514735
FT                   /locus_tag="BURPS1710b_0509"
FT   CDS_pept        513887..514735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0509"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51127"
FT                   /db_xref="GOA:Q3JWY0"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY0"
FT                   /protein_id="ABA51127.1"
FT                   /translation="MKGFLRAACFAILTFLSIGGACRAEQPVPPLAARVTDETGTLTAA
FT                   ERATLEQSLKDFETRKGSQIAVLIVPTTQPETIEQYSIRVVEQWKLGRANVDDGALLII
FT                   AKNDRALRIEVGYGLEGVLTDATSRRIIDELIVPSFRRGDFYGGVSAGVGGMMRVIEGE
FT                   PLPPPRARGGEEGGLGRVLPLLFVMTIVAGGVSRAIFGRLAGSVVTGGVVGFVAWLWSG
FT                   ALLVAIAAAAIALFFTLLGSGMGARVGGPFIGGRGGRGGGNDGFRGGGGGFGGGGASGR
FT                   W"
FT   gene            514735..515232
FT                   /locus_tag="BURPS1710b_0510"
FT   CDS_pept        514735..515232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49720"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX9"
FT                   /protein_id="ABA49720.1"
FT                   /translation="MDIARIARHLSMTRWRVAAAFPRRTLGKIERAIEASHEKHVGQLR
FT                   FAVEGALHASMLLRGITARERAIDVFSELRVWDTEHNNGVLIYLLLADHDVEIVADRGI
FT                   HARVDGDEWERVCRAMEAQFRRGRFEAGSIHGIEAVTALLARHYPSRRAPGDALPSTPV
FT                   VL"
FT   gene            515266..515733
FT                   /locus_tag="BURPS1710b_0511"
FT   CDS_pept        515266..515733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48422"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX8"
FT                   /protein_id="ABA48422.1"
FT                   /translation="MRAATCNPIASNIARRTANHGYFAALYSCAMKIVRLLLVLLWCAT
FT                   LPLTGLAASGLAGDCPMQQAMSMSEDGAMPSMQDCESMRSSVAGKSGKAGKAANVFCKV
FT                   MVQCQFGSLYHPMPAADVARPASPGRPLVFHYAKSLTVREPGGLWRPPRTA"
FT   gene            515832..517133
FT                   /gene="silC"
FT                   /locus_tag="BURPS1710b_0512"
FT   CDS_pept        515832..517133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silC"
FT                   /locus_tag="BURPS1710b_0512"
FT                   /product="outer membrane efflux protein"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48943"
FT                   /db_xref="GOA:Q3JWX7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX7"
FT                   /protein_id="ABA48943.1"
FT                   /translation="MYSMLRAPHGRRARLHARTLVAALTFANAAAAFAQSAPLTLDAAL
FT                   QSAADRSAAMQAAQASVQASAELAVKAGQLPDPMLKAGIDNLPVDGPQRFTIGQESMTM
FT                   RRIGIAQEWVSGDKRRLRTALANEVVGRERAGYLAQLADVRRQTAIAWLDAAYAKKALA
FT                   LQRELADEMNRELAATQAAYRGAKATAADALQARALLAQARDRQANARQAFDTALIGLS
FT                   RWVAAPTLDVAGEPPAPVSFVPSLPPDELRRVQPTLIAADEDVEVADADVALAASERRP
FT                   NWTWEIAYQQRGAPYANMVSIGVTIPLPLDRRDRQDRDVAQKRALATKARLMYEDARRQ
FT                   VDADIRTQSATLESGRARLAELGRALLPAADERVRLADAAYRAGAGSLADAFAARRARL
FT                   DARLQVLDLERDVARAWAQLDYQIVPSAMLAAAQ"
FT   gene            517144..518715
FT                   /gene="silB"
FT                   /locus_tag="BURPS1710b_0513"
FT   CDS_pept        517144..518715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silB"
FT                   /locus_tag="BURPS1710b_0513"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48108"
FT                   /db_xref="GOA:Q3JWX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX6"
FT                   /protein_id="ABA48108.1"
FT                   /translation="MNHIRLTRAALAVLAAVALSAAGYFAGARFGAHVDVAHRAHATNT
FT                   TNAVDGADAKPGRKVLYWRDPMVPNQHFDKPGPSPFMDMPLEPVYADDGGGAPGVRIDP
FT                   GLQQNLGIRYAKVRRRDVDEGFDAVGTTQFDESRTAVVQSRVTGYVDRLYASAPLQRIA
FT                   KGAPIASLFVPDWLAPQEEYLALKRGAMDEALLAASRARMRALSIPDSVIANLDRTGRA
FT                   QTHIVLASPETGVVSELNVRDGAMVTPGQTLAKIAGLSTLWAVIDVPEALASGVRPGMR
FT                   VDATFEGDPQRRVSGAIREILPGVNATTRTLQARLELDNRALALTPGMLMRARVGASHA
FT                   ASRLVVPSDAVIATGKRSVVIVRTADDRLRPADVTVGRDAGDETEVLAGLEEGETVVAS
FT                   GQFLIDSEASLKSVLPRLEADASGALAARAARPPARSSPPAAQAGGAAPVYETTGKVEK
FT                   ITAADITFSHQPVPALGWGAMTMSFDKPAPAAFANVKAGDTVRFAFEANGDGYRLTKVE
FT                   PVGGAR"
FT   gene            518712..521924
FT                   /gene="silA"
FT                   /locus_tag="BURPS1710b_0514"
FT   CDS_pept        518712..521924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silA"
FT                   /locus_tag="BURPS1710b_0514"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00914"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51050"
FT                   /db_xref="GOA:Q3JWX5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX5"
FT                   /protein_id="ABA51050.1"
FT                   /translation="MIAHVIRWSIRNRLLVLLATALVAAWGVVSLNRTPLDALPDLSDT
FT                   QVIVKASYPGKAPRVVEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDRTDQY
FT                   WARSRVLEYLNQVQGRLPQGASVALGPDATGVGWVYEYALVDRSGRRDLGELRALNDWF
FT                   LKFELKAVPDVAEVASVGGMVRQYQVVLDPDRLRAFGITQAAVADALGKANSESGGSVV
FT                   EMAESEYMVRASGYLRSLDDFRNVVLRTSESGTPVLLGDVARVQIGPEMRRGIAELNGE
FT                   GEVAGGVIVMRSGKNALSTIEAVKAKLAELRRSLPAGVELVTTYDRSQLIGRAVDNLKD
FT                   KLIEEFVVVGLVCALFLFHLRSAFVAILSLPLGVLAAFIVMRHQGVNANLMSLGGIAIA
FT                   IGAMIDAAVVMIENAHKHLESHEHAHPGAPLSSAARWELIAASAAEVGPALFFSLLIVT
FT                   LSFVPVFALEGQEGKLFAPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPREASNPL
FT                   NRLLVRLYRPLLEATLARPWRAIAIAAAALVLTAIPMSRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAQKAAELLQQTDRLIKTVPEVATVFGKSGRADTATDPAPLEMFETTIRFRPRGE
FT                   WRPGMTPGRLVDELDRVVKVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKIAGPELAQID
FT                   RIAAQVEAAVKRVPGVTSALAERLNGGRYVDVDIDRRAAARYGLSVGDVQAVVASAIGG
FT                   ENVGEVIAGRERFPINIRYPREVRDSLEKLRALPIVTERGAQILLRDVAAVTIADGPPM
FT                   IRSENARLSGYVYVDIRGVDLKTAVGAMQRAVAQQVALPPGYSIAWSGQFEYLERAAAT
FT                   LRTVIPVTLAVIFVLLFLTFDSAADALLLMTTVPFALVGGLWFVWALGHAVSVATAVGF
FT                   IALAGVAAEFGVVMLLYLKRAYERRIAAGEPPNEATLADAIREGAVLRVRPKAMTVAVV
FT                   LAGLVPIMIGHGSGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWLLLQRRRMRGAARAA
FT                   SQAPVAGAAGADFSSIHTGESR"
FT   gene            521807..522262
FT                   /locus_tag="BURPS1710b_0515"
FT   CDS_pept        521807..522262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0515"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50196"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX4"
FT                   /protein_id="ABA50196.1"
FT                   /translation="MAPVAAPPHARRGPCGVAGPRCRRCRRGFFVHPYRRISMKQWIAA
FT                   LMTLAAAAAPAFAAEAAAGPNTPAPPRDARPPAGDALTEAVVRQVDLATGMITLKHGAL
FT                   DNVGMPPMTMTFKAKDIAMAKRVRAGDSVRVRVENVDGVMTVVKLEK"
FT   gene            522298..522909
FT                   /locus_tag="BURPS1710b_0516"
FT   CDS_pept        522298..522909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0516"
FT                   /product="avidin family protein"
FT                   /note="identified by match to protein family HMM PF01382"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48484"
FT                   /db_xref="GOA:Q3JWX3"
FT                   /db_xref="InterPro:IPR005468"
FT                   /db_xref="InterPro:IPR036896"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX3"
FT                   /protein_id="ABA48484.1"
FT                   /translation="MPRDARAARASARDASVAQRVPRGRRRDSRRKVARRRMRCTIVLG
FT                   IRAASPIKEALARPAPRPGRLPSIHRSGRRNMQRLEHVLRRVKAGTGAPIDFSGTWKNE
FT                   LGSTMRIEQSGDSVSGTYESAVSENGGATSGQLSGYVDGDLIAFVVHWDQFQAITAWVG
FT                   QGGPGASSDRINTLWQMTQQVEAGEEWASINAGADIFVKT"
FT   gene            complement(522984..524816)
FT                   /gene="glmS"
FT                   /locus_tag="BURPS1710b_0517"
FT   CDS_pept        complement(522984..524816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BURPS1710b_0517"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47673"
FT                   /db_xref="GOA:Q3JWX2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX2"
FT                   /protein_id="ABA47673.1"
FT                   /translation="MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLDAGAPAPG
FT                   TPKRARSVARVADLDAQVRESHLEGETGIAHTRWATHGAPVTHNAHPIFSSDALALVHN
FT                   GIIENFEPLREALRAKGYAFVSQTDTEVIAHLIHSLYRGNLFAAVQQAVKQLHGAYAIA
FT                   VTHKDEPHTVVGARQGSPLVVGFGERENFLASDALALAGSTDRFTFLEEGDVCELKLEG
FT                   VTVVDRDGARAARDVRVVAAYGGAVELGPYRHFMQKEIFEQPRAIADTIAQTDAFDPPL
FT                   FGERASSVFAGIDSLLILACGTSYYSGLTAKYWLESIAKIPTQVEIASEYRYRESVPNP
FT                   RALVVVISQSGETADTLAALKHAQALGHAHTLAICNVATSAMVRQTELQFLTHAGTEIG
FT                   VASTKAFTTQLVALFVLAATLGKLRGHVDAAREADYLKQLRHLPAALNSVLALEPQIIA
FT                   WSDEFARKENALFLGRGLHYPISLEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMP
FT                   VVTVAPNDTLLEKLKSNMQEVRARGGELYVFADADTHIVNDEGLHVIRMPEHYGPLSPI
FT                   LHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            complement(524880..526565)
FT                   /gene="glmU"
FT                   /locus_tag="BURPS1710b_0518"
FT   CDS_pept        complement(524880..526565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BURPS1710b_0518"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49097"
FT                   /db_xref="GOA:Q3JWX1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWX1"
FT                   /protein_id="ABA49097.1"
FT                   /translation="MARIARRPAPPGHACSPARRTLSRPARHIRLASSPAPPDLARLPD
FT                   RFGATRRRPRGRLALPAFVRLERTSRPRPPAAAAPGPPGCPAAPDGARMLEWPASNSPY
FT                   ETGAMNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARALAPSRLVVVIGHGAE
FT                   QVRAAVAAPDVQFAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTRTATLKRLAD
FT                   AATDARYGVLTVTLDDPTGYGRIVRDQAGCVTRIVEQKDASPDELRIDEINTGIVVAPT
FT                   AQLSMWLGALGNDNAQGEYYLTDVVEQAIEAGFEIVTTQPDDEWETLGVNSKAQLAELE
FT                   RIHQRNLADALLAAGVTLADPARIDVRGTLACGRDVSIDVNCVFEGDVTLADGVTIGAN
FT                   CVIRHAAIAAGARVDAFSHLDGATVGANAVVGPYARLRPGAVLAADAHVGNFVEVKNAT
FT                   LGQGSKANHLTYLGDADIGARVNVGAGTITCNYDGANKFRTVIEDDVFVGSDTQFVAPV
FT                   RVGRGVTVAAGTTVWKDVAADMLVLNDKTQTAKSGYVRPVKKKS"
FT   gene            complement(526819..527814)
FT                   /locus_tag="BURPS1710b_0519"
FT   CDS_pept        complement(526819..527814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0519"
FT                   /product="PP-loop family family"
FT                   /note="identified by match to protein family HMM PF01171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50365"
FT                   /db_xref="GOA:Q3JWX0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWX0"
FT                   /protein_id="ABA50365.1"
FT                   /translation="MNAPHTPHLNEAEAAAAVEANAAELGRRALTRREQKEAYENNKLF
FT                   KRLVRQVGQAIGDYNMIEHGDKVMVCLSGGKDSYALLDILLRLRERAPIDFDIVAVNLD
FT                   QKQPGFPEHVLPEYLTKIGVPFHIENQDTYSIVKRLVPEGKTTCSLCSRLRRGILYRVA
FT                   GELGATKIALGHHRDDIVQTLLLNMFYGGKLKGMPPKLQSDDGKNIVIRPLAYAKETDL
FT                   EKYAELREFPIIPCNLCGSQPNLKRAEMKALIRDWDKRFPGRVDNMFNALANVVPSHLM
FT                   DARLFPFAGLRATGEADPNGDIAFDEDPCGTDASAPGGAKSVSIVQFDDL"
FT   gene            complement(527811..528242)
FT                   /gene="folB"
FT                   /locus_tag="BURPS1710b_0520"
FT   CDS_pept        complement(527811..528242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BURPS1710b_0520"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48612"
FT                   /db_xref="GOA:Q3JWW9"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW9"
FT                   /protein_id="ABA48612.1"
FT                   /translation="MPHPLTGTTMFAALLHPRLADCRRLYLRNHEVYMNIGAFEHEKRG
FT                   EQRVVINVDLFVPLALTTPVEDRLREVVDYDLMKQSVAQCVARGHIHLQETLCDAIAAS
FT                   LLAHDAVRAVRVSTEKPDAYPDCDAVGVEVFRIKDEERA"
FT   gene            complement(528297..529232)
FT                   /locus_tag="BURPS1710b_0521"
FT   CDS_pept        complement(528297..529232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0521"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49419"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW8"
FT                   /protein_id="ABA49419.1"
FT                   /translation="MTVPADTCDTSAARTARVVLITGAVQTGAAPARAAEAARAGARQA
FT                   IGAGRPGDAQPGASAPAGAPAHPPRAGEQQAQAPSAPPAARPAPDAAAVGRALAVGFAR
FT                   RGWNVALAAAAGDEARAAAALAAEVEALGRRAAVLAADLAIEADVARLVADCGAALGRP
FT                   ACVIAQAAPVADTARDVGYASLAGAMARSVAAPLVLARTLADATPDAARDDERERAVVI
FT                   HLLDETLFHPAPERLSHSLAQAALHRATAAQALALAPKVRVVGLVGGRAPRADDIADAA
FT                   CYLADAPGVTGATLTVDGGEHLAPPADERN"
FT   gene            528327..529274
FT                   /locus_tag="BURPS1710b_0522"
FT   CDS_pept        528327..529274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50793"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW7"
FT                   /protein_id="ABA50793.1"
FT                   /translation="MLAAVDGQRRARHAGRIREIARGVGDVVRARRAPADEPDDAYLRR
FT                   ERERLRRRRAMQRGLRERVRQPLGRRMKQRFVEQMNHDRTLAFVVARGVGRRVGERARE
FT                   HERRGDAARHRARERRVADVARGVRDGRGLRDHAGRPAERRAAIGDEPRDVRFDRQIGG
FT                   EHRRAAAERLDFGGERGGRAGFVARRGRERDVPAAPREADGERAADGRGVRRGPRGRRR
FT                   ARRLRLLLAGARGMCRRTGWRRCAGLRIARPAGADGLPRARPRRLGGARWRGARLHGAR
FT                   NQHDPRGAGRGCVAGVGWDGHLQCRDESESSRTR"
FT   gene            529204..530436
FT                   /locus_tag="BURPS1710b_0523"
FT   CDS_pept        529204..530436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02636"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47745"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW6"
FT                   /protein_id="ABA47745.1"
FT                   /translation="MSQVSAGTVIYNAGMNPKAHEPASLPVPGPDALAQSDALAASLRA
FT                   EIAAAGGWIPFSRYMERVLYAPGLGYYSGGAQKFGRRGDDGSDFVTAPELSPLFAQTLA
FT                   RPVAQALAASGTRRVMEFGAGTGQLAAGLLNALAALGVELDEYAIVDLSGELRARQRET
FT                   LDEQASGAAARVRWLDALPERFEGVIVGNEVLDAMPVQLVAKHAHGWCERGVSLGDAGA
FT                   FAFADRPLARAEDAARLAALDADEGYVTETHDAAAAFVGTVCAMLARGAALFIDYGFPR
FT                   HEYYHRQRAQGTLMCHYRHRAHGDPFVYPGLQDITAHVEFSAVYEAGVGAGAELLGYTS
FT                   QARFLLNAGITDVLAEIDPSDAQRFLPAANAVQKLISEAEMGELFKVIAFSRGIDGTLD
FT                   AFARGDRSHTL"
FT   gene            530454..530648
FT                   /locus_tag="BURPS1710b_0524"
FT   CDS_pept        530454..530648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0524"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49972"
FT                   /db_xref="GOA:Q3JWW5"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW5"
FT                   /protein_id="ABA49972.1"
FT                   /translation="MLRWLLTTFIAVMVLTRAWPWLAKLGVGRLPGDVTLRLGSRVYPF
FT                   PFMSTLVIMGIVSVIARLW"
FT   gene            complement(530937..532394)
FT                   /locus_tag="BURPS1710b_0525"
FT   CDS_pept        complement(530937..532394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW4"
FT                   /protein_id="ABA50853.1"
FT                   /translation="MEARDERRISAIRIGGRHSHRHGAHRRRALDLAPGRRGLERRARG
FT                   RAARRAERVRGRGGPRLLLRRAVARKRGGRPRSALPAARRACAAPRDRPRDAAPRVFLH
FT                   RREQRRSRLRSAAAARRLARAREVGAFRLHQPRARAARVDARRARRRAARSGREDQLRS
FT                   ELPESDDGQLPADAREDGRTRRSDQGVRRRSAPPVRGRRRSERDRAAARAQPARGAARH
FT                   ARAGHGDALRGRRDDRRTAAAHRGSRYGRRGRRDDRRPAVQPDDGAGARLARASVVRAR
FT                   GGRGGVPAHGRARADARRSRRARRGVTYAPAGAGAETFRAWNARRGDSRRVGGCLQRVP
FT                   EEDSPIGRAPADERTPPASHRAARCMPEAPAPIPGAAMRGPLELAHRAFLPPLKAGRRN
FT                   ATMGASFLGRGIMDGGNTYTKGLYTAKAHTRKTDNGRFQGYVILSRDEGGAPENTLYEV
FT                   EATSANEAEAFDEAKALAHRILGDLEL"
FT   gene            complement(531473..532381)
FT                   /gene="cscK"
FT                   /locus_tag="BURPS1710b_0526"
FT   CDS_pept        complement(531473..532381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cscK"
FT                   /locus_tag="BURPS1710b_0526"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48319"
FT                   /db_xref="GOA:Q3JWW3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW3"
FT                   /protein_id="ABA48319.1"
FT                   /translation="MSAGFPQFVSAGDILTDMVRTGGAHWTSRPGGAGWNVARAVARLG
FT                   APSACAGAVGRDCFSDELWRESEAAGLDLRFLQRVERAPLLAIVHETQPPAYFFIGENS
FT                   ADLAFDPQRLPDGWREHVKWAHFGCISLVREPLASTLVALAAELREAGVKISFDPNYRN
FT                   LMTDSYRPTLARMAELADLIKVSDEDLRHLFAGDDEASAIARLRALNPRAALLVTRGPD
FT                   TATLYAGGETIDARPPRIEVADTVGAGDATIGGLLFSLMTVPARGWRAHLSFALAAGAA
FT                   ACRHTGAHAPTLDEVVALVAA"
FT   gene            complement(532378..533835)
FT                   /locus_tag="BURPS1710b_0527"
FT   CDS_pept        complement(532378..533835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0527"
FT                   /product="N-acylglucosamine 2-epimerase (GlcNAc
FT                   2-epimerase) family"
FT                   /EC_number="5.1.3.8"
FT                   /note="identified by match to protein family HMM PF07221"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49200"
FT                   /db_xref="GOA:Q3JWW2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW2"
FT                   /protein_id="ABA49200.1"
FT                   /translation="MTTSATPAPRPAPAAPPAAAPYVASFRDPQFLLAHVEDTLRFYAP
FT                   HAFDPTGGFYHFFRDDGSVYDRTTRHLVSSCRFVFNHAMAYRHFGDARDLAYARHGLRF
FT                   LRDAHWDAEHEGYDWEIEWRDGAKRATRDGTRHCYGLAFVLLAAAHAAMAGVEEAKPLI
FT                   AHTFDLMEHRFWDRAAGLYADDATPNWTVSSYRGQNANMHATEALLAAYEATGHLTYLD
FT                   RAEKIATNIVQRQAALSQGLVWEHFHADWSVDWEYNKEDSSNIFRPWGFQPGHQTEWAK
FT                   LLLILERHRPLDWLVPRAIELFDAAFAHAWDSDHGGLCYGFGPDYTVCDHDKYFWVQAE
FT                   SFAAAALLAQRTGSERFWDWYDEIWRYSWAHFVDHRHGAWYRILTCDNRKYSDEKSPAG
FT                   KTDYHTMGACYEVLHTLASTRDDSGRGANAGGGAGDDDRAPRAAHDNGRGGGGKGGGKS
FT                   GGTDDHGHRGEGDAADGAGRRRNGGAR"
FT   gene            complement(533832..534851)
FT                   /gene="rbsR"
FT                   /locus_tag="BURPS1710b_0528"
FT   CDS_pept        complement(533832..534851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="BURPS1710b_0528"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50003"
FT                   /db_xref="GOA:Q3JWW1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW1"
FT                   /protein_id="ABA50003.1"
FT                   /translation="MGTTIRDVAQAANVSIGTVSRALKNQPGLSEATRARIVEIAHRMN
FT                   YDPTQLRPRIKRLTFLLHRQHNNFATTPFFSHVLHGVEDACRERGIVPSLLTTGPTDDV
FT                   IRQMRPHAPDAIAVAGFMEPETLEALAATGRPLVLIDIRAPGLRSINVDNAGGAALAMH
FT                   HLFASGRRRVAFIGGSLAHYSIAQRALGYRRAFFDAGMLFDPSLELSIDTSLGPDAGAA
FT                   NAMRQLLDAGGALPDAVFAYNDAAALAAMRVCVERGVRVPEDIAFVGFDDIPAAAHAAP
FT                   PLTTLAIDKEALGRQGVELLLADSPAQAELSLPVQLVARASSAGAARAPRTLTSVLGS"
FT   gene            complement(534948..538379)
FT                   /locus_tag="BURPS1710b_0530"
FT   CDS_pept        complement(534948..538379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48230"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW0"
FT                   /protein_id="ABA48230.1"
FT                   /translation="MRCAGNVHRHAFESLIDSSNEFAYSIAGHDNIRPTFAAPPAIERP
FT                   APPPHSIETRNGAFPLRSRQLHARARRHRRARELPAVPRRGRARVQLGDRHRGRPAVLP
FT                   ARREALARSDRRGRDALAAACARAAQHVRAVPAARPGAQARAHAARHARAVRRRAVSLH
FT                   AAVDGAVVDRVHVDRQGQRAGGRLLGVRVEPARHLRHAGARRRDGVDAGHGRDGVAVEH
FT                   DRRDRDATARAVRRRPVAAAGDRPLDRAQSRRAALRRSGLDPARRLRRVQRSGERGALA
FT                   PDPADGARGPRRRQRRVARDRARGHDGRQQAARFQPRGPDHDHLLRLEEKPRGRRADGE
FT                   GDLRRARGGRGRAAADAVPSDSADDLRGARAALGRARHEPRTAGGRARRRGARFGRERG
FT                   EALSGGRRGPASARPPRLRRRSLQEEALLRFSASPLLRFSASPLLRFSASPLLRFSASP
FT                   LLRFSASPHPTFPQPHAPRSSRTASRFPDCVDASNFPAISAETASASRHAATSRHAATR
FT                   SERAALPLIRTARRSPLGRPPASRRRAAAVPPARRARRRPPPQTGASLHEKFIQPRFRS
FT                   AVKPASRHGPTRHERGAPPPESLDEHHPPHRQDPSAHPRRDRRPRARRRGRHRPRGGRA
FT                   RRRRAHARLRRPRENAAANLVGRRTRHAGALRGRRRRARSVRRENRSGRRGGGARRRRD
FT                   RSPARRLSRDAARGRRARAGGAPRRRLGDVARQGHPARRRSAEGKQPVRSAMGRHANAR
FT                   SRCATREGRSRAVAPEPARGRATRVRPRARRRAARPVGGRGLRARGRRRRRDPVRGDGA
FT                   RARAAVGRRAGLRGERRERDRVRQSRARPARGRRRSRQRAARDARDARAPRGDDRHAAA
FT                   RGRRDRARDVRHRARQSRLVAPHRRTRGRPAADGEQHGAARGDGAHERRPRAAGERARA
FT                   RRIDAGRTGRRRRARRDRADGGALGTLAADPQHLVDDRGHRLPDQSARAERRRRGGARR
FT                   AGGTRFRGRRAGGARPRAQQRAGREGNLGADRRRDGRSRARRGHGEGRRQHDRRHARVG
FT                   AAGRDARRRNLARVRRAAFRHRPGKPRGRADGRDDAAQRAARAKGGGRRGRARRRGGRA
FT                   ARGRRDLPGRRVNAVHVGTPSCLVFLVNDYDLIYRL"
FT   gene            complement(535022..536581)
FT                   /gene="cheD1"
FT                   /locus_tag="BURPS1710b_0529"
FT   CDS_pept        complement(535022..536581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD1"
FT                   /locus_tag="BURPS1710b_0529"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49282"
FT                   /db_xref="GOA:Q3JWV9"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV9"
FT                   /protein_id="ABA49282.1"
FT                   /translation="MNTTRLTVKTRLRILVAIVVLVLAAAGGIGLAGVARVGDALTHVF
FT                   EDRAKTLQRISSVDELVTQARYAVGDAVLDPSAAKTEAVAAAAARDVAAIDRLLADFRA
FT                   TPRAGAEREQAERLAADWATLRDKGIRPAVDLLKANNLSEAQWVVTQTLDPVAQRVKGE
FT                   AAQLRQNQLEAAQRAYDRARGVARLVQWAVAGCVLAGVAAVAILCAAMARALARQLGGE
FT                   PDYAASVANEIASGNLALDLHAADAAAGSVLHAMHAMRARLAATIGTLQRAADAIAHAT
FT                   SDIAHGNHDLSRRTDEHAAGLQQTASSMEQLAATVRTNADHARQASALALAASTQAEQG
FT                   DAAARDAIARMEALSVRSQQIRSISSTIEGIAFQTNLLALNAAVEAARAGQAGRGFAVV
FT                   AQEVRGLAHSSAQAAKEISALIADVTGEVELGADTVKAAGSTIVGMLASVRQVATLVDE
FT                   ISHASDEQRSGIDQVSRAVAQMDEMTQHNALLVQKAAGAAGALADEAAALREAAAIFRV
FT                   VA"
FT   gene            536849..538285
FT                   /locus_tag="BURPS1710b_0531"
FT   CDS_pept        536849..538285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0531"
FT                   /product="Atu, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50975"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV8"
FT                   /protein_id="ABA50975.1"
FT                   /translation="MWRRDGMPMRFQRRWRGNSMHRRSREIAKPCGCCGGHGAAGTSGA
FT                   EKRRSGEAEKRRSGEAEKRRSGEAEKRRSGEAEKRRSGEALPPASFAGAGAAAAPRPAR
FT                   VARRSALRRARARTERPGAGRVRQPFAARVARAPALRERRAGHQLNLMEQHQRQHDRAH
FT                   RVRGEDHLRHRHAGREAFLRAAEDDRDLVRAVETEPLADDRRDRERDREQHDVDDGEAR
FT                   ERRRRDLVPEPLVHRFAERDVDDEQDRALIDEAQHAAIALDPAADHRPQQLAGDERHEQ
FT                   LHHDRADRAPRRRRRARALRRHHHADERRRDEDAEQARRGRRADGRRHVALGDRRERDR
FT                   RLHRRRQRAEKQHAGVQRGRDERREHGLERQAEQREQRERAEQHERMQPPVRRARDDRF
FT                   ARELRAVQEEQQADRDVGRPVERVRGLAAARQEAREHDGADEREREVVGNEAGTRHFGS
FT                   RSSAVEAPAARWRAARRMSA"
FT   gene            complement(537173..538321)
FT                   /locus_tag="BURPS1710b_0532"
FT   CDS_pept        complement(537173..538321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0532"
FT                   /product="sodium/bile acid symporter family protein"
FT                   /note="identified by match to protein family HMM PF01758"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49865"
FT                   /db_xref="GOA:Q3JWV7"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV7"
FT                   /protein_id="ABA49865.1"
FT                   /translation="MNLPIQSPATTISGRHSPRRPPSSGRRLHRTRSRPEMARSRFVPD
FT                   NFTLALVGTVVLASFLPCRGEAAHAFNWATDIAVGLLFFLHGAKLSREAIVAGATHWRL
FT                   HALVLLSTFALFPLLGLALKPVLTPLVTPALYAGVLFLCTLPSTVQSSIAFTSIAKGNV
FT                   PAAVCSASASSLLGIFVTPALVGVMVSTQGTGATASPWSTIGAIVMQLLVPFVAGQLLR
FT                   PVIGRWIERNRGVLRFVDQGSILLVVYVAFSEAVNEGLWHQIPPTALAGLAVVNVVLLA
FT                   IALAVTTVVSKRLGFNRADQITIIFCGSKKSLAAGVPMAKVIFAAHAVGAVVLPLMLFH
FT                   QIQLMTCAALAQRWGARDTSRERLADAPGAGALGSGASAAKR"
FT   gene            538596..539072
FT                   /locus_tag="BURPS1710b_0533"
FT   CDS_pept        538596..539072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0533"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48702"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV6"
FT                   /protein_id="ABA48702.1"
FT                   /translation="MMTERAIRKIGQWAAGVTCALAAVLVFAQPPHGGGPGFGGGRGGV
FT                   PAMAGGWRGAPGYLQAAPHGGEARIGVNGYRQRWGLRPTPSYGRYAAQSPYRPISAEAR
FT                   PAPHASGPGNVPMRAGSIRADVARYNEERGGRPAPAPRQDDSQRLPFFAPFSRN"
FT   gene            539393..540556
FT                   /locus_tag="BURPS1710b_0534"
FT   CDS_pept        539393..540556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0534"
FT                   /product="putative outer membrane porin protein precursor"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49741"
FT                   /db_xref="GOA:Q3JWV5"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV5"
FT                   /protein_id="ABA49741.1"
FT                   /translation="MATPPNGIASSGRRPPVRLASVRRQSGDHMKSSFSRALQTTFACA
FT                   AVAALAAGASGARAQSSVQLYGQVDEWIGAQKFPGGQRAWGVQGGGMSTSYWGLRGTED
FT                   LGGGYQAIFTLEDFFRAQNGHYGRFDGDTFFGRNAYVGLATPYGTVRAGRLTTQLFIST
FT                   ILFNPFIDSYVFSPMVYHVFLGLGTFPTYTTDQGVVGDSGWNNAIDYTSPSFGGLNAAA
FT                   MYALGNTAGDNRSKKWSGQLNYSSGPFAATAVYQYVNFNGGPGDLGALVSGMKSQGVAQ
FT                   LGLSYDFKLAKIYAQYMYTKNELNTGSWHVNTAQGGVSVPLGPGSALASYAYSRDSGGH
FT                   DQTRRTWALGYDYPLSKRTDVYAAYMNDRYSGMSGGDTFGAGIRAKF"
FT   gene            540590..541678
FT                   /locus_tag="BURPS1710b_0535"
FT   CDS_pept        540590..541678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0535"
FT                   /product="LysR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50460"
FT                   /db_xref="GOA:Q3JWV4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV4"
FT                   /protein_id="ABA50460.1"
FT                   /translation="MHEKVSGVTFGGAVLPFLTFSIHQLCYSCLRLHNSPRLRAFRMDT
FT                   LVSMNVFRYVVEVGSFVGAAERMEMSAAMASKHVMHLEHQLGARLLHRTTRRVAPTEAG
FT                   REYYERLVQALTELDEAGQAVGAASVVPQGRLRVTSLSAFGLRHVMDAVTSYAERYADV
FT                   TVEITLSDRVVELIDEGYDVAVRAAPAGMKSSSLVARQIATAHILLVASPDYLAKHGTP
FT                   ATIADLQHHSFIRREPNETLLDAAISEVAAASRVPMSGNVIVNHLEGLRVAVLGGAGIA
FT                   LLGTEVVGEDIESGRLVPLLLDALPPRELPIYAVYASRRHVSAKVRSFVDFLADRFAGQ
FT                   SLCPSIDERLRQLAMPRMKRLG"
FT   gene            complement(542124..543083)
FT                   /locus_tag="BURPS1710b_0536"
FT   CDS_pept        complement(542124..543083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0536"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47592"
FT                   /db_xref="GOA:Q3JWV3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV3"
FT                   /protein_id="ABA47592.1"
FT                   /translation="MALPAVLQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQLQTQLAEHKAANPDAVIGPIAVNQIVHQSNVRLEQDIRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHGYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATQEAHAVDAYKR
FT                   AILEAKSADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGGDKAKAWKDI
FT                   WGAGQGVGLMDDVPSVAELVARLKREYDDAKARLGIRA"
FT   gene            543322..544272
FT                   /gene="dehH"
FT                   /locus_tag="BURPS1710b_0537"
FT   CDS_pept        543322..544272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehH"
FT                   /locus_tag="BURPS1710b_0537"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49286"
FT                   /db_xref="GOA:Q3JWV2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV2"
FT                   /protein_id="ABA49286.1"
FT                   /translation="MTRRSRSYNNETTIRENKTMSFEEFAPFRVTAQDVDIFGVKGGAG
FT                   PPILLLHGHPQTHMIWHRVAATLARHFTVIATDLRGYGASGKPPSDARHAPYSKRAMAA
FT                   DQVAVMRHFGFPRFYVCAHDRGARVAHRMALDHPDAVERMLLLDIAPTLAMYERTDRAF
FT                   ATAYFHWFFLIQPEPLPETLIGGQSDAYVEAVMGNRSAGLAPFSPEALHAYREALRQPG
FT                   AVHAMCEDYRASATIDLDHDRADLERGHKLACPLRVLWGEQGVVARCFEPLDEWRRVAR
FT                   DVSGRALACGHYIPEEAPVALIDEIVSFFEAREAA"
FT   gene            544330..545868
FT                   /locus_tag="BURPS1710b_0539"
FT   CDS_pept        544330..545868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0539"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50576"
FT                   /db_xref="GOA:Q3JWV1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV1"
FT                   /protein_id="ABA50576.1"
FT                   /translation="MRRGAPRASILFARERRQAPRDGRRLDDRGARFRTLGHFREYSVE
FT                   LFDRVQIEPADEAIVARHLVAFDELRNPPQQLLDEMQLAGQRLHAHDRLQRVAERARIE
FT                   LDREARDHALRFEPAQPVGRARRGQPDAPREFADGLARVVGERAQQLAVDRIERVRRGK
FT                   RRGKAFLHGDLLFKGGKAFCAEFSDGDVRIKSLESKPGFLLARTHMASNPASSDARRGA
FT                   LEMVVAMLMSGTIGWLVVSSRQHLMNVVFFRCLFGGATMLIICAALGLLRRDLLTKRTI
FT                   AFALLGSVAIVANWVLLFAAYSRASISMATAVYNTQPFMLVALGALVFRERLTASAAAW
FT                   LVLAFGGLALVVRVEPAVLAVPGEYLEGVALALGAAFLYAVSSIVTKRLKGTPPHLIAL
FT                   FQTGVGVLALAPFVHYDALPATAGQWLDLVALGVVNTGIMYVLLYGAIQKLPTATIGAL
FT                   SFVYPVVAIVVDRFAFGQTLAWSQVGGAALILLAAAGVNLGWRIVPARRVAARG"
FT   gene            complement(544354..544842)
FT                   /locus_tag="BURPS1710b_0538"
FT   CDS_pept        complement(544354..544842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0538"
FT                   /product="AsnC family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49397"
FT                   /db_xref="GOA:Q3JWV0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV0"
FT                   /protein_id="ABA49397.1"
FT                   /translation="MQKRLSTPFAAANTLDAIDRELLRTLADDARQPVSELARRVGLSA
FT                   PSTADRLRRLEAQGVIARFTVELDPRALGYTLQAIVRVKPLPGQLHLVEELLRRIPEFV
FT                   ECDKVTGDDCFVCRLYLHSIEQLDGILAKVTERAETSTAIVKSTPVARRLPPLAREED"
FT   gene            545121..547052
FT                   /locus_tag="BURPS1710b_0540"
FT   CDS_pept        545121..547052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU9"
FT                   /protein_id="ABA49095.1"
FT                   /translation="MRRARPAAPRSADETHDRVRAARQRRDRRELGAAVCRVFARVDLD
FT                   GDGRVQHAAVHARRARRARVPRAAHRVGRRVARARVRRARARRARRAGGARGARRVSRG
FT                   RRPRARRGVPVCGVVDRHEALEGHAAAPHRAVPDGRRRARARAVRALRRAARDGGAVAR
FT                   SRRARRRQHGDHVRAAVRRDPEAADRDDRGAVVRLSGRRDRRRPVRVRADARMEPGGRR
FT                   GADPARGGGRESRVADRAGATCRGARLKAAHGCERASGRKAAAGASTKASAGESARERK
FT                   GAQGSARERALRHSDTRNKVVGKFLMRCSEGARMMRSDVDHVHRILIRYAVRLSGRTVF
FT                   FCARDGAPGARRARLTRLAAWRCARAPYASRRRRACATRRSRRACGGSLRTSRSLHRFG
FT                   RHSCTAMAPPRSAWRFPYPSSISRRSRSCRHPRTRRPAHALPHRAWAPCPARRRRASRR
FT                   AFPSHGSCVAALRDVGDRRARERHELLRRQVEHRVRMARRGPQAVEIEQVAIDQHHGLD
FT                   EMADRAHAADRVAGVVAHELRVRAADFADLCGDLPFVDAVRAARDDEHRRAVGAAPEQD
FT                   RFRDLRDRAAEARGGLGRSLAGFLEHHDRLRMPALAQQQRDAASGIGKLVDGGGGSHGC
FT                   ASSPRWVG"
FT   gene            complement(546184..546342)
FT                   /locus_tag="BURPS1710b_0541"
FT   CDS_pept        complement(546184..546342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06945"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49374"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU8"
FT                   /protein_id="ABA49374.1"
FT                   /translation="MPSPCTNVCRIDARTGWCEGCRRTRDEIAAWRKLDDDAKRTVLAR
FT                   IATRRAA"
FT   gene            complement(546513..547019)
FT                   /locus_tag="BURPS1710b_0542"
FT   CDS_pept        complement(546513..547019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0542"
FT                   /product="YbaK"
FT                   /note="prolyl-tRNA synthetases associated domain putative;
FT                   identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50169"
FT                   /db_xref="GOA:Q3JWU7"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU7"
FT                   /protein_id="ABA50169.1"
FT                   /translation="MATPAPIDKLPDSARRVALLLRERGHAKAIVMLEETGKTSAEAAA
FT                   GLGCSIAQIAKSILFRRRADGAPVLVVASGANRVDERKVAAQVGEVGRADAKFVRDNTG
FT                   YAIGGVCPIGHLVEPVVLIDRDLLDLDSLWAAAGHPHAVFNLSPQELVSLTGAPVADVA
FT                   QRGDA"
FT   gene            complement(547075..548010)
FT                   /locus_tag="BURPS1710b_0543"
FT   CDS_pept        complement(547075..548010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0543"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="identified by match to protein family HMM PF00682"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47965"
FT                   /db_xref="GOA:Q3JWU6"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU6"
FT                   /protein_id="ABA47965.1"
FT                   /translation="MTLPQSVKIVEVGPRDGLQNEQTFVPTGVKIELVNRLSQAGFRNV
FT                   EAASFVSPKWVPQMADGADVMAGIARRAGTIYSALTPNLKGVENALAARADEVVIFGAA
FT                   SEAFSRRNINCSIAESIARFEPVARAAKDAGVRLRASVSCALGCPYQGDVPLEAVVDVV
FT                   ERLAALGCDEIDIADTIGVGTPGRTRAVLDAVAKAFPRERLSGHFHDTYGQALANIYAA
FT                   LLEGIAIFHASVAGLGGCPYAKGATGNVATEDVLYMMRGLNIETGVDLDQVVAAGDFIS
FT                   NAIGRANISRAGRALLAKQRAAAEPPSACA"
FT   gene            complement(548096..549037)
FT                   /locus_tag="BURPS1710b_0544"
FT   CDS_pept        complement(548096..549037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0544"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF02826;
FT                   match to protein family HMM PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50655"
FT                   /db_xref="GOA:Q3JWU5"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU5"
FT                   /protein_id="ABA50655.1"
FT                   /translation="MRILLYTPHRDAHDWKRDVERALPGAQLRTWTPGDDASADYALVW
FT                   RAPREFFAPRAGLKAVFNLGAGVDAILALEREHPGLLPRDVPLVRLEDAGMARQMVEYA
FT                   THAALRYLRRFDEYALLQRERRWQVLAPHARETFVVGVLGLGALGAEVARALAALGLPV
FT                   RGYSRAPKAIDGVTTFAGAAQLDAFLGGAKLLVNLLPSTAATDGILNARTFSKLAHGAY
FT                   LVNLARGAHLVEADLLDALASGRVAAATLDVFATEPLPPDHPFWHEPRITITPHCSADT
FT                   LRAEAVEQIAAKIGALERGEPIGGIVDRDRGY"
FT   gene            complement(549042..549479)
FT                   /locus_tag="BURPS1710b_0545"
FT   CDS_pept        complement(549042..549479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0545"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49642"
FT                   /db_xref="GOA:Q3JWU4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU4"
FT                   /protein_id="ABA49642.1"
FT                   /translation="MSATPRGALRPFHLAFPVTSLEHARRFYGGLLGCPEGRSSDHWVD
FT                   FDFFGHQLVAHLAPGETGRSAVNPVDGDDVPVRHFGVVLSMDEWHALADTLKAAGTRFV
FT                   IEPHIRFKGEAGEQATMFFVDPCGNALEFKAFADIGQLFAK"
FT   gene            549629..550258
FT                   /locus_tag="BURPS1710b_0546"
FT   CDS_pept        549629..550258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0546"
FT                   /product="Predicted esterase of the alpha/beta hydrolase
FT                   fold"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48609"
FT                   /db_xref="GOA:Q3JWU3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU3"
FT                   /protein_id="ABA48609.1"
FT                   /translation="MRSCSKSTWPPRLVTAPGLHGSEGAHWQTWLERQFARALRVEQDD
FT                   WDAPHVERWAQKVRDLLARERGPFVIAAHSFGCLATAHALAQAAQTRAADVVGVLFVAP
FT                   ANPRKFAFAGDFDARRLNVPSIVVGSESDPWMTLADAREFAQRLGSAFVNLGDAGHINT
FT                   AAGYGPWPRAKYFVDTLVHCAAPLRLRDDDAPASGAPARQPLVTAA"
FT   gene            complement(550287..550697)
FT                   /locus_tag="BURPS1710b_0547"
FT   CDS_pept        complement(550287..550697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0547"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47487"
FT                   /db_xref="GOA:Q3JWU2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:4DYW"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU2"
FT                   /protein_id="ABA47487.1"
FT                   /translation="MQHTEQPRVGCGAAIVRDGRILLIKRKRAPEAGCWGLPGGKVDWL
FT                   EPVERAVCREIEEELGIALERATLLCVVDHIDAANGEHWVAPVYLAHAFSGEPRVVEPD
FT                   RHEALGWFALDDLPQPLTHATRIALEQVTRAA"
FT   gene            550738..550845
FT                   /locus_tag="BURPS1710b_0548"
FT   CDS_pept        550738..550845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47811"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU1"
FT                   /protein_id="ABA47811.1"
FT                   /translation="MPRCVPSKPGGAAGLPVRRPAVQTVAAAGAAVFSP"
FT   gene            complement(550835..552952)
FT                   /locus_tag="BURPS1710b_0549"
FT   CDS_pept        complement(550835..552952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0549"
FT                   /product="non-hemolytic phospholipase C precursor"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM PF05506"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49869"
FT                   /db_xref="GOA:Q3JWU0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU0"
FT                   /protein_id="ABA49869.1"
FT                   /translation="MTSESRRRFLHTVAQSAGAAAALTVFPESIRRALAIPAASRTGTL
FT                   RDVEHIVVFMQENRSFDHYFGHLRGVRGYNDRFPIPLPNGKPVWYQPSKANPGKPVLPF
FT                   RLNTLTTSAQCIGDLDHSWYKTHAAIDGGRYDQWPANKTDMTMGYHVREDIPFHYALAD
FT                   AFTVCDNYFCSLPGPTHPNRSYLMTGTVDPTGRYGGPLLDNSDYVDGDVPPKYDLLTWT
FT                   TYPERLEANGISWQIYQQGTTGADPLNGNYGTNILQNFANFINAKPGSSLYRRAQTART
FT                   LDDLKADVLANKLPQVSWLLPPAAFSEHPRYTPAYGANYTSQILDALTSNPDVWRKTVL
FT                   FIMYDENDGFFDHVVPPQPATTRAQGLSTVTVDGEIHDVVNPGRGGSYTADGLPYGLGP
FT                   RVPMTVVSPWTKGGFVCSQVFDHTSVIRFIAARFGIDEPNITPWRRAVCGDLTSAFDFR
FT                   TPDATLPPLPDTSGYRSIADQLCSTKPAPAVPAAPSPVDPQEPGVRPARALPYELHVNA
FT                   EVHGGARLRIEFANRGEQGAHFYVYASNRSDGPWRYTVGAHRSLHETFDLAATNGAYAF
FT                   AVYGPNGFVRVFEGLAAAGGHGRQAAARPEVKAGYDVANGNLYLKLANHGAQSVQLTLA
FT                   DNAYGAPARRITLRGGDEQIESWALASSHQWYDVTVSDGATGQFVRRFAGHVENGKPSY
FT                   SDPAAIAPVTG"
FT   gene            complement(552999..553295)
FT                   /locus_tag="BURPS1710b_0550"
FT   CDS_pept        complement(552999..553295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0550"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT9"
FT                   /protein_id="ABA50309.1"
FT                   /translation="MRQRLTAPAVVVVAALCVAPLVAACSDDASHANAGAGTSPAAQPG
FT                   GAANAFNGGATAAGNASASAPLATPVIHYPPEDAADDASGTAAGSAQSASHPG"
FT   gene            complement(553533..553991)
FT                   /locus_tag="BURPS1710b_0551"
FT   CDS_pept        complement(553533..553991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0551"
FT                   /product="AsnC family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49491"
FT                   /db_xref="GOA:Q3JWT8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT8"
FT                   /protein_id="ABA49491.1"
FT                   /translation="MKLDSIDRRILRALQRDGRQQNVELAKEVGLSPSPCLRRVRLLEE
FT                   AGVIERYVAVLNPAKVGRGLTVFTRVWLKEQDADTVAHFAEAVQHLPQVVECHLMAGDC
FT                   DFLLRVVAADIDDYRQFQMQHLTRIRGVQSVKTEIPLQKVKLTSEVPV"
FT   gene            554116..554844
FT                   /gene="azlC"
FT                   /locus_tag="BURPS1710b_0552"
FT   CDS_pept        554116..554844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azlC"
FT                   /locus_tag="BURPS1710b_0552"
FT                   /product="azaleucine resistance protein AzlC"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48619"
FT                   /db_xref="GOA:Q3JWT7"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT7"
FT                   /protein_id="ABA48619.1"
FT                   /translation="MNSLPTSTVISEASPARSEAWRGLRASLPVMLGFVPFALVLGAQA
FT                   AQKGLGIVEVPLLTGLNFGGGSEFTAIRLWTSPPHILLIVAMSFLVNCRHILMGAAFAP
FT                   YLRHLSRRQTFPALFFMCDESWAMALADARREGRGRVSLPYYLGVAAGLYLTWISCTAL
FT                   GAALGPTIGDVERYGFDMAFTAVFLVLLRGMWKGARASRPWLVSLVVAAATYLLVPGAW
FT                   YVAAGALAGLVAAVVCGEPA"
FT   gene            554801..555973
FT                   /locus_tag="BURPS1710b_0554"
FT   CDS_pept        554801..555973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0554"
FT                   /product="Lactonase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49908"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT6"
FT                   /protein_id="ABA49908.1"
FT                   /translation="MPASSRPSSAESRHDRCPDAAHDRADGLVHLPEPDSRLRRAAQPH
FT                   AEPAHDVGDGERAGMRAGVGDRAGVRVRQAGQSARARHHAARRNPPVDPADRDHRHRVD
FT                   RRAAPSARSMTNVDACGHAAADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSL
FT                   GCVRMWRTFPQTLAACAGRRVIAYDRLGFGQSDPRTDALGFDFVRDEARRCFPMLRDAF
FT                   GFDRFVAFGHSVGGGMAVHCAAEFASACDALITESAQAFVEDRTRAGIVDAREQFKQRD
FT                   AFERLRAYHGEKARWVLDAWIDTWLSPEFAGWSLASVLPRVTCPMLAIHGGDDEYGSAL
FT                   HPETIARLASGPAQIEILPGVRHVPHREREQWVAQRVAAFIGAGPHGVAE"
FT   gene            554841..555143
FT                   /locus_tag="BURPS1710b_0553"
FT   CDS_pept        554841..555143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0553"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06063"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47797"
FT                   /db_xref="GOA:Q3JWT5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT5"
FT                   /protein_id="ABA47797.1"
FT                   /translation="MIDVPTLLTIVLMASSTYLSRILGYVALRNRTLSPRMMSVMENVP
FT                   GCVLVSVIAPAFVSDKPANLLALGITLLAATRLSILPTVIIGIVSTGVLRHLLGQ"
FT   gene            complement(556337..556945)
FT                   /locus_tag="BURPS1710b_0555"
FT   CDS_pept        complement(556337..556945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0555"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49230"
FT                   /db_xref="GOA:Q3JWT4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT4"
FT                   /protein_id="ABA49230.1"
FT                   /translation="MNETSMMRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHK
FT                   GFRLTDLHGHTKTPQDYRGNVLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKIL
FT                   FVTLDPNRDTSPTIARWLASFGDDNIGLRDSEAHVRKAATALNLKYERVEGDVPGAYTI
FT                   DHGVQTYVFDSQGRLRLIARAGIEPEYVAKDIVQLLSGR"
FT   gene            complement(556958..559687)
FT                   /locus_tag="BURPS1710b_0556"
FT   CDS_pept        complement(556958..559687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0556"
FT                   /product="kelch repeat protein"
FT                   /note="identified by match to protein family HMM PF01344;
FT                   match to protein family HMM PF07646"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48181"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR009880"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015202"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT3"
FT                   /protein_id="ABA48181.1"
FT                   /translation="MKKREEKSLSVSHSRRAFLVWVPASLLVTACGGDNGSSAPASIKK
FT                   AVAALTGPGGATWTGMGKGGILIQSPYSGAGNFELLAGDEYGMLHCLRRTNDNGAQWMV
FT                   AVGDGMGSKNSVSGYCHTYSTNYTNIEAAVVDDGAVKTYFRSNSTPWSAHKTIPIGDAQ
FT                   GFPAYLQSNRNGAQQLELVVGMRRGGMVHYWRDDKDGFTWKQSSIFGSGQVKGVSVMQG
FT                   NYIGPDNNANLELVAWVDDRLESWCCEGRAWRKICNIAAGGVGGAPALLQSNYGTKGNF
FT                   EVLVPLATGGIAHYWRNNDAEGIPWSFTGTIGTGAYVAAGLLQSQNGVKGDFEAIGLRA
FT                   SGKADVFRRGDTLVWENSATVSPFSEGTAADVGVSSHIVDVNVTGINSVLLKNGSVLMF
FT                   GYYKGGSTNKTIPACIWNPVNDQITAIPSFRNNFCAGQTAMPDGKVLIVGGHIGDTLKD
FT                   VVVFDPDNHTATLVATMTKGRWYPSTATLPDGQVFIISGTETAGWNTSVNDTWQTYANN
FT                   ALTAPEDVISPFSPYYPKSQTQIDLYPFLFVLPDGKLLVHARNTTRFFDIGTRSWSATL
FT                   YKTVSDNSRTYPFMGGTAVLPLRPSENYRVKVVVAGGADKSAQIAIGDDSQYDNSVPGM
FT                   TSCEMLDLGDAAPAWKAIAPLNEGRVMCDLVTLPDGKLFIVGGNKTGKADYGRGPTYRP
FT                   ELYDPQTNTWTLLASTRIARGYHATALLLPDGRIAITGKDGDYQGSGLQYAETRVEIFS
FT                   PPYLFKGPRPAIQSAPASINHGGSFTLGLSSGTSPEDIGSIVIVACGSATHQINFSHRI
FT                   VELVFAVSGGTLTVNAPPNANIAPPGYYMMFVLSKLGVPSVSSIVHVAAGSAQAASATP
FT                   EALTRQPRVATVSIEQAGDAPRCAPLTVAEKQSINGMG"
FT   gene            complement(560756..561658)
FT                   /gene="dapA"
FT                   /locus_tag="BURPS1710b_0557"
FT   CDS_pept        complement(560756..561658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BURPS1710b_0557"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by match to protein family HMM PF00701;
FT                   match to protein family HMM TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50425"
FT                   /db_xref="GOA:Q3JWT2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT2"
FT                   /protein_id="ABA50425.1"
FT                   /translation="MHMQSRFEGIWLPIVTPFHARETGTVDHAALARLARHYSDEGIAG
FT                   FVAGATTGEGALLNAGEQEAIFATLRDAAPARPIVLGITASATHAAAERARALAALRPD
FT                   GLLVTPPVYVRPTQAGVQRHIEAVVEAADLPVLVYNIPYRTGVNVELDTLKALSRDARV
FT                   AGVKECGGTMERMLRLVHETPLRILSGDDNQNFAALCAGAHGAIASAAHVLPAWHVRVY
FT                   ALLREGRLDDARRIAVALQPLVADLFAEPNPAPVKALLAAQGWCDNALRLPFLPVEEAL
FT                   ATRLVAHWESLRQSEAAGA"
FT   gene            563745..564302
FT                   /locus_tag="BURPS1710b_0558"
FT   CDS_pept        563745..564302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49335"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT1"
FT                   /protein_id="ABA49335.1"
FT                   /translation="MAELVLASSSQEIRVLVVIDTAYIRSLNITPSKDPLQPTGIGHDH
FT                   QYLLCTGSRGIISGQGTGDLEFRANVGDYVAFTGTSIQDNSDDAVIVYDIKHYSGDKVF
FT                   NPFSANIITRKGAVEPNPDTPSRNGLPPRHTPINFATFDSKVARSGREGFGIAFGLYTL
FT                   QSNGQDQDLYGYYWWDPYITVA"
FT   gene            564040..565428
FT                   /gene="hydG"
FT                   /locus_tag="BURPS1710b_0559"
FT   CDS_pept        564040..565428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydG"
FT                   /locus_tag="BURPS1710b_0559"
FT                   /product="Fis family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49322"
FT                   /db_xref="GOA:Q3JWT0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT0"
FT                   /protein_id="ABA49322.1"
FT                   /translation="MATRFSIRSARISLRARVRWSRTLTRPAGTACRRVIRRSISRRSI
FT                   RRSREAAGKASASRLASTRSSPTGRTKICTVTTGGIRTSRSRKEAARRLCSGLPDGAIR
FT                   LARHRRCRAGIARRGGTVPSGFAVPPRPQAFLMAHFFMHWLPVGRAPTGAGIRRHCAAT
FT                   EPRSLMRDAAHRCNARAVVAALHLPAETRGFDARVYRPRSDRRADSSMHLDVPCSRRLG
FT                   RREAPKRLSARAPECPSARVSAVTIGASSAEPWLCPPSLLSRSASARRRGKPLDTRERI
FT                   AASGIDSRVSRGARMLTHRDLKNAIAKGMFRMDLFHRIAVTAASIPDLRERIEDLPSLI
FT                   AYWLARLCERHGLPPRQFDDEAYARRLDCPWSGNVRELRSAIEGLVLLSDGPVITAEKQ
FT                   PAEIGEPASVPAHRAWVASGRRRAARMRRGRVHPPRARSPSRQSHGGGESARHREKHAV
FT                   REGP"
FT   gene            565897..566910
FT                   /locus_tag="BURPS1710b_0560"
FT   CDS_pept        565897..566910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0560"
FT                   /product="sulfate-binding protein precursor"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48448"
FT                   /db_xref="GOA:Q3JWS9"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS9"
FT                   /protein_id="ABA48448.1"
FT                   /translation="MKHNKGIGRRLAAGVAAALLATAAHADTALLNVSYDVTRELYKDI
FT                   NASFVAAYKQKTGETVSVRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAERGQLL
FT                   PKNWRTRLPNGSSPYSTTMVFLVRHGNPKQIKDWSDLAKPGVQVIIANPKTSGNGRYAY
FT                   LAAWGYQKLKGATDQQALDFEKAIFRNVPVLDSGGRGATTTFTQRGIGDVLVTFENEVA
FT                   LIDSGAAGASFDAVYPSASILAEPPVAIVDKVVDKKGTRRAAQAYLDYLYSPAAQEIVA
FT                   QHHLRPRDPNVLKQHASEFKPLKTFTVEQIFGNWANAQKTHFADGGTFDKIIVDRK"
FT   gene            567455..569104
FT                   /locus_tag="BURPS1710b_0561"
FT   CDS_pept        567455..569104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0561"
FT                   /product="serine-type carboxypeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49456"
FT                   /db_xref="GOA:Q3JWS8"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS8"
FT                   /protein_id="ABA49456.1"
FT                   /translation="MPATAAVAAALLLALGGCGDDLQSTTTPAQLNQPYTDTTAYSPKA
FT                   GDGLPASQVSERAAVMSHQWTANGASVDYLTTTGHLTATDPNGNAEATMSYVAYTAPSR
FT                   DGSPRPVTFFYNGGPGSSSVWLRLGSFAPTRVATPDPLMTNWPNFPLVDNPESLIATTD
FT                   MVFIDPPGTGLSEAIQPNTNQTFWGADADVKVMRDFIRRYLSVNGRGGSPIYLYGESYG
FT                   TPRTDMLALALESAGVPLTGIVLQSSILNYMAAAGDQAVGTFPSYAQVAAYFNQVSPSP
FT                   TNLGAYAQRIENFVTAQYAPIVHYATASSPISPDAGTLAAWSSQTGMATASIGAYFQYF
FT                   YDTEPSPGQTTLVPGYTIGRYDGRVSLPNGDARLASDDDPSDILISKPFTSALASQMPN
FT                   YLGYTAPNATYQTLNPDIIGVWNFSHAGQPYPDTIPDLLAALQLNPKLKVLASNGYHDL
FT                   ATPYFETEKELARLQTVSGLAPNLQVTFYQGGHMIYLDDVARPQMQADLVAFYQNRPVA
FT                   NALTLAALPSPWPDESPANTPTAKIARAAAAR"
FT   gene            569133..570695
FT                   /locus_tag="BURPS1710b_0562"
FT   CDS_pept        569133..570695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0562"
FT                   /product="Inward rectifier potassium channel"
FT                   /note="identified by match to protein family HMM PF01007;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50085"
FT                   /db_xref="GOA:Q3JWS7"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS7"
FT                   /protein_id="ABA50085.1"
FT                   /translation="MRSASLNPRYCESSHVQDSSVAARRYGGGICARRRVFGRRAGRNR
FT                   AGRLVRRAAARRRRRAVLPEGRLGRAGLGLGDDGRAVAAAGAKPACREPRRERRAAQRR
FT                   GAHEGAGASERPRLRRAAFRRNRHRAHRQGHAQAGSAVHRAAASVTGGARRAPAARVAP
FT                   AGARDARIALAACYARRTDSGETAMNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGT
FT                   REVIAYGMPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFALLYQLGDAPIANQSP
FT                   PGFVGAFFFSVETLATVGYGDMHPQTVYAHAIATLEIFVGMSGIALSTGLVFARFARPR
FT                   AKIMFARHAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRREHSSEGYSLMKIHDL
FT                   KLVRNEHPIFLLGWNMMHVIDESSPLFGETPESLAEGRAMLLVMIEGSDETTAQVMQAR
FT                   HAWEHDDIRWHHRYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQAFAAKPGEGDA
FT                   RPV"
FT   gene            570912..574487
FT                   /gene="iorA"
FT                   /locus_tag="BURPS1710b_0563"
FT   CDS_pept        570912..574487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="BURPS1710b_0563"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01558"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51105"
FT                   /db_xref="GOA:Q3JWS6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS6"
FT                   /protein_id="ABA51105.1"
FT                   /translation="MNARLPIDGPPALADYRLTDNLSATRGRIFLTGTQALVRLLLMQR
FT                   ALDAAQGVNTAGFVSGYRGSPLGMVDQQLWKAKKQLDASGVRFLPAINEELGGTAVLGT
FT                   QRVEADPQRTVDGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMIAWHMPVVNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTV
FT                   DLDALAMRWPAPEGFAPPEGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIA
FT                   KSARANVGIVTCGKAHLDLMEALRRLDLTAADLDAAGVRIYKVGLSFPLEMTRIDTFVE
FT                   GLAEVLVIEEKGPVIEQQIKDHLYNRAAGARPVVLGKHDAAGAPLLSELGELRPSRILP
FT                   VFAEWLARHKPALDRRARVVDLVAPSILSNEADAVRRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMERDTTGLIQMGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAARANITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHDLFPKGTTFHHRRELDAVQRELRETSGVTVLIYDQTCAAEKRRRRKKGEFPDPDR
FT                   RLFINEAVCEGCGDCGVQSNCLSVEPVETALGRKRRIDQSSCNKDFSCANGFCPSFVTV
FT                   ERATLKKAAGVAFDEAALAARVGALPRPATHLADAPYDMLVTGVGGTGVVTVGALVSMA
FT                   AHLEGKSASVLDFMGFAQKGGAVLSFVRIASSDAWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRRERTRIVVNTHAIPNAAFVRDPDASLHADALVEKMRHAAGDGFLARCDAQA
FT                   LATKFLGDTIGANILMLGFAWQQGLVPVSLDAMMRAIELNNVAVPMNKLAFSIGRMAAA
FT                   DAAGLDALWDARHPVHAPPLPQTLDAIVADREARLADYGGARYVARYRALVGAARATGD
FT                   ERLARAVATTFYRLLAVKDEYEVARLYTDGAFRTALEAQFEGAAGKDFRVKFNLAPPAT
FT                   AKAGRHGAAPRKQMFGQWLWPVLGVLARVRGLRGTWLDPFGGTVERKMERALADDYETT
FT                   MHRAFAAHSPQTAELVARLAELHAKVRGYGHVKLANVAGVKRSERELAARLSIDAATSD
FT                   AVRHALDEMKGAGALRGIAVVVAKS"
FT   gene            complement(574755..576512)
FT                   /locus_tag="BURPS1710b_0564"
FT   CDS_pept        complement(574755..576512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0564"
FT                   /product="Na+/H+ antiporter"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM TIGR00831"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49013"
FT                   /db_xref="GOA:Q3JWS5"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS5"
FT                   /protein_id="ABA49013.1"
FT                   /translation="MRPRSRPASRRAFRAHATLRTVVSSPFRISMAIVFTVLILLLAVA
FT                   LSGVATRVLPLRLPLPLMQIAIGAVLAWPRFNLHVTFDPEIFMLLFIPPLLFADGWRIP
FT                   KRELYLQRRAILMLAFGLVFMTVLAVGYFAHGLIPGLPLPIAFALAAVLSPTDAVALAG
FT                   IAGKGRIPPQLMHILEGEALMNDASGLVALKFAIAAALTGMFSLRDASISFVIVASGGL
FT                   AAGAALAWLFSALSTRFLNAAQEGDPAPGIVMTLLVPFASYLIAEHLGLSGILSAVASG
FT                   MMMNYTSFSKSSTVAARVRAESTWAMIEFVFNGMVFIMLGLQLPHIIGRALVDAHHTSD
FT                   ALVGAMIGYVAAMLAALYAIRFTWVWLLRWIASRRAAKQGLAGTMAGLRTIAVMTVGGV
FT                   RGAITLAGVLSIPVALGDGTPLAGRDTAIFVASGVILGSLVVAVIALPLLLRGVRPMRN
FT                   PHAEEERAARAAAAQAAIRAVDAAHDALAVDLDESAAARCADVTARVMDLYRRRLAGLA
FT                   ADGATPREEARQTEKMELALKIAAIRAERAVLYRLRGEQKINDETLAKLMREVDFSETA
FT                   LSTRKKGIV"
FT   gene            576476..578023
FT                   /locus_tag="BURPS1710b_0565"
FT   CDS_pept        576476..578023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0565"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49792"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS4"
FT                   /protein_id="ABA49792.1"
FT                   /translation="MRGVKRGASAGALWWCAQSPSACTRGAPRAWRPRPGAGGAAGRHA
FT                   REHGACLRLVDNYDRTTEDHDENPRVACFACRRFRHQEGRRMTIAQQERPVAASPYRFE
FT                   AEMTSGLERVAAHHHDLTLTSVFQPIFSLSHMRAVGYEALLRAHDALDRPVSPLDVFGE
FT                   AARHGEATQVDRLAQALHLENFARFGAEREWLFLNVHPGVLTDPFQAAALFANLRRLDI
FT                   APRRIVLEVLEQRAEDIERLADAVREFREHGFLIALDDFGAGHSNIERIWQLNPDIVKL
FT                   DRIMLSHAQHRAGLTAILHGLVTLLHEAGKLVLIEGIETEHEAQIALACDADFVQGHFF
FT                   GRPAPGLPDSAAASTCIGELTERYRQQTEAAERRDAQRLAPYQRAFERAAERLAAGEPL
FT                   DEVCWNFLALDHAARCFLLDERGRQAGRNVVLRADRASHETRFLPLADAQGANWLRRPY
FT                   FRAAIAEPGRVQATRPYLSINEALPCVTLSIAVRVNDALCVLCGDIDWIDADAAAGA"
FT   gene            578340..578858
FT                   /locus_tag="BURPS1710b_0566"
FT   CDS_pept        578340..578858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51014"
FT                   /db_xref="GOA:Q3JWS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS3"
FT                   /protein_id="ABA51014.1"
FT                   /translation="MPHSRGRARMPGRRCILRTRGRECAEDRGAGPAPRDPAIGATRRR
FT                   IMKRPLSLTVLAWFVIVSNVIGLISMPFSLRDPNAVALLRYSPLPLEATVAIAVVSEGL
FT                   HLVAGTAILKRRIWGRTLYAIVALAGFAISVFTTPFKGMLIIAAALIALFLFILYRPAA
FT                   TAYFRQRAS"
FT   gene            579064..580593
FT                   /locus_tag="BURPS1710b_0567"
FT   CDS_pept        579064..580593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0567"
FT                   /product="alkaline phosphatase family protein subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48062"
FT                   /db_xref="GOA:Q3JWS2"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS2"
FT                   /protein_id="ABA48062.1"
FT                   /translation="MLSIQFTFASHRPRIVLAFLKEITPTGSRNMKRVRLAALLGASVF
FT                   AAAGCGSDEPKTPGASDNGAQTGAARNVIFFLGDGMGMTTLTAARIYALGEDGALTLDT
FT                   LPETAFVKTYSNDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAIEPSASLTGNCGAN
FT                   NGKPVPTLLEIAKAKGLATGVVTTTRVTHATPAATYAHVCHRDAENDIAAQLVPGGAGY
FT                   NAALGGGVDVVLGGGAQFFVPKEAGGKRADGRHLVNELKAKGYAIAQNRDELLAADATK
FT                   RGKLAGLFASSHMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMVEGGRIDHALH
FT                   DTNAKRALQDTVAFDNAIKATLDKVRQTDPELKNTLVVVTADHDHTLVLNGYAARTGKT
FT                   EAGKPGVLGVLRNYQTGAVAKDADGAPYTIIGFGNGENRVQGSRAGTSLTDAVTGADDY
FT                   RQEAVVRMAKGGETHGGTDVFLGAIGRGADGFHGVIENNKVFELVRGAAQL"
FT   gene            580626..582029
FT                   /gene="phoA2"
FT                   /locus_tag="BURPS1710b_0568"
FT   CDS_pept        580626..582029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA2"
FT                   /locus_tag="BURPS1710b_0568"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49523"
FT                   /db_xref="GOA:Q3JWS1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS1"
FT                   /protein_id="ABA49523.1"
FT                   /translation="MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPA
FT                   TVTASRLYKVGEAGQLTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSM
FT                   SPDTRAIAPGSDANGNKTVNRCGVGNGTPAATLLELAKARGKAVGAITTTELTHATPAA
FT                   TYSHICHRDAQYDIAVQAVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADG
FT                   RNLLAELQAKGYAVVATKDQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLA
FT                   EMTAKAIDVLRKNPNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLS
FT                   DTLIVVTADHDHTMTINGYSKRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRP
FT                   NVRVPVDSSTATNDAYLQEVGVRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVF
FT                   GLVKAAFGF"
FT   gene            583257..583970
FT                   /locus_tag="BURPS1710b_0569"
FT   CDS_pept        583257..583970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0569"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50848"
FT                   /db_xref="GOA:Q3JWS0"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS0"
FT                   /protein_id="ABA50848.1"
FT                   /translation="MPASSILLEVIATTIGDARAAARAGADRIELVTAISEGGLTPSVG
FT                   VIEAVVAAVPIPVNVIVRPHSRSFSYDASELAAIARDVRAAVAAGANGIVFGMLDAHGD
FT                   IDLDALRRIADAADGRDLTFHRAFDVARDLNAAFDTLLRVPSVTSVLTSGGHPSVLDAR
FT                   DVVARMVRRAAGAACTVLAGAGLTVDALGDFVRATGVRAVHFGSGVRERGEVLAPIDER
FT                   LVAKARAALDAATRG"
FT   gene            584004..586283
FT                   /locus_tag="BURPS1710b_0571"
FT   CDS_pept        584004..586283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR9"
FT                   /protein_id="ABA47844.1"
FT                   /translation="MAEAVAGECRAAHRAKKPGHRPAVLQEGSRRSGAQLRRLACPHAE
FT                   PREQLAVRFRARIAGREQHVAVEHRIRAGEEAQRLHRVVELLAARRQAHHRLRHRDARD
FT                   RDRTHELERIERLRVRERRAFDRDEIVDRHRFRIRVHVRELRDQARALAARFAHPDDPA
FT                   AAYVDARVAHALERVEAILVRARRDDLPIEFGRRVEVVVVIVEARLRQRLRLVFLEHAE
FT                   RHARLEAHVLHAADHFLDRLDVAILRVAPRGAHAEARRAVFLRGARGGEHRVHLHQLLR
FT                   LQAGVVMRGLRAVAAVLLAAARLDRQQRRELDRVRVEVLAVCLLRAEQQIVERQLVERD
FT                   HVGDAPARRGGRGHRCFGRRASGLSFSHVGHPSEQGSMRKIGKERLKRAAKTSARRGGA
FT                   QRVQQEVHVERVRRRVGRRRAHVRERAEQRRAVLAFEPRAQRVDVVVGEGHRRIDAVRD
FT                   PAGKGQAARGDRLGGEQCVADAAETHADDEHHGQPERDRQIGGIARVGERHAKAADAFD
FT                   DDDVRHLARAAMRVDDRADVERDALARGDDVRRGGRLQEKRRADRGGQRDVRGRVELVR
FT                   VFVAPCAVALVRARGHRLHRGRAQPRAREAVQQRGRYERLADLGIGTRHEQRKRRAHAA
FT                   APIGVTSAASRRARSSNECAADSEMRSRDVPAGTVGGRIAGTHRPCASSAAIAASVASL
FT                   LPITSGCTAVCESTGCQCVARRIARVRLISAPRCARRASPSSLAMTARLADTAHATDGG
FT                   AAVVKI"
FT   gene            complement(584097..585116)
FT                   /gene="bioB"
FT                   /locus_tag="BURPS1710b_0570"
FT   CDS_pept        complement(584097..585116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="BURPS1710b_0570"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50391"
FT                   /db_xref="GOA:Q3JWR8"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWR8"
FT                   /protein_id="ABA50391.1"
FT                   /translation="MTDMTEAQTACATTETPVAAPAAPRWRVADVIALYELPFNDLLFR
FT                   AQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAA
FT                   RTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGLETCVTLGMLEEHQAKALAE
FT                   AGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERA
FT                   GLIAQLANMNPYPESVPINNLVAIEGTPLANAQALDPFEFVRTIAVARITMPKAMVRLS
FT                   AGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLLARLGMWASEASQLSA"
FT   gene            complement(585180..585902)
FT                   /gene="bioD"
FT                   /locus_tag="BURPS1710b_0572"
FT   CDS_pept        complement(585180..585902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="BURPS1710b_0572"
FT                   /product="dethiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49562"
FT                   /db_xref="GOA:Q3JWR7"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWR7"
FT                   /protein_id="ABA49562.1"
FT                   /translation="MSAPLSLFVTGTDTEIGKTFVSAALLHGFARAGLRAAAMKPVAAG
FT                   AYERDGAWRNEDADQLDAAANVALPAAIRTPFLLKAPAAPHIVAAREGVALDIGTIVDA
FT                   HRRACEMADVIVVEGVGGFRVPLADTRDTADLAVALGLPVVLVVGVRLGCISHALLTAE
FT                   AIAARGLPLAGWVANRIDPAMPFADDNVDTLRAWLEREHRAPLLGALAHMSPPSPDAAS
FT                   HALDVNLLLNALRAAAPR"
FT   gene            complement(585899..587140)
FT                   /gene="bioF"
FT                   /locus_tag="BURPS1710b_0573"
FT   CDS_pept        complement(585899..587140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="BURPS1710b_0573"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00202; match to protein
FT                   family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48675"
FT                   /db_xref="GOA:Q3JWR6"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWR6"
FT                   /protein_id="ABA48675.1"
FT                   /translation="MARLAHARDARRNAVGGPRMNPLATLEQGLADIDAQGLRRCRRVA
FT                   DTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYGSGSGGSHLLGGHSRA
FT                   HATLEDQLAAFSGGFSDAPRALYFSTGYMANLAALTALAGRGATIFSDALNHASLIDGA
FT                   RLSRANVQIYPHGDADALDARLRACDAPTKLIVSDTVFSMDGDVAPLARLVALAETHGA
FT                   WLVVDDAHGFGVLGPQGRGALAAHGLRSPNLVYVGTLGKAAGVAGAFVVAHETVIEWLV
FT                   QRARSYIFTTAAPPSVACAVSASLAVIASDEGDARRAHLGALIKRTRAILRATHWQPVD
FT                   SHTAVQPLVIGSNEATLAAMAALDAQGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLA
FT                   RLEAALVTPIGAAA"
FT   gene            complement(587080..588615)
FT                   /gene="bioA"
FT                   /locus_tag="BURPS1710b_0574"
FT   CDS_pept        complement(587080..588615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="BURPS1710b_0574"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47830"
FT                   /db_xref="GOA:Q3JWR5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR5"
FT                   /protein_id="ABA47830.1"
FT                   /translation="MPSKAPAFCNEYCNGAKNTLISAPVFDLHTRFSSPSDRPLFRCRF
FT                   RMSERRFAPSTRFGPGAVLSTHATDDWVARSLRAVWHPCTQMKHHERLPLIPVARGERA
FT                   WLFDRAGNRYLDAISSWWVNLFGHANPRINAALKQQLDTLEHAMLAGCTHESAIELAER
FT                   LAARTQHTLGHAFFASDGASAVEIALKMSFHAWRNRGRGDKREFVCIANGYHGETIGAL
FT                   GVTDVALFKDAYDPLIRAAHVVASPDARGARDGETAADVAARALGDVRRLFAERGEKIA
FT                   ALIVEPLVQCAAGFAMHDPSYVRGLRALCDAHDVHLIADEIAVGCGRTGTFFACEQAHV
FT                   WPDFLCLSKGISGGYLPLSLVLSRDAIFDAFYDDDVTRGFLHSHSYTGNPLACRAAVAT
FT                   LELFDTDDVLAENARKSALMREALAPLASHPHVRHLRERGTIFAFDVALEGDAARTFPR
FT                   RFFAHALARETLLRPIGTTVYLMPPYILDEGEIEWLASRTRATLDATLSEAHA"
FT   gene            complement(588897..590537)
FT                   /locus_tag="BURPS1710b_0576"
FT   CDS_pept        complement(588897..590537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0576"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49843"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR4"
FT                   /protein_id="ABA49843.1"
FT                   /translation="MALRRRRCKRALSPPVRIASPHLVPLRRAADRGERPPPPGPPRIR
FT                   RHIRRRASAWPGNSGVAQSKFVRLGWPTFGAIRVGGLGHGVRQGDDGMDRGMRAVGRSG
FT                   RSAALRCAVGASRRPLRAARIARAPRSRRARERRALRLRRFGPAARRRESERNDHPHSG
FT                   RRRRRDHARGDRIQAGWPGPLPARGLQPRQESRRSARAAAQPAAVVRARVRAARLCGGR
FT                   AEPRGLRRLGRHVHPGRLRRRAQRRRAGARRRRDDRLHVEAVLRRCEARRRRRHVARRA
FT                   RVARVRHRGRARRARNHQLLGRAASGSLRRLAEEPRRRVRHVRLAHARAVALAVRRERF
FT                   GMVARARRATARRVHVARREHALRRFRPLQGRRAPDHRRSRRRADLVAARRVVPRATEP
FT                   AHLGPLCGRESARAEGERLCGDRIGRCGAVHRRRRPRRISPLPRAASEPRVRGVERGRM
FT                   VVGRRRRRSDGARARRLPQAGRGGVPAICGRRARRVARRGHADGGRIDERGARAREPLT
FT                   APRTSHPARTSPAMPRPSRFGPPRPADRA"
FT   gene            complement(588989..590287)
FT                   /locus_tag="BURPS1710b_0575"
FT   CDS_pept        complement(588989..590287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49079"
FT                   /db_xref="GOA:Q3JWR3"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR3"
FT                   /protein_id="ABA49079.1"
FT                   /translation="MAFGKVMTGWIAACVLSAAQADPLPSDAPSAPAAAPYAPRVSHAP
FT                   RAAGALANAERFDYGDSGLPPVAANLNETIIRIPVDAAGAITLEATVYKPDGPGPFPLV
FT                   VFNHGKNPGDLRAQPRSRPLSFAREFVRRGYAVVAPNREGFAGSGGTYIQEGCDVERNG
FT                   VAQARDVAATIGYMSKLSYVDARHVVVAGTSHGGLVSLAYGTEAARGVRGIINFSGGLR
FT                   QDLCEGWQKNLVDAFDTYGSRTHVPSLWLYGENDSVWSPALVAQLRDAYMSHGASTLFV
FT                   DFGRYKDDAHRIIVDRDGVPIWWPPVASFLAQLSLPTSVRYAVANPHEPKASGYAAIES
FT                   VDAVPFIDDAGRAAYRRFLAQHPSRAFAVSSEGAWSWAEGGDDPMALALEGCRKQGAGA
FT                   CQLYAVDERVVWRDAGTQTADESTSAAHALASR"
FT   gene            complement(590501..590953)
FT                   /locus_tag="BURPS1710b_0577"
FT   CDS_pept        complement(590501..590953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48135"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR2"
FT                   /protein_id="ABA48135.1"
FT                   /translation="MQPTTNAPERPLDCPCGGAAPGANANARAPRYADCCARLIDGHAT
FT                   AATALELMRSRYSAYVLGATDYLRATWDPSTCPAELDADTGRAHAPRWLGLVIKRHAQL
FT                   DATHAEVEFVARYKIGGRAHRMHETSRFTRDAQGAWRYVDGDVSER"
FT   gene            complement(590985..591662)
FT                   /locus_tag="BURPS1710b_0578"
FT   CDS_pept        complement(590985..591662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0578"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48357"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR1"
FT                   /protein_id="ABA48357.1"
FT                   /translation="MKTVLIVGASRGIGREFVGQYLHDGWRVIATARDAAALAALDALG
FT                   ARALALDVAQPDDIAAFDARLGGAALDAAVVVSGVYGPRTAGVEPIGVEDFDAVMHTNV
FT                   LGPMLLMPILLPRVEASRGVLAVLSSKMGSIGEATGTTGWLYRASKAAVNDALRIASLQ
FT                   ARHAACIALHPGWVRTDMGGAQAALDPQASVAGMRRVIAQAAGDRERANGRFFQYDGVE
FT                   LGW"
FT   gene            complement(591693..592886)
FT                   /gene="fadA"
FT                   /locus_tag="BURPS1710b_0579"
FT   CDS_pept        complement(591693..592886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="BURPS1710b_0579"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48979"
FT                   /db_xref="GOA:Q3JWR0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR0"
FT                   /protein_id="ABA48979.1"
FT                   /translation="MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALER
FT                   AGLQPEQIDEAVMGCVLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAH
FT                   DMLVAGSVDVIVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLM
FT                   GTFAEECAGEYAFSRDAQDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARD
FT                   EQPFKANPEKIPTLKPAFSKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVV
FT                   GHSTFAQAPSKFTTAPVGAIRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHE
FT                   KVNVNGGACALGHPIGASGARILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI"
FT   gene            complement(592873..593643)
FT                   /locus_tag="BURPS1710b_0580"
FT   CDS_pept        complement(592873..593643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0580"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49566"
FT                   /db_xref="GOA:Q3JWQ9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ9"
FT                   /protein_id="ABA49566.1"
FT                   /translation="MNKNDHPLSHLFDNNDAWVKRKLADDPQYFSRLADQQAPEYLWIG
FT                   CSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLNCLSVIQFAVDLLKVKHVMVVGHYG
FT                   CSGVNAALHNRRVGLADNWLHHVQDVREKHAALLEDWPLGEARYRRLIELNAIEQVVNV
FT                   CRTTIVNDAWARGQPLTVHALVYGVHDGRMRNLGMAVSHAEQLDATYRRAVAALSASGA
FT                   HSADNDVVAADAAQLAGAVDLIAQTIKETKHDGC"
FT   gene            complement(593701..595512)
FT                   /gene="aceK"
FT                   /locus_tag="BURPS1710b_0581"
FT   CDS_pept        complement(593701..595512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="BURPS1710b_0581"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="2.7.11.5"
FT                   /note="identified by match to protein family HMM PF06315"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49915"
FT                   /db_xref="GOA:Q3JWQ8"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWQ8"
FT                   /protein_id="ABA49915.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTILENFDRHYRIFREAAVEAKDLFERA
FT                   DWHGLQRLARERITSYDDRVRECVELLEDEYDAENIDNEVWPQIKLHYIGLLTSHRQPE
FT                   CAETFFNSVCCKILHRAYFNNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGSEGLAAT
FT                   LERIVTNFQLNPPFEDLERDIACIMQAIHDEFGAFDEAVNFQIHVLSSLFYRNKTAYVV
FT                   GRIINGDRVLPFAVPIRHARAGILALDTVLLRRDQLKIIFSFSHSYFLVDMNVPSAYVQ
FT                   FLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDRFIVAPGIKGLVMLVFTL
FT                   PSFPYVFKMIKDHFPPPKDTTREQIMAKYLLVKRHDRLGRMADTLEYSSVALPLARLDD
FT                   ALVRELEKEVPSLIEYEGENLVIKHLYIERRMVPLNLYLQNGSDAEIEHGVREYGNAVK
FT                   ELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRVPPPRNDEDEMSGEPW
FT                   YTVGPHDIFPETYAPFLLGDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYE
FT                   PALRFCIRYPERFAPGDAADGGKLAAA"
FT   gene            595885..596880
FT                   /locus_tag="BURPS1710b_0582"
FT   CDS_pept        595885..596880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0582"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50963"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ7"
FT                   /protein_id="ABA50963.1"
FT                   /translation="MRWLRMPLPFALDHINLWLLRDEIDGQAGWTIVDCGIASEQIKAH
FT                   WERIFDAHLDGLPVLRVIVTHCHPDHFGLANWLCDGGARARWNVRLWMTLGEYLFGCVM
FT                   AAGNGSNAGGPAAADHFARHGLADPAALDKLRNRRGYYADLVPAVPPRYRRLREGDALA
FT                   IGAREWRVVTGYGHSPEHCALHCAADGMLISGDMVLPRISTNVSVFDLEPEANPLALYL
FT                   ESLGRYEAMAEGTLVLPSHGLPFRGVRARVAQLRAHHDARLAEVRAACRERPMSAADIV
FT                   PIMFKRGGLDIHQMTFALGEAIAHLNLLWLAGELARDTGADGVLRFRHAD"
FT   gene            complement(597207..598853)
FT                   /locus_tag="BURPS1710b_0583"
FT   CDS_pept        complement(597207..598853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0583"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48245"
FT                   /db_xref="GOA:Q3JWQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ6"
FT                   /protein_id="ABA48245.1"
FT                   /translation="MARTALAGALVALHHVSFRFDDGVTLFDSLDLTFDRAPSAIVGRN
FT                   GAGKSVLARLIAGRLAPTAGAIERHASIAFVAQHDADAMHDSRCTAAAVARLDAPLAAL
FT                   ERVARGDARADDFDLLDGRWDLAERWQAALDEAGLPPLDARTPAHALSGGQLARVAMIG
FT                   ALLSGADLLVADEPTNHLDAPGREWLRAALAGWRGGLVVVSHDRALLADVERIVELTPR
FT                   GARVYGGNYAAYRAQRDAEAQAAQAALDHAHAERERERRRLAREHDTIQRHAAATRRYA
FT                   ETANLPSGKRVSLKNSAREIMGRVRRDHRDTKTALGDAVQAAAARIEPDAPVLVSLPGT
FT                   EIAARRRLFTLDAARLPWLPAHARAATVTWSAHGPARIALTGPNGCGKSTLLRMLAGEC
FT                   APRAGRCDTHVPLAYLDQRLALLDPRRSVVEQLAALRTPLGQGELRSRLALLQLDATRA
FT                   TQPSARLSGGERLKAALACALWRETPAQLLLLDEPTNHLDLESVRAFEAALADFPGAIV
FT                   AVSHDAAFIDALAPTHAMRWTSEGWRFEPFA"
FT   gene            complement(599087..600673)
FT                   /locus_tag="BURPS1710b_0584"
FT   CDS_pept        complement(599087..600673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0584"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50148"
FT                   /db_xref="GOA:Q3JWQ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ5"
FT                   /protein_id="ABA50148.1"
FT                   /translation="MRFTHIAAAALVAAASVAAAKPLTVCTESSPDGFDVVQYNSLVTT
FT                   NASADVVFNTLVSYDEATKKVVPALADKWDVSADGLAYTFHLRPNVAFQTTDSFKPTRA
FT                   LDADDVLFTFGRMLDDANPWHKVAGASGFPHAQSMGLAKLVKAVTKIDESTVKFELNEP
FT                   NATFVPILTMGFASIYSAEYADQLLKAGKQADLNAKPVGTGPFVLKSYTKDAVIRYEAN
FT                   PTYWGPKPKVERLIYAITPDPSVRAQKVKAGECQIALSPKPQDVAAAKADRALRVVETP
FT                   AFMTAFVALNTQKKPLDNDKVREALNLAFDRATYLKVVFDNTATPATNPYPPNTWSYAK
FT                   SIAPYPHDPAKAKQLLAQAGFPNGFSTTIWVRPTGSVLNPNPKAGAELLQADLAKIGVK
FT                   ADVRVIEWGELIKQAKLGQHDLLFMGFAGDNGDPDNILTPQFSCNSVKSGLNFARYCDP
FT                   KLDKLIADAKETTDQAKRAKLYEAAQKIIHDEALWIPLGYPTAAAITRPNVAGYRVSPF
FT                   GRQHFDAVSVQ"
FT   gene            complement(600771..601163)
FT                   /gene="atoB"
FT                   /locus_tag="BURPS1710b_0585"
FT   CDS_pept        complement(600771..601163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoB"
FT                   /locus_tag="BURPS1710b_0585"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51151"
FT                   /db_xref="GOA:Q3JWQ4"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ4"
FT                   /protein_id="ABA51151.1"
FT                   /translation="MRAIRHAFDAPANGSADVAAAGGMARSSNGPYRALGVRGGYRSGH
FT                   AALHDHVAPDGLADAGDRGTSMGEFGQRGAPRLHACRSRRVRGRIAAMGAACATGDRAD
FT                   VTPLARGGAAPRQRFRRRGATPSDAD"
FT   gene            complement(601631..602125)
FT                   /locus_tag="BURPS1710b_0586"
FT   CDS_pept        complement(601631..602125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0586"
FT                   /product="MarR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47606"
FT                   /db_xref="GOA:Q3JWQ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ3"
FT                   /protein_id="ABA47606.1"
FT                   /translation="MHMHFVRHRMLVVDKRFQRLPMSDAPMRLPCHCGTLRQATRAITS
FT                   LYDAHLARHGIRITQFTILAALHGGDALPTGELATRLLLDQTTLSRTLATLQSNQLVRA
FT                   ESGDDQRVRLWSLTPKGTALFKAARVDWEAAQNDVSRRIGKRNMQALDAGIFALAKALS
FT                   N"
FT   gene            complement(602100..603743)
FT                   /locus_tag="BURPS1710b_0588"
FT   CDS_pept        complement(602100..603743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48664"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ2"
FT                   /protein_id="ABA48664.1"
FT                   /translation="MPRRRDRERRHQQGRDHGRRRSGRVPRDHGRQLLRDDRDVRAVHR
FT                   ADDGRAARHARRHRERGRRARAAGLGRVQRVEGGGDQVSRSAEGRAAARASRGRDDRAR
FT                   LHPHADDRAQPVSDAVPDGCGPLREARGARDLAENRVSRDSMADGHRREAAARDAALAV
FT                   RSPVREGAAQTQGEGGLSGADAGARRDPHARRRRAALPPCATPFIHSSIRPFVPNAGAA
FT                   RAPRAAVSPSRARRRLRVDRRLGRQPRLHVARQRIDEHFVAAGRERVERLPDDVLRAIL
FT                   RHALRVRDHVGIDIRRMQREHARALLAQLVADRVRRGPRGRLRNAVRARIRQAEPRQHR
FT                   QHVDDRAAAVLAQHRRERTRHRERAEEIRVELRLQAAAVRLREQRAHSENARVVDEQID
FT                   VAQLARGGGDILRARDVEPHRLHAGRRHARRIARGRIDFLRARGLQPLDEREPQAAIRA
FT                   GHQYDGIIQIHLDSLQQDPGFARRPPAAACLVQACAAPRTPRRTAQPTHGSPPNRCGRI
FT                   DSANGASRTRCYTETPSPAGAKHAYAFCTS"
FT   gene            602337..603050
FT                   /gene="sitS"
FT                   /locus_tag="BURPS1710b_0587"
FT   CDS_pept        602337..603050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sitS"
FT                   /locus_tag="BURPS1710b_0587"
FT                   /product="oxidoreductase homolog"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48677"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ1"
FT                   /protein_id="ABA48677.1"
FT                   /translation="MNLNDAVVLVTGANRGLGLAFVEGLKAAGAKKIYAAARDPARVTT
FT                   PGVQPVRLDVTRAQDIAAAARELRDVNLLVNNAGIFRMGSLLAEADGGGLQAQLDTNFF
FT                   GPLAMARAFAPVLRENGGGAIINVLSVLSWLGLPNTGAYGISKAAAWAATNAIRNELRE
FT                   QRTRVLALHSAYIDTDMVAHAQGVPKNRPEDVVRQTLDALAAGRDEVLVDALTRDVKAG
FT                   LSAEPAVYTQPPTGA"
FT   gene            complement(603203..603982)
FT                   /locus_tag="BURPS1710b_0589"
FT   CDS_pept        complement(603203..603982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0589"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47957"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ0"
FT                   /protein_id="ABA47957.1"
FT                   /translation="MNAPAPLKVFITGASSGLGLALAAEYARHGATLGLVARRADALAE
FT                   FAPRFPKASISIYPADVRDADALALAASRFVAAHGCPDVVIANAGISKGAITGEGDLAA
FT                   FREIMDVNYYGMIATFEPFIAPMTAARRGTLVGIASVAGVRGLPGSGAYSASKAAAIKY
FT                   LEALRVELRPAQVAVVTIAPGYIRTPMTEHNPYPMPFLMDADRFAKRAALAISQKTAFR
FT                   VIPWQMGIVAKLLHVMPRWLYDRLFEKAPRKPRAKAG"
FT   gene            complement(603999..604637)
FT                   /gene="dsbA"
FT                   /locus_tag="BURPS1710b_0590"
FT   CDS_pept        complement(603999..604637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="BURPS1710b_0590"
FT                   /product="thiol:disulfide interchange protein"
FT                   /EC_number="5.3.4.1"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48407"
FT                   /db_xref="GOA:Q3JWP9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP9"
FT                   /protein_id="ABA48407.1"
FT                   /translation="MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPA
FT                   GKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIAFKRVPVAFRDDFVPHSKLFYALAA
FT                   LGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVKQSA
FT                   ELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL"
FT   gene            complement(604689..605537)
FT                   /locus_tag="BURPS1710b_0591"
FT   CDS_pept        complement(604689..605537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0591"
FT                   /product="sporulation-related repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47648"
FT                   /db_xref="GOA:Q3JWP8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP8"
FT                   /protein_id="ABA47648.1"
FT                   /translation="MAKPRRTSKQSKQAGGTFLGIVLGLIVGLAIAVVVALYITRAPSP
FT                   FVSKVAPPADNNASQPQQFDPNRALQGKTPGQPVTPQAAQPAPPNTAPGQAANPSQPPL
FT                   LPEPQIVEVPSSNNNGNGSPSASNNAADNGVAVAPKPAEPAPPPAKKPQTAANGSSAPH
FT                   VANNNAQASAAATPPKAAQAPKGASSATTTAAKPTSGADANTGYFLQVGAYKTEADAEQ
FT                   QRARLGFQGFESKVSKRDVSGVTYFRVRIGPFSKFEDMNSARQRLSDAGVDTAVIRFTK
FT                   Q"
FT   gene            complement(605616..607400)
FT                   /gene="argS"
FT                   /locus_tag="BURPS1710b_0592"
FT   CDS_pept        complement(605616..607400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BURPS1710b_0592"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51032"
FT                   /db_xref="GOA:Q3JWP7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWP7"
FT                   /protein_id="ABA51032.1"
FT                   /translation="MLPAQKHTLETLLENSVKQVVQASKGDADAAFVLPAIALERPKVA
FT                   AHGDVACNVALQLAKPLGANPRQLAEQIVAALTAQPEAAGLVDAAEIAGPGFINLRLTP
FT                   ASKQAVIGAVLAQGRAFGASERDHDKRVLLEFVSANPTGPLHVGHGRQAALGDALANVL
FT                   ASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIARDYL
FT                   NGETVAASDGEPVTGKRDVEDLEAIRKFAVTYLRREQDMDLKAFGVKFDQYYLESSLYT
FT                   EGRVEKTVDALIAAGMTYEQEGALWLRTTDEGDDKDRVMRKTDGTYTYFVPDVAYHVTK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEGSPELLDEATITRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVYYVQYAHARICSVINEWKSRYGATDALLPGADLSPLDSKQAMALMQK
FT                   LAEYPDVLAHAAGELAPHAVAFYLRELASEFHSFYNAERVLVDEQAPRTARVALLAATR
FT                   QVLENGLAMLGVSAPSKM"
FT   gene            607603..607926
FT                   /locus_tag="BURPS1710b_0593"
FT   CDS_pept        607603..607926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50239"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP6"
FT                   /protein_id="ABA50239.1"
FT                   /translation="MITFKSKAAQDLDVLKDFAVYVLGLVGKQLGERGVITSDELDGAI
FT                   AKLEDAVSQAKQARAEHAGHFHEDEPDHAHHEVPPSLAQRVAPFLTMLREAKAQNADIH
FT                   WGF"
FT   gene            complement(608170..610887)
FT                   /gene="metH"
FT                   /locus_tag="BURPS1710b_0594"
FT   CDS_pept        complement(608170..610887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="BURPS1710b_0594"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM PF02310; match to protein
FT                   family HMM PF02607; match to protein family HMM PF02965;
FT                   match to protein family HMM TIGR02082"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48367"
FT                   /db_xref="GOA:Q3JWP5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP5"
FT                   /protein_id="ABA48367.1"
FT                   /translation="MTDHTMRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNGQ
FT                   FDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGKEAFVHHAKLIRRYGAAAVVMAFDEAGQADTLARK
FT                   TEICKRSYDVLVNEVGFAPEDIVFDPNIFAVATGIDEHNNYAVDFIEATRWIKRNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDAELRER
FT                   VEDVILNRRDDSTDRLLEIADKFKTGAAKKEENLEWRSQPVEKRLAHALVHGITNFIVE
FT                   DTEEARAKIAAAGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRLLAQAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPHYEGPVVYVPDASRSVSVASNLLSDEGATKYLDELKADYERIRAQHANKK
FT                   ALPLVTLAEARANKTKIDWARYTSVKPKFIGRRMFKNYDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVGDDDIEIYT
FT                   DDTRAEVLLTWHNLRQQSVRPVVDGVMRPNRSLADFIAPKDSGVADYIGMFAVTAGIGV
FT                   DAKEKQFLADHDDYSAIMLKALADRLAEAFAEAMHARVRRELWGYAATEQLDNDALIAE
FT                   QYAGIRPAPGYPACPDHLVKRAMFEALHTDEIGMSVTDSLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGQDQLEDFARRTALSKADAERALAPLL"
FT   gene            complement(610933..612012)
FT                   /locus_tag="BURPS1710b_0595"
FT   CDS_pept        complement(610933..612012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0595"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /note="identified by match to protein family HMM PF02574"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50821"
FT                   /db_xref="GOA:Q3JWP4"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP4"
FT                   /protein_id="ABA50821.1"
FT                   /translation="MSEPTPIAPFASSAAPAAPYTRGAALPQLLRQRILILDGAMGTMI
FT                   QRYKLDEAAYRGERFKDFPRDVKGNNELLSITQPRIIREIHDQYFAAGADIVETNTFGA
FT                   TAVAQADYGMEALVVEMNVASAALARESAAKYATPEKPRFVAGAIGPTPKTASISPDVN
FT                   DPGARNVTFDELRDAYYQQAKALLDGGVDLFLVETIFDTLNAKAALFALDQLFDDTGER
FT                   LPIMISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLC
FT                   DTYVSCYPNAGLPNPMSDTGFDETPDVTSGLLKEFAQAGLVNLAGGCCGTTPEHIAAIA
FT                   KALAEVKPRRWPSQYSEAA"
FT   gene            611912..612049
FT                   /locus_tag="BURPS1710b_0596"
FT   CDS_pept        611912..612049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP3"
FT                   /protein_id="ABA50549.1"
FT                   /translation="MRCRSSCGSAAPRVYGAAGAADEAKGAIGVGSDMADYRRIGKPSL
FT                   "
FT   gene            complement(612200..612643)
FT                   /locus_tag="BURPS1710b_0597"
FT   CDS_pept        complement(612200..612643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49714"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP2"
FT                   /protein_id="ABA49714.1"
FT                   /translation="MTIFDTNFRPPEENRKRFEVVGIQPIRPVKTTGVQRQPLETGSAR
FT                   PTYGATRPKAIAKRSAAMQMIYNSPNYCVVEFPPQDGHHAMNSGGYEIVDKNAQREIFI
FT                   DGELAARFREHVKQLIQAEPTLDEVDEFLGQFDSLMTQPVVLH"
FT   gene            complement(612640..613959)
FT                   /locus_tag="BURPS1710b_0598"
FT   CDS_pept        complement(612640..613959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49156"
FT                   /db_xref="GOA:Q3JWP1"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP1"
FT                   /protein_id="ABA49156.1"
FT                   /translation="MPLSSIVSSNPRGAARRVRRAACVLALVLALHWLAALWLVRFREP
FT                   FRPVEPDHVPVQVELLKPQPIERAPAPEKPAADRPRAAPKRAARAPAPPAHAPRASAPV
FT                   SSAAESSTESSAESPAAASGTEPASAAGGQAAGATSGAAAGASGASAPPGEAAQGVKFA
FT                   LPPSADLQYDTFYNGMQNMPGTIHWRTDGGGYSLYVSMPVPFVGPYTYESRGRVDAFGV
FT                   APARYVETRGRRPPDFAIFNRQTKQIVFTGTPNSLALPDGAQDRFSMLMQLAGLVGGDP
FT                   DAYRPGVTREFFVVDRDSGETWPITTIGDETISTGMGSLDARHFMRLPRRAGDTRRIDI
FT                   WLAPSLGWLPVRMVQTEPNGAQIELLLHRRTNANGDADVHSDTSANTDADANADGGAAP
FT                   AAAPASASGAPLNANEPVNSTEKADGSPRPPPADPGEPQP"
FT   gene            614023..616131
FT                   /locus_tag="BURPS1710b_0600"
FT   CDS_pept        614023..616131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP0"
FT                   /protein_id="ABA50621.1"
FT                   /translation="MRRRPSGVARSLTIPKLVRQLLRAGAQRGVDLAAPADVERALVAE
FT                   RDDRERELADRVEHRHPECVDRRQQHAFDARRAMRAHVGEHRVDFGARARAGIVRGAPR
FT                   VGELALDHRGRLAARQVRGEHEARRRAEERHHVAELERRLRRMARLHPVDDRRPLVAPY
FT                   RDADRLVELIAQRGERDARELHAVDAREARQAHLQREAAELVAARHRILRHEPEPLETD
FT                   EVAVRLRRAHRRALREVAQHHRARLARQHVEQAKADLDRLDAGADFFLAGVVIVGEVVV
FT                   GGVGGGRGGLVHGVAGRMGRGRLAARAAVRIHHRKIDSFHRHYNGSFPYETCFAQGRHA
FT                   RRPTDRRLARPAHGGDRRRDRADAAARARRLGVLRAAAARPVRRTEPRPRAQRVRVRAR
FT                   RLHGAAAARVPVGGRLRVREPRRARAPRARRRDAARVLDRSADVPGRQRRFPRPARRHR
FT                   LRIGGVGHRFRGGSRGDHGRRADGRRARRGAESGAARHARERRVAAQPDSRRAREGLRL
FT                   LPEQAGERVRAGGRDARRARRALARRPPASPDARPLERQEGRSAGCGRRHGVSLRSTDR
FT                   ARGEDAQRARGLDRRLGHGVEQGCEARLLLHRREALPRDDRARRAADRVHALRRQGEDR
FT                   DGRRGGEVDLRRDRAGGRAGGRRRLTRPCERAAMRRPCGRARKRAAPPGPDCPPGRRAA
FT                   RRAPGFAG"
FT   gene            complement(614038..614985)
FT                   /locus_tag="BURPS1710b_0599"
FT   CDS_pept        complement(614038..614985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0599"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47728"
FT                   /db_xref="GOA:Q3JWN9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN9"
FT                   /protein_id="ABA47728.1"
FT                   /translation="MEGIYFTMVNPHGGPRREPPPPHSSRHAVNKSASPSSDAPDDDLA
FT                   DDHDTGEEKVRSGIQSIEVGFRLLDVLTGEPRAMMLRDLAQRAAMSPAKAHRYLVSFQR
FT                   LGLVSQDPVSGRYELGGFALQMGLARLARVDGVKLARIALTALRDQLDQTVGIAVWGNQ
FT                   GPTIVHWMESSHPAKASLKLGDVMPLLGSATGLVFAAYLPRGKTAAMIERELADTRRAA
FT                   HYTGPRTRAEVDAVLADVRAHRAARVEGMLLPTINAFGMPVFDAVGELALAIIALGHEG
FT                   AFDIRWGGEVDTALRTCAQKLSYELGYSEGARDA"
FT   gene            complement(614060..616180)
FT                   /locus_tag="BURPS1710b_0601"
FT   CDS_pept        complement(614060..616180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN8"
FT                   /protein_id="ABA48474.1"
FT                   /translation="MSRQACKSSVAKAGGRVIRRNPARVGRHGGPAGNPARAAPHACVR
FT                   ARTAAAWPPVRMAVSSGGVHRRDRLLDRAEDRLPRLVDHLDLHPVAVAHELGLRRAVLD
FT                   RLEAALLGDAAVAALRILVRHRARADDRARAHVARLRRVRDQLTEVKHHVDARIRLTDL
FT                   LAVPVDEHRAMQAAFAPVLAELVGRHGHRRERARRLALEEAEALRELGGNQVAQRHVVH
FT                   ERDEPHRFQRLVGRGAHRHVGRDHRDFRLEIDAPRLRCADDVVARAEEIVAAALVHQRI
FT                   GPELGRHLGAARAAHELDVVHVRGAVRPLERARQRRHAIGGLERERVARAAVVQCVVQV
FT                   AQLRRVERPVVEHALQRRRDRVGDRRRVQVARDDDQLAVARAVLERSKFHREMSRCSDD
FT                   GRNLFYDGESARRPAPRAAPSPFFPPRREQVRLALLRRPRRRPRRRSRHRRGKSPLRHP
FT                   VDRGRLSPARRADGRAARDDAARPRAARGDEPGEGAPLPRQFPAARARVAGSGVGPLRA
FT                   RRLRVADGPGAPRARRRREARAHRAHRAARSARPDGRHRGMGQPGADDRPLDGVEPSGE
FT                   GVAQARRRDAAPRLGDGPRVRRVPAARQDGRDDRARARRHAARRALYRPAHARRSRRGA
FT                   RRRARASRGARRRHAAADDQRIRDAGVRRGRRARARDHRARPRGRVRHPLGRRGRHRAA
FT                   HLRAEAVVRAWV"
FT   gene            615011..616003
FT                   /locus_tag="BURPS1710b_0602"
FT   CDS_pept        615011..616003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0602"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47600"
FT                   /db_xref="GOA:Q3JWN7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN7"
FT                   /protein_id="ABA47600.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLRDLYDALNHGRARNAFAFEPADCMAPLPRAFQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGPRDDIVCASEAWGIDFEAEVAVITADVPMGAAPDEALKAV
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPASAFAPVAVTPDELGEHWREGRLHRPMLV
FT                   HWNGKKVGQPDAGVDMVFHFGQLIAHAAKTRNVRAGSIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMRYGDRVKIEMVDEAGKSIFGAIEQAVAPVDAAA"
FT   gene            616058..617038
FT                   /locus_tag="BURPS1710b_0603"
FT   CDS_pept        616058..617038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0603"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49793"
FT                   /db_xref="GOA:Q3JWN6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN6"
FT                   /protein_id="ABA49793.1"
FT                   /translation="MRRRPGRIARRAAVPPDARRVSPDDPAARLRYTGFAGLSAHPTLH
FT                   FEGRSSMTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWR
FT                   DVDRDPDARVAVIRGEGKGFSAGGDLALVERMADAHAVRERVWREARDLVYNVINCSKP
FT                   IVSAMHGPAVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKA
FT                   KYHLLLCEPVSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNW
FT                   LRLAGPTFDASLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS"
FT   gene            617128..617937
FT                   /locus_tag="BURPS1710b_0604"
FT   CDS_pept        617128..617937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN5"
FT                   /protein_id="ABA48898.1"
FT                   /translation="MTDPNGSNPFSGFGGFQPAGFLDKMWDMMRLTPFGAMSALPGASQ
FT                   GLPPSLSAMSDLMAPLASVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLAT
FT                   LRAFGALAQTSMAAAEAALSPDDSAPREPASAAASASAAKREASAGEPADAQGARDADG
FT                   ETPPPGADAFDPAGWWNLLQSQFNQLARFAMTQPGMAAAGDAPAAGAAAGPKPSAAKKP
FT                   ATRRAAAPRTGGSAADRAPGASSASSASSAGGDAKPAAAKKPARRGA"
FT   gene            617974..619218
FT                   /locus_tag="BURPS1710b_0605"
FT   CDS_pept        617974..619218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0605"
FT                   /product="Patatin"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50620"
FT                   /db_xref="GOA:Q3JWN4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN4"
FT                   /protein_id="ABA50620.1"
FT                   /translation="MRLALVLMGGGARAAYQAGVLKGLAEIAHDVDPKRRTSPFSVICG
FT                   SSAGAINATSLASHADDFEHGVRRLLEFWEQLRAERVYRTDWLGIAAAGARWLAAMSIG
FT                   WAARRSPRGLLDNAPLAYLLRRELDFHRIELMLEARKLHALSVTALSYSSGRHLTFYQA
FT                   SEPIQAWRRAERTARMVDLSAEHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPL
FT                   SPAIHFGSDRIVVVGAADPRPEVPAANGNGRGYPSLAQIGQQVLASVFLDSIGADIERI
FT                   DHVNRMIEHLPAYVEPESGWRHVDVLAIAPSERIELIASKHLKRLPLTVRGLLGAVGGN
FT                   KPAGASFASYLLFEAEFTRELVELGYRDAHGQRERLAQWIASAERRGGPAERGPGAGTD
FT                   ARTGAGAHAARRTTT"
FT   gene            619811..620686
FT                   /locus_tag="BURPS1710b_0606"
FT   CDS_pept        619811..620686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51017"
FT                   /db_xref="GOA:Q3JWN3"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN3"
FT                   /protein_id="ABA51017.1"
FT                   /translation="MNTMLYPELYKSLEAVRWDMEKDIPWDKFDASLLTDEQAKTIKMN
FT                   AITEWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELMPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYETISRDEARHGG
FT                   AYLRYMKKALNNCGDVARAAFSKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRL
FT                   PDPEWLERWLDEQIRFDGEWEKKVVERILHNLSVLFERTFATAQELNRYRKEVTARLQS
FT                   ESGPAAAQPA"
FT   gene            620827..621312
FT                   /gene="rfaE"
FT                   /locus_tag="BURPS1710b_0607"
FT   CDS_pept        620827..621312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="BURPS1710b_0607"
FT                   /product="rfaE bifunctional protein, domain II"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50187"
FT                   /db_xref="GOA:Q3JWN2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN2"
FT                   /protein_id="ABA50187.1"
FT                   /translation="MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA
FT                   DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS
FT                   LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR"
FT   gene            complement(621364..621786)
FT                   /locus_tag="BURPS1710b_0608"
FT   CDS_pept        complement(621364..621786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50074"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN1"
FT                   /protein_id="ABA50074.1"
FT                   /translation="MLRWLISILFLANMLAFVVVRGVFGPLPAAGPREPGHALLQVRPD
FT                   ALRVTPVSQAADQPIVGGPIVPPALETAPLNAPGAAPAAASDSAPGSPAASAPASAVAP
FT                   ASMPASVAAPAAPAPSSPPAAQPARAPILPGASAAR"
FT   gene            complement(622672..623940)
FT                   /locus_tag="BURPS1710b_0609"
FT   CDS_pept        complement(622672..623940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0609"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="identified by match to protein family HMM PF02237;
FT                   match to protein family HMM PF03099; match to protein
FT                   family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49375"
FT                   /db_xref="GOA:Q3JWN0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN0"
FT                   /protein_id="ABA49375.1"
FT                   /translation="MSDRTQGRSSASCDAPHHAASHRIALRRAGRRTRHPTRRRTASAE
FT                   PARQNAAAHPIARRRPHAAMMGASPTEPRKAAIRPPVKRRARRTLRWQPSISSATIRAM
FT                   NVATPPSMPATGGPLIDRARVDAHLAPAAREWSIEIVDTTGSTNADLGARLKALPRRRD
FT                   ALAAPIARVAYEQTAGRGRQGRPWFAKPGDALLCSVACVLPRPVGALAGLSLAVGAALA
FT                   EAFAARPAATGDAPRGDADGARRIALKWPNDLLVATERDGETAIVGKLAGVLIETVWNT
FT                   IDATAVVIGFGVNVRTADAAAAEVDALRARDATLAGGLPPVALAAVRAGATLTDTFAAA
FT                   LNALAVALPAFAADGLAPFAARWHALHAYAGREVVLLERGAELARGVAVGIDETGQLLL
FT                   DTPAGRQAIAAGDVSLRTPGAAR"
FT   gene            complement(623997..624881)
FT                   /locus_tag="BURPS1710b_0610"
FT   CDS_pept        complement(623997..624881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49173"
FT                   /db_xref="GOA:Q3JWM9"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM9"
FT                   /protein_id="ABA49173.1"
FT                   /translation="MNAIKKLLPTHAAPPPDGARRPPPRRRLLHARLSPVGMLAVAAAL
FT                   AAGVAVTERIERPASGAPAVSRAQLDEWRAMVEQASEPNALGRLRALAQRGSADAQAAL
FT                   GLALAGSRDLALRDEGWRWLETAAHATPPENAPTSAGERDARLALGKAWLLGAGGAARD
FT                   YPRALAMLRPLAAAGDPNAAYYVGLVYRSGYGTPADATEAARWFELAARHDIPAAQFML
FT                   ANAYRDGSGVRRDEARALALYRQAADHELPEAVQALAIAYRNGELGLPRDADAFHAQWI
FT                   EAAHALKHPALAP"
FT   gene            complement(624958..627006)
FT                   /gene="cpdB"
FT                   /locus_tag="BURPS1710b_0611"
FT   CDS_pept        complement(624958..627006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="BURPS1710b_0611"
FT                   /product="2`,3`-cyclic-nucleotide 2`-phosphodiesterase"
FT                   /EC_number="3.1.4.16"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48941"
FT                   /db_xref="GOA:Q3JWM8"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM8"
FT                   /protein_id="ABA48941.1"
FT                   /translation="MRFRRRRLAAALVACAALVAGCNDDVDSPGAQSGASAPAGTKATL
FT                   AVLETTDLHTNVLSYDYFKLAADKSLGFERVATLIAQARAQYPNTLLLDNGDTIQGTAL
FT                   ADYQALVKPVSCGETLAIYKVMNAAKFDGGGIGNHEFNYGLPYLSQVTGNAFAVDGLPD
FT                   PARQKKCAGPDFPQVLANVISAKTNAPLFTPYTILTKNVTATTPDGRTVTAPVKVGIIG
FT                   FTPPAIMSWDKRWLDGKVYTTGLKEAAEKYIPEMRAKGADLVVAISHGGLDNSPYSPTM
FT                   ENGSWWLSTVPGIDAMLIGHSHQVFPDATSTVAQFNLPGVDKVKGTVNGVPTVMANYWG
FT                   KHLGVIKLGLAFDGKTWRVDKSQTTVEARSIQNPDKSYVDADPSVAAAIAAEHQATIDY
FT                   VKTPIGSTDYRMTSYFADVGDPGAIQLVNEAQADYVANYVQTNLPQYASLPVLSVSAPF
FT                   KSGFGGGTDFTDVAAGALAINNAADLYLYPNTVYAVKVSGADIKNWLETAAKRFNTIDP
FT                   TKATVQKLVSTFPGYNFDMFTSADLRYEIDVTQPAGSRIRNLAYKGAPIDPNAQFIVAT
FT                   NNYRASGGGNFPGLDGSKTIFASPDANRDVLIAYIKKRGRITRAADGMQRSWRFTKLAG
FT                   SVAHVQFASAPNLAALASTAGLAGITQVAADDGSGKGLATYEIDLTQ"
FT   gene            627284..628408
FT                   /locus_tag="BURPS1710b_0612"
FT   CDS_pept        627284..628408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0612"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02405;
FT                   match to protein family HMM TIGR00056"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48802"
FT                   /db_xref="GOA:Q3JWM7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM7"
FT                   /protein_id="ABA48802.1"
FT                   /translation="MNFQTPPGLSIDAGSQGRTVRLCGQWTALALARDRGNVARRIARL
FT                   AKEAVGEWDLSGVERLDHVGGQALWRVWGRRLPDGIALTDNQRVVFERIERLDAGRESP
FT                   EPVVRIDPVTRFGQGLFTFGEHLYGGIALLGGLIVDLLAVLRRPRTMPWTEISANVYAA
FT                   GTKALPITALVAFLIGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAG
FT                   RSGSAITAQIGVMRVTEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTG
FT                   GALAAKFVLGIDLNFFVRSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQ
FT                   SLGEGTTTSVVTSITVVILADAVFAILFQNVGLG"
FT   gene            628405..629247
FT                   /locus_tag="BURPS1710b_0613"
FT   CDS_pept        628405..629247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0613"
FT                   /product="ABC transporter system ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48080"
FT                   /db_xref="GOA:Q3JWM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM6"
FT                   /protein_id="ABA48080.1"
FT                   /translation="MSARDDDFVIEVRDLTKRYGRNVVHEHLDFDVRAGEIVSIVGGSG
FT                   SGKTTLVRQILGLERPSSGTIRVFGEDTSKIDADTARVMRSRSGMLFQHGALFSSLTVF
FT                   DNVAQPLRELGRVPDDLLHDIVMLKLEMVGLPCKHASKMPAALSGGMVKRVGIARAIAL
FT                   EPELLFLDEPTAGLDPGASDEFVELIATLHRTLGLTVVMVTHDLDTMVALSTRVAVIAE
FT                   RKVLVAASVEEAAGVDHPFIREYFLGRRGRRALQALPPERRARLPKAALEPAPSDVEL"
FT   gene            629271..630200
FT                   /locus_tag="BURPS1710b_0614"
FT   CDS_pept        629271..630200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0614"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51077"
FT                   /db_xref="GOA:Q3JWM5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM5"
FT                   /protein_id="ABA51077.1"
FT                   /translation="MENKSHAFWAGLFTIALLGAIVGAVYWFNVDRTVRVPYDLVSRSN
FT                   VTGLFPDAAVRYRGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVT
FT                   GIAFVQLDDTGADLAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEML
FT                   SPEMRDQLKATAASMQHAADGVTQLSRQVEPALARMPQTMEHVNRALSSANALVAPGGP
FT                   LVANLNRAGQALASMNDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGRNP
FT                   RSLLFGSPAAAPGPGETGFVWPSATPAQ"
FT   gene            630219..630857
FT                   /locus_tag="BURPS1710b_0615"
FT   CDS_pept        630219..630857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48512"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM4"
FT                   /protein_id="ABA48512.1"
FT                   /translation="MHAHFMSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYD
FT                   LGPAQPAASSGTGPALKVLDVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQL
FT                   LTQRLRGALSGRGAVLAADDGVRAPVLKVELSEFEQVFDGRSESHAAVTARATLTQEGK
FT                   VLGQRTFVSRAPASTPDAAGGAQALATASDALVSQLVAWLGVQAYAAAQ"
FT   gene            630907..632100
FT                   /locus_tag="BURPS1710b_0616"
FT   CDS_pept        630907..632100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0616"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47657"
FT                   /db_xref="GOA:Q3JWM3"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM3"
FT                   /protein_id="ABA47657.1"
FT                   /translation="MTPAARRQRRHSTLARQAFAVYAALVVYASLYPFTGWRSLGIGPF
FT                   DFLLAPLPRYLTAFDVVSNVLGYLPFGALAVLALYPLRGVPAALAATLLGALLSGAMEA
FT                   LQTYLPTRVSSNLDLAANALGALVGAAAAAPAATALIERGVVRRVRFAWFEREASTPLF
FT                   LSALWAGAILFPSPFLFGIGDWPSELWERADVTMRGALLAWAPDAWNVPAWPERLDGLL
FT                   SDSAWETLLAALGLFAALAVASLAMRERAPRVRLVVGFAACALALKAAATFMQSYTGLV
FT                   LDWATPGALRGIAAGLVAALVALRLPAAWRAALAAAALAAALVLVNVLPVNPFFDFALS
FT                   GWQQGRYVHFNSIARWLAWIWPYAALVWLAGRAERAWLARRGAGASRRASGKRRRSL"
FT   gene            632218..632535
FT                   /gene="fdx"
FT                   /locus_tag="BURPS1710b_0617"
FT   CDS_pept        632218..632535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="BURPS1710b_0617"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51034"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM2"
FT                   /protein_id="ABA51034.1"
FT                   /translation="MDSYYRHHVFFCLNQREKGAERPSCANCGSQEMQEYAKKRVKELG
FT                   LAGAGKVRVNKAGCLDRCEEGPVVVVYPEGTWYTYVDKNDIDEIVESHLRDGQVVERLR
FT                   I"
FT   gene            632582..633226
FT                   /locus_tag="BURPS1710b_0618"
FT   CDS_pept        632582..633226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0618"
FT                   /product="Esterase/lipase/thioesterase family active site"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50213"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM1"
FT                   /protein_id="ABA50213.1"
FT                   /translation="MNAHTQKSLIAGPVGHIEIAIDLPDAVRDGSAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARIFVQLNYAVIRSNFRGAGATEGEHDNGAGEVDDLLAVLAHMRA
FT                   LPGHADLPLVLAGFSFGTFVLSHVGKRLRDAGQAIERMVFVGTAASRWQVAAVPEDTIV
FT                   IHGENDDTVPIASVYDWARPQELPVIVIPGAEHFLHRKLHILKRIVVGAWR"
FT   gene            633360..633500
FT                   /locus_tag="BURPS1710b_0619"
FT   CDS_pept        633360..633500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0619"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM0"
FT                   /protein_id="ABA48672.1"
FT                   /translation="MIIRRRSRRFPQIPGDPRRLSTARVAHRAFVQCRGKAGRAAPERG
FT                   V"
FT   gene            633968..635281
FT                   /gene="dac"
FT                   /locus_tag="BURPS1710b_0620"
FT   CDS_pept        633968..635281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dac"
FT                   /locus_tag="BURPS1710b_0620"
FT                   /product="penicillin-binding protein 6"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47611"
FT                   /db_xref="GOA:Q3JWL9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWL9"
FT                   /protein_id="ABA47611.1"
FT                   /translation="MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKP
FT                   AAKAKHAAAPAAAAAPTGAPATYVPGAVPPPGVNARSWVLVDASSNQVLASGNADERVE
FT                   PASLTKLMTAYLVFEALDAKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVY
FT                   GMIIQSGNDAAIALAELVGGSEAQFVNMMNAEAQRLGMKNTHFADVNGMPDPNHYTTAG
FT                   DLAKLSTHLIRDYPDYYNIFSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYC
FT                   LIASAKRALPGAADATRRLVTVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKASQPI
FT                   DTPRVYKGKSNNVQVGVKKDQFITVPRGLADKVKPEVALNAPLIAPLADGQVVGSVKLV
FT                   ADGKTVAEFPVVALQPVPEAGLLGRIWDSILLMFSKKK"
FT   gene            635371..636318
FT                   /locus_tag="BURPS1710b_0621"
FT   CDS_pept        635371..636318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0621"
FT                   /product="D-amino acid aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50292"
FT                   /db_xref="GOA:Q3JWL8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWL8"
FT                   /protein_id="ABA50292.1"
FT                   /translation="MNQADIEPIVYLSVASHEELVPLSEARVPVLDRGFIFGDGVYEVV
FT                   PVYADGARRAPFRIAQHLARLARSLKRIGIADPHDEAGWRALVAQVVDANAAALGDGRH
FT                   AIVYIQVTRGVAKRGHAFPANAVPTVFAMASPLALPSDAQRAQGVRCVTAEDRRWLHCD
FT                   IKSVSLLGNVLMAQHAAEHDAIETIQLRDGNVTEGSSSNVWIVKNGELIAPPRSNRILE
FT                   GIRYALVEELAEECGIRFVAREINEAELRAADEILLTSATKEVLPVTRLDDLPVQGGRP
FT                   GPVFDALYAAYQRAKAREMEASERAVPPTRGETT"
FT   gene            636315..636623
FT                   /locus_tag="BURPS1710b_0622"
FT   CDS_pept        636315..636623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04359"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49457"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWL7"
FT                   /protein_id="ABA49457.1"
FT                   /translation="MTEPNKTVELTGEIATPKETLLEFPCDFPIKVMGRAHPEFKDTIF
FT                   KVVSVHDNEIDLEKIEERASSGGNYTGLTITVRATSQAQLDNIYRALTGHPMVKVVL"
FT   gene            complement(636634..637599)
FT                   /locus_tag="BURPS1710b_0623"
FT   CDS_pept        complement(636634..637599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0623"
FT                   /product="glycine cleavage system transcriptional
FT                   activator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48643"
FT                   /db_xref="GOA:Q3JWL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWL6"
FT                   /protein_id="ABA48643.1"
FT                   /translation="MNIHRLPMLNALRVFEAAARHESFSRAADELSVTHGAVSHQMRAL
FT                   EAELGVPLFVRHGKRLALTDAGGRYAQQVRAALALLADATREVRASERDKRLVVSTLPS
FT