(data stored in ACNUC7421 zone)

EMBL: CP000125

ID   CP000125; SV 1; circular; genomic DNA; STD; PRO; 3181762 BP.
XX
AC   CP000125; AAHT01000000-AAHT01000077;
XX
PR   Project:PRJNA13954;
XX
DT   03-OCT-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Burkholderia pseudomallei 1710b chromosome II, complete sequence.
XX
KW   .
XX
OS   Burkholderia pseudomallei 1710b
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-3181762
RA   Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (28-SEP-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 5fad85413e38c9d1ae021c4c4b8359e0.
DR   BioSample; SAMN02604036.
DR   EnsemblGenomes-Gn; BURPS1710b_A0832.
DR   EnsemblGenomes-Gn; BURPS1710b_A1133.
DR   EnsemblGenomes-Gn; BURPS1710b_A1908.
DR   EnsemblGenomes-Gn; BURPS1710b_A1909.
DR   EnsemblGenomes-Gn; BURPS1710b_A1910.
DR   EnsemblGenomes-Gn; BURPS1710b_A1911.
DR   EnsemblGenomes-Gn; BURPS1710b_A1912.
DR   EnsemblGenomes-Gn; BURPS1710b_A1941.
DR   EnsemblGenomes-Gn; BURPS1710b_A2360.
DR   EnsemblGenomes-Gn; BURPS1710b_A2614.
DR   EnsemblGenomes-Gn; EBG00001177409.
DR   EnsemblGenomes-Gn; EBG00001177410.
DR   EnsemblGenomes-Gn; EBG00001177411.
DR   EnsemblGenomes-Gn; EBG00001177412.
DR   EnsemblGenomes-Gn; EBG00001177413.
DR   EnsemblGenomes-Gn; EBG00001177414.
DR   EnsemblGenomes-Gn; EBG00001177415.
DR   EnsemblGenomes-Gn; EBG00001177416.
DR   EnsemblGenomes-Gn; EBG00001177417.
DR   EnsemblGenomes-Gn; EBG00001177418.
DR   EnsemblGenomes-Gn; EBG00001177419.
DR   EnsemblGenomes-Gn; EBG00001177420.
DR   EnsemblGenomes-Gn; EBG00001177421.
DR   EnsemblGenomes-Gn; EBG00001177422.
DR   EnsemblGenomes-Gn; EBG00001177423.
DR   EnsemblGenomes-Tr; BURPS1710b_A0832-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1133-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1908-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1909-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1910-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1911-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1912-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A1941-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A2360-1.
DR   EnsemblGenomes-Tr; BURPS1710b_A2614-1.
DR   EnsemblGenomes-Tr; EBT00001756130.
DR   EnsemblGenomes-Tr; EBT00001756131.
DR   EnsemblGenomes-Tr; EBT00001756132.
DR   EnsemblGenomes-Tr; EBT00001756133.
DR   EnsemblGenomes-Tr; EBT00001756134.
DR   EnsemblGenomes-Tr; EBT00001756135.
DR   EnsemblGenomes-Tr; EBT00001756136.
DR   EnsemblGenomes-Tr; EBT00001756137.
DR   EnsemblGenomes-Tr; EBT00001756138.
DR   EnsemblGenomes-Tr; EBT00001756139.
DR   EnsemblGenomes-Tr; EBT00001756140.
DR   EnsemblGenomes-Tr; EBT00001756141.
DR   EnsemblGenomes-Tr; EBT00001756142.
DR   EnsemblGenomes-Tr; EBT00001756143.
DR   EnsemblGenomes-Tr; EBT00001756144.
DR   EuropePMC; PMC2168197; 17905875.
DR   EuropePMC; PMC2386483; 18439288.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000125.
DR   SILVA-SSU; CP000125.
XX
CC   Source DNA and bacteria available from Don Woods
CC   (woods@ucalgary.ca).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3181762
FT                   /organism="Burkholderia pseudomallei 1710b"
FT                   /chromosome="II"
FT                   /strain="1710b"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:320372"
FT   gene            751..15375
FT                   /gene="pksN"
FT                   /locus_tag="BURPS1710b_A0001"
FT   CDS_pept        751..15375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pksN"
FT                   /locus_tag="BURPS1710b_A0001"
FT                   /product="polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00550; match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51769"
FT                   /db_xref="GOA:Q3JMN8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN8"
FT                   /protein_id="ABA51769.1"
FT                   /translation="MSLHVHHLVLDGQSLLLLIGTLLDAYRALVDGVEPAPRAPAATHD
FT                   DFVAEERALLDSDEGARRIAYWRRQLDALPPALELPASAPAAAERAAGDAWHAVPLDAA
FT                   RSARVAAFVQSNHLGAAAFFLGMFKLLLHRYTGEPDIVVGMPADARPSQRYRDALGFFV
FT                   NMLPLRTRLAGETAVVAMLERVQRELVDAMAMQYPFGALVRELGLQGAEDGAPMYRIAF
FT                   MYQDFLARLRFSDDVEPIGEIRQAGEYELVLEVIEGAAPGGPARFALNWKYDGARYRAA
FT                   AVEAMARHYLTLLDGVLAAPAARVADCPMLPAAERERLLALGRGPRADHARERRVHDLI
FT                   DARAQQAPHAIAVSCGGRSLDYARLKADSDALAQRLRACGIGAGDFVAVRLDRSTALVV
FT                   GLLAVLKAGAAYVPLDPDYPDDWAAQMLGDCRPAAILTRAALAAGAHALARRVAADGPP
FT                   AVIALDDAADADTHAADGARAAAIAAARQAAASRAHAARAADLAYVIYTSGSTGAPKGV
FT                   MVTHRALTNFLASMARRPGLHARDTLLAVTTYCFDIAALELFLPLVQGAHCVICDSASA
FT                   RDGGRLRELIDAARPTVMQATPSTWEMLLHAGWRNARRMRVLCGGDTLPDAVKARLLED
FT                   GGEVWNLYGPTETTIWSMVAPVTAERPTSIGAPIDNTRIRIVDAYGNPVPIGVPGELCI
FT                   AGDGLAAGYLNRPDETAARFVDALPDVDGEARERHYRTGDLARWREDGEVEHLGRMDFQ
FT                   VKIRGHRVEVHDIERHLARHPAIRAAAVVARRHAGGDQLVAYYVRGDAAGHGGADDAPA
FT                   LAAELRGHLAGALPDYMIPALFLPIDALPMTHNGKLNRKALASRGIRLRVASSGERRAA
FT                   PPRAPAAADIEARLLAICREVLKIDDIDRADGFFEVGGNSLSVALIASRVGAEFGLARL
FT                   GAGAFFRYPTVAALAAHLGARLRGDAGAAEGADGADAGPAGADARASRPAQPRAAGPAA
FT                   RLPAALDDAIAIIGISCQFPGAQDHRAFWRNLRDGKSGARFYSEDELRAAGVPDTLIRD
FT                   RHYVPMQQTIEGKDLFDRHFFRLTTKDAQLMDPQFRLLLQHAWKAIEDAGCTRERIADA
FT                   GVYMSASNSYYQAMLRAAGTIDASDEYQAWLLAQGGTIPTRISYELGLTGPSLFIHSNC
FT                   SSGLVSLSVAAKSLLQRESRCALVGAATVLPDADIGYVYQPGLNLSSDGRCRTFDENAD
FT                   GLTSGEGVAVLLVKRARDAIDDGDPIYALLRGIAVNNDGADKVGFYAPSVGGQADVIRK
FT                   VLDATGIHPETIGYVEAHGTGTKLGDPVEVAALTDAYRRHTARTGFCAIGSVKPNIGHL
FT                   DTVAGLSGCIKVALSLRHGEIAPSINYEKPNREIDFAHSPFYVVDRLTRWPAREPGAPR
FT                   RAALSSFGIGGTNAHLILEAFERDEPPAGMRAPAARAARVIALSARTEERVRAQASQLL
FT                   AFLEQEAGALPDFDGFAFTLQVGREAMRERVAFVADGYDALAAALARFLRGEPDAAACF
FT                   TGARGGDSTLAALLDDTGDTGDTAAHGLIAAWCEQGKVAKIAALWAHGVNVDWRRLYGA
FT                   RAPVRVSLPTYPFAPERCEGVARRRAAAPAPRRAGVETAAARLHPLVHDDRSDGARRRF
FT                   AATYSGEEFFLADHLIRGKRILPGVAYLEMARMAAVRAHGDGALSLHDVVWMTPIVVDG
FT                   PCEVELSLEAAERVEAEGAAEAAAGVRTMRFNVTSGGGAGARRTNSQGTIRLAPGAAAP
FT                   AAARVDVAALLARCTREIGAQRFYTFLDSGGGHYGPTFRSVAALHQGEREVLARLALPE
FT                   SVAHADAFVLHPSMMDAAFQIADSLILQPRANGGCLPFFVKELVVRRRPGRDAWVHVRL
FT                   AGGDATLARYDIDLIDPDGTVCVSMREFSARAETAGGSGRPNTYRAAEWRAAECDGERD
FT                   GNELSELNELNEGNERRRAAPRVAVLDASPRLAHALRGIGVDALWLPADAAHAARGPAL
FT                   RDLDAALHAGAARDLLVLADERRELDDDALRAWLDGAPHAGGARRALVSIAGLADADAR
FT                   AVADIVERERHGRAADVRYDAGGARSVRGFADAAVARWLLDTDALRSGGVYWIAGANGP
FT                   LGASLACHLATVERATVVLTDAHAIDAARLACLDGYRAGGARLEFIEGDAARDGAALAQ
FT                   RIRARHGRIDGVLHCAQHASAPTLAALAALDRATRADALDCFVACEARDADPDHDPAAA
FT                   LVARFVERRHARVQAGLGGGRTVAIAAHAALPWPDDAPLLRAGGIASQPALAIVQALHH
FT                   ALRSDEAMLAVGWGASAGGVDAGASKAANASNASNASNASNASNASNASNASNASDASN
FT                   ASNASNTSNTSNTSNAPSVAADLAAPAEPNARIPARARATPDTIAACLKAVIADVIRAD
FT                   VDEIDARQHFGEYGLDSLSLTSVSNRLNDAYRLDASPAGALNPTLFFEYPSVERMAAYL
FT                   AEHHAARFADASAAPGADGAAECAPRPEAALNAEVEPGNGAAPAPEPEVGFRAGFEPVA
FT                   PPMPRIEPAASTPPDQPAPQPGGAWHAGRGARPAADDDVAIIGISGRFPGARDVAEFGR
FT                   NLFDGRDCIGEIPADRWDWRAYLGDPQHEAGKTNSKWGGFIDGIAEFDPLFFSLSPKEA
FT                   YLLDPAHRLLLMHAWWAIEDAGYNPAALAGSRTALFAGIAQSGYADLRRQAGEGIEGNS
FT                   FLGVVPSIALNRISHLLDLHGPSEPVETACSSSLVAMHRALVSLRCGDADMALVGGVQT
FT                   ILSPHAHIGFGKAGMLATDGRCKAFSSRADGFVRGEGIGMLFLKRLGDARRDGDAIYGV
FT                   IRGSAVNHDGRSSSLTAPNPAAQRDVIVQAHMRAGVDPRSIGYIEAHGTGTKLGDPIEI
FT                   NALTQALDTLLRAQREEGAAYVPGACAIGSVKSNIGHLELAAGVSGVIKVLLQMANGRL
FT                   AKSLHCDELNPYITLDGGPLRVVGANAAWPRPVDRDGREQPRRAGVSSFGIGGVNAHVV
FT                   LEEYPEADARARDDGQPAAVLLSARDSQRLADYASALLAFVRERREAAAHAPPPRLSDL
FT                   AYTLQVGREAMRERVGFVVTSLAQLEARLAAFVAGEPAGDGVYRGSVRPARGERAADAD
FT                   GLDRLVDIWLASRKHEALLGAWVKGAAIDWARLHAGGAPRRVHLPGYPFARERYWIAEP
FT                   APATGAPGEPAPPRMPTQPHGPTSDGRAESRHPLRRDAADGRFLLDLDGDEAFLADHRV
FT                   DGRRVLPGVAHLEIAYEAARRTFGPADAIRIRNLGWIRPIVADGALRIGVELSVTGAAE
FT                   GAFRLYTTDPQHGRLTHSEGAIGRADVAQSARALDLGALRDAFATAERVDPAVWYDGFS
FT                   RAGIDYGPSHRCLETCAVGPAGVLARVRLPAAEARAARPFTLHPGLMDAVLQAAIGLRK
FT                   RAGGAPRGTPYLPFALDTVEILGGCGEAAWAWLRPSPRDAADASASRGDAGKPAAERID
FT                   IDVCDDAGRISVTLRGLTSRPLARRTAPAPEAGNPAGEVGEVADATDADAAEVREISDV
FT                   SNVSNVSDVSDVSDVSDVAPLADGDVGLLARTAVWSALTPAQWLADPASRPRAGARVFV
FT                   LGGTAAQRREIARIHPGCEPLEANAADDGGDGADQQAHVDALRRRLAEGAPIDQLVWIA
FT                   PPEPAADARAGLRGDAIVAAQEHGVLQLFRIVKLLLAAGYGGKPLDWTIVTRETHATSG
FT                   VDEPSPTHAGVHGFVGSMAKEYRNWRVRLLDMPAREAWPIDAMFSTRFDPRGDALAYRR
FT                   GRWLARELAAIDALPDGGCHVKTGGVYVVIGGAGGIGEVWSRWMMERYQARIVWIGRRD
FT                   EDEQIRRKRERLARYGTPPVYLRADASERASLAAARERIAALRWDGRALPTSGVVHSAI
FT                   VLADASLATMDEARFLAAWRSKADVGVRVAEVFGGDPLDFMLFFSSITSFGKTAGQANY
FT                   AAGCAFKDAFAAHLGRTLPYPVKVMNWGYWGSVGVVSDETYRRRMASAGFGSIEPDEGM
FT                   SALERLLASRVGQIAVLKTLRPNLVGDSRADRIRHYPGRDWPDAAPAPATAALQAALAA
FT                   RAGRWHAQASALALGNPELETLIARGLLAGVLPYLDAPGSVDARHARWFDESRAMLHGF
FT                   GYLARDGAGDAPSWSLTDAGRAAAPHVWQDWERHALAWHDDERRVPMRLAHVCLRALPE
FT                   LLGGKRRATDVMFPGSSMALVEGLYKSNRKADLFNDVVHDAVLSYARALGRALDIVEVG
FT                   AGTGGTTDGLLRKLVEQGIAVREYRYTDLSHAFLLHAREHYAPRAPFLTTGIFDVDKPI
FT                   AAQRVPGGRYDVAVATNVLHATRDVRRALRNVKATLRAGGLLILNELSVKSLFSHVTFG
FT                   LLDGWWMYEDADLRIPGSPGIDSSTWRRVLAEEGFEYVFFPAQGLHAHGQQVIVAQSDG
FT                   VVRQPRAAAAPGAGAAASPSGGTQAAVPARRAAAASGAPRVEAIPPAAVAPAAFDAATA
FT                   APPGTAAAAATAVPADGRSALAHASSPVASPPQPGDAPALERMHAYLRDKLSQVLKLPP
FT                   ERIEPDASFASYGVDSIMAMALIAALEKELGSLPKTLFFEHETIEELGAYLLERCEPMP
FT                   SGVEPATVGADDRAAYSGARPHAWPASPTEPDEPTEPTASPASSASPVASPPQPGDAPA
FT                   LERMHAYLRDKLSQVLKLPPERIETDASFASYGVDSIMAMALITALEKELGSLPKTLFF
FT                   EHETIEELGAYLLERCEPMPSGVEPATVGADDRAAYSGARPHAWPASPTEPDEPTVPTE
FT                   PTASPASSAPPAASPPQPGDAHAPERMHAYLRDKLSQVLKLPPERIETDASFASYGVDS
FT                   IMAMALITALEKELGSLPKTLFFEHETIEELGEYLLERQGQERACHASNV"
FT   gene            15359..20032
FT                   /locus_tag="BURPS1710b_A0002"
FT   CDS_pept        15359..20032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0002"
FT                   /product="putative polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53505"
FT                   /db_xref="GOA:Q3JMN7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN7"
FT                   /protein_id="ABA53505.1"
FT                   /translation="MQATFNSDEVALAGDARRTDGDADRAAASPHGFRFVEKARIADEP
FT                   GLSARLAARKGDAHQDGVFLDLWPSIFLSDEHGDHIHVLRDRGLLFVTRFVGAPQREAA
FT                   LLSALLDRARGEGRALCYLDMSNRRKPDIERECGLLSTPLGVVQTIDDIRRFTLDGPRM
FT                   RKLRYLVSKFGRDPSCRVVEYTEPDPAVDGEIRAVMAAWSREKGVVNKVDAILADMRVG
FT                   NLLKRYRVYLTYLGDRLQNVVVLSHIGEGYITDQEYFVPDMPLGGTEYAYATIIERLAA
FT                   EGHRKFSLGLTWGLFEPEAGFSDAEGWTLVNRTEGQLAQIFRRGVQNHQYKNKYCPAEY
FT                   PLYLYRSADSRPQIIKQCMGQFFRNGVPYDEIARQIEADDARALAAAGAAPPRATHGGD
FT                   EAEARSALGGAPDDARAGAPDDASFDAPDEAPIEVSDHAPGSTPPPRAARDERGGERDD
FT                   GKGGQAGQADRSGKHDPADARGRAASGTPDAARAPALADIPDAFFDATQADPNAIRLDL
FT                   VSDSWAHLGYPFIRERARRLLAGLASPHADPAAPCGLFGVDHCVLTTSGRNAERVFFNL
FT                   FPAKRKTILQNIPFFSTRHNAAKAGFASVEIPDPRIFDPDCREIFRGGIDFARLREQLE
FT                   ARPDGVAMVLIELCNNASGGYPVPLAQIADVSALCRARGVPFVMDVTRIVRNAELIRRH
FT                   EPGCANVGLWDTVARIVAHADVVFGSLCKDFGVSAGGIVAANDGRLIGKARRYAEIEGA
FT                   LLDHVQTQVVCASLGERDALERGVAAQLDVARRVSDALDARRIPALLPVVGHCALVRAA
FT                   DMPGYAGRRYPRESLLRALLERHGVRAGIHLAGSGAERVIDRCIRIALPIGLDDARLAS
FT                   GLADALAGTAPGATDAPAALPDLLHARAPGAADTADTVDTVDTVDTADTADTADTAAQA
FT                   GARRGEAHASRAPMRASDDDAIAIVGMAGRYPGADDLSAFWRNLVDGVNAITEIPAERW
FT                   DWRAHYHPDPEQAARLRKSYGKWGGFLGEFDCFDPLFFWMAPRRIAMIDPQERLFLEEC
FT                   WKALEDAGYPPSRLGDALRERTGVFGGLSKHGFSLYASQYAGTQPHTSPASMVGRVSHF
FT                   FDLKGPSVAIDNHCASSLVAVHEACEYLRRGDGDLAIAGGVSLCLHPSSYVQLSLVRML
FT                   SRDAHCAAFDEGGAGYVPGEGVGVVVLKRLAQARAHGDPIHAVIRSGAVNHNGRMRYYG
FT                   QPDQAGQQAAIRAALARARIDPRSISYIEAAASGVETTDAVEMAALTEVFGDRAGAAGA
FT                   YTIGTVKPAIGHGEAASGMSQLMRVALSLKHATLTPTRLPRRPSPLIDFDRLPFRLAAE
FT                   AAPWAPVSVDGRPVPRRAGVTAIGNGVNAHLVLEEWPGAPADDSAAAPREPQVFVLSAQ
FT                   DGERLAAYVERWIAFLASGATPDFGRMLRTLQIAREPMPARLALVASDRDDLLRALRAW
FT                   RDGGASSRVHRGDARRRAGQAALAEQACDPRACAPDEAAAAWVQGRTVRWEALHRGGPW
FT                   RRVGGLPAYPFARERYWIADAASGAPAGREEASARPD"
FT   gene            20115..21773
FT                   /gene="prnC"
FT                   /locus_tag="BURPS1710b_A0003"
FT   CDS_pept        20115..21773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prnC"
FT                   /locus_tag="BURPS1710b_A0003"
FT                   /product="halogenase PrnC"
FT                   /EC_number="3.8.1.1"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52923"
FT                   /db_xref="GOA:Q3JMN6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN6"
FT                   /protein_id="ABA52923.1"
FT                   /translation="MSNNQVRKYDVVIIGTGIGGTTLGAILARHGLRVAMIDSGTHPRF
FT                   AVGESTIATTTLTLELMAMRFDVPELKHITSIAEVSENVMPSCGVKRNFGFVYHREHTE
FT                   QNPQEVNQALVVNEVHYFRQDIDAYMLHVAIRYGCDAYQNTVVDDIRIDAGGVTVTTRG
FT                   GLTFEADFVADGAGYRSVLADKLGLRETPCRAKTHARGLFTHMIDVKPFDACREVPKAL
FT                   QQPVPWHQGTLHHLFDGGWMWVIPFNNTPESKNPLVSVGLMLDPRKHPKPDVRPEQEFA
FT                   DFIAKHPDMARQFADARAVREWVSSGRIQYSASACTGDRFCLLSHATGFIDPLFSRGLF
FT                   NTMQTTNALAGLLIEAAKDRDFSKARFAPVEKLQQGLIDFNDRLVNCSYLSWGHYPLWN
FT                   AWFRLWLLTGNYGQLHLQRVMMKYRQTGDARWLEPADALLPGAFTTLEPIMRLFEEAAV
FT                   CVERYGAGELSGEAAERAIYALLEENAALLPPFFDFVSPAERITWPSTPEKIAALLLEW
FT                   VERLPEDVRAEYFDYDVRALLQQPVVKDTITADVA"
FT   gene            21862..23304
FT                   /gene="rbmK"
FT                   /locus_tag="BURPS1710b_A0004"
FT   CDS_pept        21862..23304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbmK"
FT                   /locus_tag="BURPS1710b_A0004"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52154"
FT                   /db_xref="GOA:Q3JMN5"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN5"
FT                   /protein_id="ABA52154.1"
FT                   /translation="MTSEISGKRRWYALVVLCLGVLMIVLDTTIVNVALPSIAAELRFS
FT                   ENALVWVVNAYMLTFGGCLLLGGRLGDLYGHRRLFLAGVTVFTAASLACGLAQTQLVLI
FT                   AARAAQGIGGAVVSSVALSLIMTLFVEPGDRAKAMGVYGFVYAGGGSLGVLLGGLLTSA
FT                   LSWHWVFLVNLPLGAVVYLLSSALLPKARAQATRAPLDIAGAVTVTAALMLAVYAVVNG
FT                   NAAGWLSARTLSWLGGAAALFAAFVAIEARVAHPLMPLALCMKRNVAIANLIGILWAAA
FT                   MFAWFFLAALYLQRVLGYGPLQIGLAFLPANLIMGVFSLIVSALLVVRFGIRVPIAAGL
FT                   LAAAAGLMLFARAPVGGDFVADVLPGMILLGTGAGIAFNPVLLAAMSGVDPADSGLASG
FT                   IVNTSFMMGGALGLAVLASVATARTDALLAARTAVPAAMAGGYHAAFMLGAAFAIVAAL
FT                   IGMRLRAAPNPAAMQGLQGATQ"
FT   gene            complement(23863..25635)
FT                   /locus_tag="BURPS1710b_A0005"
FT   CDS_pept        complement(23863..25635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0005"
FT                   /product="voltage-gated chloride channel/CBS domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52206"
FT                   /db_xref="GOA:Q3JMN4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN4"
FT                   /protein_id="ABA52206.1"
FT                   /translation="MLSTFAAFALLSLIHLFTNLFFFQRFSFAEHSPALNTLGPWAAAV
FT                   PVAGGIVVGLIARFGSEKIRGHGIPEAIEAILFGKSRMSPKVAVLKPLASGIVIGSGGP
FT                   FGAEGPIIMTGGAIGSLIAQFVKVTAAERKTLLVAGATAGMTAVFGTPVAAVLLAVELL
FT                   LFEWRPRSFLPVALACAVAGFARAAFFGVGPLFPVETAAPTAAALGSCALAGLLSGALA
FT                   CGLSVSLYKIEDRFGKLPVHWMWWPAIGGLAVGIGGLIEPRALGVGYDVIGDLLHGHIA
FT                   LQIALAILVVKAVIWVIALGSGTSGGVLAPLLMLGAGLGTLLGPVLPGGEPALWPLVCM
FT                   AATLGATLGAPLTAIVFAFGLTHDANALLPLLTATLVAHGFATVAMKRSIMTEKIARRG
FT                   YHIYREYGVDPLERHYVDEVMTRSAVTIDADLSVEVVRARYFGATQAHRAYPVVRDGVL
FT                   IGMLDRATLDGSPAAHDGDGQADDARAAKMRAADVQMTDMRVADVLPRRAPLFSLADET
FT                   CRLVATRLAVHQLERLPVVADPDTMRVVGIVSRSDLVKPALRHFDDEHKRERFRRAHPA
FT                   AFVKRRFAPARKTG"
FT   gene            complement(25754..26167)
FT                   /locus_tag="BURPS1710b_A0006"
FT   CDS_pept        complement(25754..26167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0006"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51646"
FT                   /db_xref="GOA:Q3JMN3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN3"
FT                   /protein_id="ABA51646.1"
FT                   /translation="MTKPARELRKTDFEQLSEFRYQMRRFERFSERAAQSEGITPLQYL
FT                   LLLHIKGYPERDWATVGELAERLQAQHHGVVALVTRCEALGLVRRRPSDADRRQVEVHL
FT                   QAAGERVLARLAELHRAELKSLRGAFQVPQIDY"
FT   gene            complement(26308..27348)
FT                   /locus_tag="BURPS1710b_A0007"
FT   CDS_pept        complement(26308..27348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0007"
FT                   /product="HPP family protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF04982"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52758"
FT                   /db_xref="GOA:Q3JMN2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN2"
FT                   /protein_id="ABA52758.1"
FT                   /translation="MRALPGLPGDVPLLVAPMGASAVLLFAVPASPLAQPWSLIGGNLV
FT                   AATVGVACAQWIADPVLAASVAIAGAIGAMFALRCVHPPSGAVALTAVVGGPAVHALGF
FT                   RFVAEPIALQSAALLGAALVYHALTGHRYPHGGAARPHADSNAHAAAAPLHARFVRADL
FT                   EAALKNRSEWLDVAPEDLESLLRETELRAYARTFDELSCAEIMSRRPISIAPDTPLPAA
FT                   MTLLERHRIKALPVVDADARVVGIVTRADLSKAAPYATPGFLRNLSARLPRSLVGPAFV
FT                   ARAVMSTRVHTVRTTTPIAELVPLFADHGHHHIPVVDADHQLAGIVTQADLIAGLYRQS
FT                   QVRLAA"
FT   gene            27530..28825
FT                   /locus_tag="BURPS1710b_A0008"
FT   CDS_pept        27530..28825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0008"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51332"
FT                   /db_xref="GOA:Q3JMP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMP3"
FT                   /protein_id="ABA51332.1"
FT                   /translation="MEGCADRSRDEPEIICHCDINCRPRRLRGRPLAFQDAENVRARAR
FT                   RRASAYNSPDLISTNHIICRPRCPLPACPMARASGRSVVPGRASRRSPLPAGRCSPFIP
FT                   EAHPMDMLDNMRLFVRVVEAGSFTAVAKEIDATTAQVSRAVSNLEAHVQTRLLHRTTRH
FT                   LGLTESGQRYFERAKSILAEIDYANAEARNALLRPSGKLRIHAMTGLGQSHVVSSIVRY
FT                   QEDNPDVSVELTLAQRMPNLVEEGYDVSIVSASHLPDSGYVAQTCGTSCSVLVASREYL
FT                   ARHGTPTTPDDLAKHVCLRLDTPASPGGEWRLERDDGDETVYALPPAPFQANVPDALSV
FT                   AVRAGRGIGSIALYTALDDIREGRLVRVLPNYRLDTLSVYAVYATRRYLDAKIRTFLDH
FT                   LRTTLAPALENDLKELNRLNGGVGKKALREVA"
FT   gene            complement(29352..30494)
FT                   /gene="chaA"
FT                   /locus_tag="BURPS1710b_A0009"
FT   CDS_pept        complement(29352..30494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chaA"
FT                   /locus_tag="BURPS1710b_A0009"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53668"
FT                   /db_xref="GOA:Q3JMP2"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMP2"
FT                   /protein_id="ABA53668.1"
FT                   /translation="MPDRLLESLLAPCHDQGHSMPISSSALPRWTLVAPLAAWLVLALS
FT                   RVVPAEGFAIAFVAAALAGAVFSAVHHAEVVAHRVGEPFGTLVLAIAVTVIEVALIVSV
FT                   MLSAGPEKAGLARDTVFAAVMIVCNGIVGLCLLVGGWRHGEQDFQGRGATKALAVLASL
FT                   SVLSLVMPNYLSAAPGPRLSTSQLAFAGVSSLVLYGVFVFVQTVRHRDYFLIDGSADES
FT                   VHAVPPSGRTALTSIAFLFVSLVAVVLLAKLLSPAVERTVLRLGAPEAAVGIVIAALVL
FT                   LPEGLAAVGAARANRLQTSMNLALGSALASIGLTIPTVAAVFIWTGAPLTLGIGAMETV
FT                   LLSLTLLVSTLTLSLGRTTVLHGVVHLSLFAAYLFLSITH"
FT   gene            30715..31953
FT                   /locus_tag="BURPS1710b_A0010"
FT   CDS_pept        30715..31953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0010"
FT                   /product="possible membrane efflux protein"
FT                   /note="identified by match to protein family HMM PF01914;
FT                   match to protein family HMM TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52669"
FT                   /db_xref="GOA:Q3JMP1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMP1"
FT                   /protein_id="ABA52669.1"
FT                   /translation="MTRPSCPAGALEAVETASRDERRALQRARLKGALRRASDHVAHYQ
FT                   PLLRCGGRASGDVPKTLADRARVRAVTRVGIGRAVARRKSCAAGCQMPDAGCRMQGTSR
FT                   KTRSTTRRAARAIASIGSTRGRRRAEIRTPPRRVCGVGEAPAGERRMNEDGRRAAVADG
FT                   RGRACSTMARPRERPPITLVRPSRFPMIVDRLISEILFGFTGLMGIINPFGIAFLFLER
FT                   TESLTEAQRAALARKVAINAFIVLLAAFFVGTPILHFFGISLEALRIGGGLAVAVAGWQ
FT                   MLNEPDVPTGGDTAAQPVEPRNAMARAFFPLTIPLTTGPGSIATAIALNANRTHKLSEF
FT                   VLSSIVSVAVSALAALVIWQTYSRAAFLARYLGTEGTKVAMRVSAFLLLCVGVQIMLTG
FT                   FSEFLRPIADQVK"
FT   gene            complement(32300..33208)
FT                   /locus_tag="BURPS1710b_A0011"
FT   CDS_pept        complement(32300..33208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0011"
FT                   /product="CAAX protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51573"
FT                   /db_xref="GOA:Q3JMP0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMP0"
FT                   /protein_id="ABA51573.1"
FT                   /translation="MRPFIRSFVVLFMSGNTFWLAAPWAALFVAALAAVWFPKLRAASV
FT                   GLGALGYAGAFASGLIAPVALAPIALLAAAAYAVAPRRHAAVRVAGHAVFVALALALML
FT                   HWLPGFHNPRVIGPVRFTPDAAPFTMYLNLDKPLVGFWLLWVLPWLRPIDDRARAWRAG
FT                   IVAAAATSAVCLVFALGVGLVGWAPKWPESAWLWLANNLLFVCFAEEALFRGYLQGGLS
FT                   RLLANRVPAAGTVALVAAALLFGAAHAAGGWQWVALATVAGVGYGLAYRAGGLQAAVLA
FT                   HVGLNLAHFGLFTYPMLAVAR"
FT   gene            complement(33384..34088)
FT                   /locus_tag="BURPS1710b_A0012"
FT   CDS_pept        complement(33384..34088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0012"
FT                   /product="Fumarylacetoacetate (FAA) hydrolase"
FT                   /EC_number="3.7.1.5"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51217"
FT                   /db_xref="GOA:Q3JMN9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN9"
FT                   /protein_id="ABA51217.1"
FT                   /translation="MTDYVFAPPAVPSVEIAGCAARFAVRRVFCVGRNYADHAREMGAD
FT                   PNREPPFFFTKPADAIVPASGTVPYPTLTSELHHEIELVIAIGRGGRAIAADAALDHVW
FT                   GYGVGVDLTRRDLQAEAKKAGRPWDWAKGFDASGPVTALHPAASIGHPQRGRIWLAVNG
FT                   ALRQQGDLADMIWPIPDVIAYASRAVELRAGDLIFTGTPAGVAALQPGERVTGGVDGVA
FT                   SFEFVVGEKPAA"
FT   gene            complement(34264..35721)
FT                   /locus_tag="BURPS1710b_A0013"
FT   CDS_pept        complement(34264..35721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0013"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53176"
FT                   /db_xref="GOA:Q3JMN1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN1"
FT                   /protein_id="ABA53176.1"
FT                   /translation="MGGGRWAVGGGRWAVGGRRQAAGDRRQAASGKRQAASGKRQAASG
FT                   RQAISPCRSISCNPSRASGRRPRRGGSRRRDAAAKRRLSERAQRTMAGARRPNSFAPPP
FT                   LPCPRVFSDNSTIARRAAARGGPRDPHHAHRTPMPSPVKPRTYAMPERSDRLDFYIRDE
FT                   AARRAITEPHRHAYFQIQFNLGGDTEQRIGGFTRAFPRGALAFVLPYREHLIAHPPGAH
FT                   FVVINFSQTFLRADLDVDPLDLEDVCAQRAPELAPFRFQEHLDFILTGAAFDDARRLAQ
FT                   RMLEANRARTFGSVPLLRGYLLQLIGLVCTQYAGPLTKLAQSGAHRTGRRDAFARVLRH
FT                   VRANLTNDALTLAGTARAACLSPNYLAHLIRKETGSTFTDLVTARRIALAQSLLAHTTR
FT                   RIADIAHAVGFRDEGYFSRRFRACVGVSPKEYRDANGAPGPADALDSADALDSVDTAGP
FT                   RAAPGGGETRGAAGAKSPARAAAKPRA"
FT   gene            36048..37535
FT                   /locus_tag="BURPS1710b_A0015"
FT   CDS_pept        36048..37535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMN0"
FT                   /protein_id="ABA51642.1"
FT                   /translation="MRAARADAGGGLRVPGRHVAVRPCGADGRLRPRRRQRRWRRLLND
FT                   GAARELRIGRRRLAAAVAPLCARADGRPRVGRRSRTGHRRARVLAHARVPSRQQSARVA
FT                   VDDPAPSVHRSVARAPRIRRRRRRRPVAHARGARRPDRRARAARRAANAVPAAARAARS
FT                   AAARLRRRVELSGRVGGARRAGRHRDVAAVARAGAHARAADRRAAAAAAVPYRCETSSM
FT                   SDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDPRAAGIAAHYRAQRAA
FT                   LRALFADPVAPRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGWLGGALAPRFAPSAAL
FT                   QWVAPAAAQRAFARDADLAYALYAPDARHPVEIAAGRDGAPLAWLSARVGRRIAAPSLR
FT                   EYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREAAVRPWRDGGRHTFYW
FT                   VSERTAYALSGQLDEGRLRTIAADVCGELGGHPQRWR"
FT   gene            36193..36714
FT                   /gene="ecfR"
FT                   /locus_tag="BURPS1710b_A0014"
FT   CDS_pept        36193..36714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfR"
FT                   /locus_tag="BURPS1710b_A0014"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53661"
FT                   /db_xref="GOA:Q3JMM9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM9"
FT                   /protein_id="ABA53661.1"
FT                   /translation="MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRA
FT                   FRPDSNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRM
FT                   LYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPP
FT                   LSLTAARHHR"
FT   gene            37599..38585
FT                   /locus_tag="BURPS1710b_A0016"
FT   CDS_pept        37599..38585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0016"
FT                   /product="YceI-like family protein"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52201"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM8"
FT                   /protein_id="ABA52201.1"
FT                   /translation="MDAAGSFASFAATLACALSAWLAPSAGIAQTAWPPDAPRVAGASG
FT                   PPRTPGLARTPAAVTDAPGAATAGALAASPPAATRYRLDPRHSGVTFRVDNFWHAHLTM
FT                   RFARMRAELSHVGDDRLASRVDVTVDAASLGANVPFVAALVKGSAMLDVARYPEIRFVG
FT                   TRFERTGATTGVLTGELTIRAMTRPITLAVRFDAGRQLEPDTGARAEREGDESGESGES
FT                   NPAERRAGQGRRAAELRDGRPRDAGPGVADSRDAMRRETDSGSAHRGAEPPERIARAAP
FT                   DAARPLAFVADGHFSRTAFGLSRWLPAVGDDVRLRIRAEFVRARADP"
FT   gene            38625..38984
FT                   /locus_tag="BURPS1710b_A0017"
FT   CDS_pept        38625..38984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0017"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF03640"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53306"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM7"
FT                   /protein_id="ABA53306.1"
FT                   /translation="MIRNVLIALVCAAPVAALAEPPKAAGGMIVDDDGMTLYTFDRDTM
FT                   PGKSACTGGCTANWPAALADAYDKPGGDLGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQ
FT                   HTGDGFGGMWHVARP"
FT   gene            39482..39991
FT                   /locus_tag="BURPS1710b_A0018"
FT   CDS_pept        39482..39991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0018"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51337"
FT                   /db_xref="GOA:Q3JMM6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM6"
FT                   /protein_id="ABA51337.1"
FT                   /translation="MPANTLRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTF
FT                   IRLLARDEPIDAAEPRAFLTTVAQRVLYNHWRRERLERAYLDALAQWPEAVAPSPETRA
FT                   VLFETLVEVDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQC
FT                   YFAIAA"
FT   gene            39988..40992
FT                   /locus_tag="BURPS1710b_A0019"
FT   CDS_pept        39988..40992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0019"
FT                   /product="FecR family protein"
FT                   /note="identified by match to protein family HMM PF04773"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51829"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM5"
FT                   /protein_id="ABA51829.1"
FT                   /translation="MSGAKPAGGPPAVPERVARRAVQWWVELGAAPASDATRARLARWR
FT                   AEHPAHDAAWRHIEAVNGRLGHVASALSARAARAALLPPRSRGRRAALKALAVLLFAGG
FT                   GAWTGQAYLPWRAWGADVRTALGERRTITLADGTTVVLNTDTAIDIRFDDATRGVRLLR
FT                   GEIMVTSGRDAARAVPRALVIATAHGDVRPVGTRFSVRERGDATRVDVFDGAVRIAPRR
FT                   AVGRAPLITAGHGADFTRDALAGPPRVLGASAGAWVDGILVASNLRLADLLAEIDRYRP
FT                   GRVRCDAAVANLRVSGTYPLDDTDRILDTLRETLPVDVEYLSRYWVTVVAARD"
FT   gene            41119..43764
FT                   /locus_tag="BURPS1710b_A0020"
FT   CDS_pept        41119..43764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0020"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07660; match to protein
FT                   family HMM PF07715; match to protein family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51347"
FT                   /db_xref="GOA:Q3JMM4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM4"
FT                   /protein_id="ABA51347.1"
FT                   /translation="MDSICNRRPRRAHAGVCADTANAPAGLPEAAQPAARLGAGRPRDA
FT                   AAPRCARQATSHTSHASHTLHAPCMPQFAPRRVVARVAAAALFSACAAPGVSGAAEPAA
FT                   ATRGYDIPAGPLDAALTRFGREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGT
FT                   GLVALRQPSGGYTLARLPGPAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGL
FT                   RSDAPLAEVPQAVAIVAQQVLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGD
FT                   NRDGSVMRNGMPIVQGRSLNATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLARRH
FT                   AISALGSTYGGGRNGGELTFDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPS
FT                   LAWYGRDTQMVLSYEYRRFLMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLA
FT                   QLAIDHQLAPDWKVHVGYSYNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYG
FT                   IAYVDGRVTLAGMRHDVQFGVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVS
FT                   ASDSDQSDTLHTASLFFQDSIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKW
FT                   LPRAGIVYKWNDALSLYGSYTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDM
FT                   PGGLAGTLAFFDIDKKHVLVSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIA
FT                   SYAYIDAKTTEDPLYAGNRLWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPG
FT                   DSANSFTLPAYATADAFATYDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDAR
FT                   QVSLLTTLQF"
FT   gene            complement(43983..44963)
FT                   /gene="rbsC"
FT                   /locus_tag="BURPS1710b_A0021"
FT   CDS_pept        complement(43983..44963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="BURPS1710b_A0021"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51576"
FT                   /db_xref="GOA:Q3JMM3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM3"
FT                   /protein_id="ABA51576.1"
FT                   /translation="MRDATDRLSRFAALGALAAVLAFFAVAAPGFATLANVERVLVNNF
FT                   ALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALG
FT                   AANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWL
FT                   GVAAPLWIVAALAGALHVALERSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASAL
FT                   VYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFV
FT                   ANGLLLIGWNFYWQQVASGALVFAVLALGSGVGRERRARDAGQSG"
FT   gene            complement(44956..46029)
FT                   /locus_tag="BURPS1710b_A0022"
FT   CDS_pept        complement(44956..46029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0022"
FT                   /product="ribose transport system permease protein RbsC,
FT                   internal deletion"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53793"
FT                   /db_xref="GOA:Q3JMM2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM2"
FT                   /protein_id="ABA53793.1"
FT                   /translation="MSGGACDLGRAGAAARRSPETAGAPVALPGARGWTPARRVLLRGG
FT                   PWLALALVFAGFSVSSPLFVTFANLGNVLQQSAVTGLLAFGLTIVMIGGGADAIKGGLD
FT                   LSIAANLGLCAAVFAALTRGGHGDALALAATCATGVAVGALNAWAVAWLRIPPLLATLA
FT                   TMNVCAGLELVLTENAPISSPSPLAAALVGTGPFGAPWLAYALVGVAAVLAALAHRTRY
FT                   GLALHALGAHRAAALAAGVDARRYVASSYVASGLSAALAALASCALLSGSAPGAGDYLL
FT                   PVVAAVLLGVVFSRRLVPTIPGTLVAVLFVGLLANGFQLNSVSSYWVSGVEGALILFVV
FT                   AAVALLRRRRSQGAFDA"
FT   gene            complement(46038..48665)
FT                   /locus_tag="BURPS1710b_A0023"
FT   CDS_pept        complement(46038..48665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0023"
FT                   /product="ABC transporter, ATP-binding protein domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53012"
FT                   /db_xref="GOA:Q3JMM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM1"
FT                   /protein_id="ABA53012.1"
FT                   /translation="MRPAHLRPSHNQSTNRSFPSRASLHRIVRSLPRPNPDPPIMPRPL
FT                   PSLARLLSMLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITAAGTDHY
FT                   WDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIAQIQTLIAQQPDAIIEQLGTASVLEP
FT                   WLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLVFNGFYG
FT                   VPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKGAISAIW
FT                   AAWDIPQVGATQAVDVRRVVKRFGGVAALRGASLAVTRGTVHGLIGQNGAGKSTLVKLL
FT                   AGLHAPDEGEITVGGVPFASGGGGSRAPAGAARRHSTGIGFIHQERLLPATFTVAEALF
FT                   FPHPPTLGGRASRLARLLPLDVKRMRRDCRAVLHTQFGLDLAPDRLIGELSVAEQQIVQ
FT                   ITRALLGRHEILVFDEPSAALVSSEVDRLLRTIERLRANGHTILYVSHYLDEIARVCDR
FT                   VSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPAAAAPSAATARAAARADARVSARADA
FT                   WGDDAHRAPAGADPARPGARAAPGAIALEARDLALPGRFGPLSLAVRRGEIVGLTGGLG
FT                   SGGKDVIRALFGLARGVRGSIAVDGRPARVRRPHDAVAHGIALVPENRAAHGVALTLPV
FT                   RENVVLADLSSVSRFGLVHGRREADVARALIRRLDIRPARPDLPARFLSGGNQQKVALA
FT                   KWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDALARAGAAVLLFSSDLTELLDVTDRVY
FT                   VMARGEIVAQCASAETTTRDVLAWATRARDARPGGGAGAHDAAARTGTPGAAGAASSAA
FT                   KVAT"
FT   gene            49201..49917
FT                   /locus_tag="BURPS1710b_A0024"
FT   CDS_pept        49201..49917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0024"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51735"
FT                   /db_xref="GOA:Q3JMM0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMM0"
FT                   /protein_id="ABA51735.1"
FT                   /translation="MEHEVRPSMATTRRHATATALAAAARPCAAPHADSFLGILIEVFA
FT                   RVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPLALF
FT                   FSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRGIVS
FT                   RGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSEDAAY
FT                   RAYRRSVRYRVIPGLF"
FT   gene            50024..50563
FT                   /locus_tag="BURPS1710b_A0025"
FT   CDS_pept        50024..50563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52450"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML9"
FT                   /protein_id="ABA52450.1"
FT                   /translation="MIRSETPPARGRYVQAARRFAPATCGQCPRRGGGGRRGIRTGFTR
FT                   ASHGLGAARCGGPAPPGPRGRGDIAAEDLVNQRGEGDCRPASSWRPARAPADPGQSGST
FT                   ITISLAASGKQSVECGNNQNPSLNGRVISPSTNGAFASGSPSKATRGSTWDSVLNIHHT
FT                   LTFSGAGGLNVAGPQT"
FT   gene            complement(50665..51924)
FT                   /locus_tag="BURPS1710b_A0026"
FT   CDS_pept        complement(50665..51924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0026"
FT                   /product="acyl-CoA dehydrogenase-family protein"
FT                   /note="identified by match to protein family HMM PF02770;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52855"
FT                   /db_xref="GOA:Q3JML8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML8"
FT                   /protein_id="ABA52855.1"
FT                   /translation="MSHAPADPTRSTGADYASLAARFRPIFARIAEGAIERDRTRALPH
FT                   EPIRWLKEAGFGALRVPVHAGGAGASVPQLVQLLIELAAADSNLPQALRGHFAFVEDWL
FT                   NAPPDAARRAWFDRFASGQLVGNAWTEVGDVALGEVRTKVAKRDGGWVVNGEKYYSTGA
FT                   IFADWIDVYAQRTDDGGPVIAAVAARQDGVILGDDWDGFGQATTGSGTTRFVDAHVDEA
FT                   NVIDFARRFKYQTAFYQLFHLATLAGIGRAVERDASALVRGRRRVYSHGNAPRVSDDAQ
FT                   ILQVVGEISAWAYAAEAIALRAAQPSQRAYEARGGGDAAAEHDANVAAEIESAQGQLVV
FT                   SELVLRAATHLFDALGASATRATNALDRHWRNARTVASHNPLVYKARIVGDRAVNGTEP
FT                   PYVWQIGAGPGGPREPEQAA"
FT   gene            complement(52128..53597)
FT                   /locus_tag="BURPS1710b_A0027"
FT   CDS_pept        complement(52128..53597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0027"
FT                   /product="putative sugar transport protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52686"
FT                   /db_xref="GOA:Q3JML7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML7"
FT                   /protein_id="ABA52686.1"
FT                   /translation="MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGV
FT                   FLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVF
FT                   MADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKAS
FT                   RLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAAPALAIIAVRGRYMN
FT                   ESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLV
FT                   ASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYR
FT                   LPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYP
FT                   ALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAA
FT                   IRFEPTARDVDVDIDAGSRAQGDRARVRAAA"
FT   gene            54892..55164
FT                   /locus_tag="BURPS1710b_A0028"
FT   CDS_pept        54892..55164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0028"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53383"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML6"
FT                   /protein_id="ABA53383.1"
FT                   /translation="MNTKTTIVWATAAALTALALSPAAFAQGKTRDEVRQELIRAQHEG
FT                   VVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTLAR"
FT   gene            complement(55259..57406)
FT                   /gene="irlS"
FT                   /locus_tag="BURPS1710b_A0029"
FT   CDS_pept        complement(55259..57406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irlS"
FT                   /locus_tag="BURPS1710b_A0029"
FT                   /product="IrlS"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR01386"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51250"
FT                   /db_xref="GOA:Q3JML5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML5"
FT                   /protein_id="ABA51250.1"
FT                   /translation="MAREARARGRAAPAARIIEVNPDANTDRGRRAEDRHVSAQGADRS
FT                   GLHRGLGRGRRDGPASGRDRGVRPDHPRRDAARPRRLDGARAAAPRALDARAVPDRARR
FT                   RRRPREGARARRGRLRRQAVRFRRAGRARALDPAPRAGARIDGPADRRSGARPDAAQGH
FT                   APGRRRAADREGIRAAVAADAPRGRDPAARDDRLAGVGHEFQQRHERRRRGDPPAALED
FT                   RRRVRAEADPHGARDGLRARSQKRERAEPMIRRLLPRTLRARLTALIILSTAATLALSG
FT                   VALYSALHNRLVGMSSYEMSATLAAMRTHLANVANVDDIPRKSDLWIDQLHGHQNLDLA
FT                   IYDTDGRLRFATRGFVAPRPALGAPQTRVPASAAPAGATFSYLADDAPLRGGNPRTARI
FT                   VVQYDGKNDHALLRAYAYTVVVIEVLAVVLTAALAYGIAMLGLSPLRRLVARAEQMSSS
FT                   RLAQPLPELDTSGELKEMEHAFNAMLKRLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQ
FT                   VALSKPRTADEYRDVIESSIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLDAAAQAER
FT                   VAGYYEPMAEDAEVSIVVRGKAEVRADALLYHRALSNLISNALNHAPRGSTITIECAQA
FT                   ADAATISVSDTGRGIEAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTC
FT                   GVDSEPHVRTTFWLKFPAHAA"
FT   gene            complement(56650..57339)
FT                   /gene="irlR"
FT                   /locus_tag="BURPS1710b_A0030"
FT   CDS_pept        complement(56650..57339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irlR"
FT                   /locus_tag="BURPS1710b_A0030"
FT                   /product="DNA-binding response regulator IrlR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52506"
FT                   /db_xref="GOA:Q3JML4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML4"
FT                   /protein_id="ABA52506.1"
FT                   /translation="MRILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEY
FT                   DLIILDVMLPGHDGWTVLERLRRAHSTPVLFLTARDDVGDRVKGLELGADDYVVKPFDF
FT                   VELVARVRSILRRGQARESTVLRIADLELDLTRRKATRQGDVVLLTAKEFALLWLLMRR
FT                   EGEILPRATIASQVWDMNFNSDTNVVDAAIRRLRSKIDDAYEPKLIHTVRGMGYVLEVR
FT                   SASAPSR"
FT   gene            complement(57346..60579)
FT                   /gene="czcA"
FT                   /locus_tag="BURPS1710b_A0031"
FT   CDS_pept        complement(57346..60579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="BURPS1710b_A0031"
FT                   /product="heavy metal efflux pump CzcA"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00914"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53203"
FT                   /db_xref="GOA:Q3JML3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML3"
FT                   /protein_id="ABA53203.1"
FT                   /translation="MFERLIRFAIAHRWLVMLAIVAAASLGVYSYQKLPIDAVPDITNV
FT                   QVQVNTSAPGYSPLEAEQRITYPVETAMAGLPNLEQTRSISRYGLSQVTVIFKDGTDIY
FT                   FARQLVNERIQEAKDKLPPGVAPAMGPTSTGLGEIYLWTVEADAGARKPDGTRYTSADL
FT                   RELQDWVVRPQLRNVPGVTEVNSIGGYVKEYRVAPNPTKLMSYGLTLADVVRALERNND
FT                   NVGAGYIEKRGEQYLVRVPGQARSAEDIANIVLANAGGVPVRMKDIGAVDLGRELRTGA
FT                   ATANGEEVVLGTVFMLMGENSRTVAKAVAARMADVNRTLPAGVRAIAVYDRTVLVEKAV
FT                   RTVKKNLLEGAVLVIAVLFLFLGNIRAAVITALVIPLSMLMTFTGMVNAKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENCIRRLAHAQQAAGRPLTRDERFAEVFAASQEARRALIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAITVVMALAAAMALTVTFIPAAVALFIGRRVEEKENR
FT                   LMSAAKRLYAPVLDAFVARPGQVLAGATAVVALSLVLATRLGSEFIPSLNEGDLAVSAQ
FT                   RIPGTSLTQSVAMQQSIEKTLKARFPEIDRVFARTGTAEIAADPMPPNLSDGYIMLKPA
FT                   DQWPDPRKSRDALRGEIEAVLAQLPGNAYEFSQPIQLRFNELISGVRSDVAVKIFGDDM
FT                   ATLNATGEQIAAALQKVPGASEVKVEQTTGLPVLTVNLDRDKLARYGVTVGDVQDTVAA
FT                   AVGGRKAGLLFQGDRRFDIVVRLPDELRTDVEAIKRLPIALPLAAPAGASGPLAQAPYV
FT                   PLAELATVDTSPGPNQISREDGKRRVVVSANVRGRDVGSFVADARERIASDVRVPAGYW
FT                   LSWGGQFEQLQSASERLKIVVPLALAMVFVLLFVMFNNAKDGLLVFTGIPFALTGGVVS
FT                   LWLRGIPLSITAAVGFIALSGVAVLNGLVMISFIRNLRDEGAPLDAAVREGALTRLRPV
FT                   LMTALVASLGFLPMAFATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRVAHAAPL
FT                   RATLGARAAGWLARLAPAAVLRRRRESSR"
FT   gene            complement(60625..62175)
FT                   /gene="czcB"
FT                   /locus_tag="BURPS1710b_A0032"
FT   CDS_pept        complement(60625..62175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="BURPS1710b_A0032"
FT                   /product="heavy metal resistance protein CzcB"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53481"
FT                   /db_xref="GOA:Q3JML2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML2"
FT                   /protein_id="ABA53481.1"
FT                   /translation="MRTSSASSARRRATLPAPSPNFAEELAMQRKPLILAGAAAAGALA
FT                   IVLALARAPSTSSAPAASGAAAAAPASGATGPHGGAMFAQGALSAEIVLSEKPDDARLV
FT                   VYPFVDGKPVEQGAAVSATLTRHDGERVALQFAQAGAKYTSAQPIARPHVFDASIDVRI
FT                   GARSASFPFSRADGAIALDDAQLGAARIGIARAGPAQIITSFQLPGEIKFNEDRTAHVV
FT                   PRVAGIVERVAVSIGENVKPGQVLAVIASTDLADRRSELMTAERRLQAARTSYAREKTL
FT                   WEERISAEQDYLQAQVQLREAEIAAANARQKLAALNASAASGALNRYELRAPFAGTIVE
FT                   KHIAPGEAIAADANVFVVSDLSSVWAEMAVPAQRLNDVRVGRHATVSAAAFESKSSGPI
FT                   AYVGALLGEQTRTAPARVVLPNPDGAWRPGMFVNVTVDAGAQNVPVAVESDALQDVDGA
FT                   PAVFVRTPKGFVAQAVETGRRDERRVEIVKGLAPGQTYAAANSFVLKAELGKGVADEH"
FT   gene            complement(62105..63436)
FT                   /gene="czcC"
FT                   /locus_tag="BURPS1710b_A0033"
FT   CDS_pept        complement(62105..63436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="BURPS1710b_A0033"
FT                   /product="heavy metal resistance protein CzcC"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51718"
FT                   /db_xref="GOA:Q3JML1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML1"
FT                   /protein_id="ABA51718.1"
FT                   /translation="MQAQAQPAPAPSAPDGPAAAPPDARAASVSVTPAVSPAPISTSTV
FT                   SVAPPALSLDDALALAAANNPLLKSARSSADASVGALVQAGARPNPTVSFLQEGFGRQE
FT                   RTTTAVVSQPIELGGKRRSRVDAASYGRESALASLDGRAAALRADVTGAFYGVLAAQRQ
FT                   LQVADESAAIAARSADMADKRARAGKVSPVEATKARVAQTAAQIELSNAQTRVAAALAR
FT                   LANATGSADVRGRAASGDLDALPAAEPLPQLLGRLDDAPLARVAKADMLRTNAQIAIER
FT                   AKRVPDITVSAGVKHVVTGGAPDNQAVVGISIPLPLFDTNRGALLEAVHNAAKASADFD
FT                   AERARLRLDLTQAYANYERATGEARRLKADVLPAARQSLDAMSRGYQLGKFGFLDVLDA
FT                   QRTLFDAQSRYVQALADAHQSYADIERVVGAPSRDASRPLAQLR"
FT   gene            63711..64031
FT                   /locus_tag="BURPS1710b_A0035"
FT   CDS_pept        63711..64031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JML0"
FT                   /protein_id="ABA52904.1"
FT                   /translation="MGGQGDQPPLTAGCTPAAASTPTDDGLAPGARPSCRDSAAPVGQP
FT                   DAQPADDASRCDGSCRASARIGLRSLNTRSGMPCANADDAASAKSAAKAREVARFIEYL
FT                   AR"
FT   gene            complement(63728..64012)
FT                   /locus_tag="BURPS1710b_A0034"
FT   CDS_pept        complement(63728..64012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51999"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK9"
FT                   /protein_id="ABA51999.1"
FT                   /translation="MKRATSLAFAALFALAASSAFAHGMPERVFKERKPIRADARQEPS
FT                   QRDASSAGCASGCPTGAALSRQDGRAPGASPSSVGVEAAAGVHPAVNGG"
FT   gene            complement(64411..64650)
FT                   /locus_tag="BURPS1710b_A0036"
FT   CDS_pept        complement(64411..64650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0036"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53156"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK8"
FT                   /protein_id="ABA53156.1"
FT                   /translation="MERPVRSTILCSQQREFHVSTAALEKRRVKETNMSLAAQDLIELL
FT                   RLAQGGAGALTLHLLREIAGNLIAFGVADCRGGC"
FT   gene            complement(65194..65682)
FT                   /locus_tag="BURPS1710b_A0037"
FT   CDS_pept        complement(65194..65682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04008"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51490"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK7"
FT                   /protein_id="ABA51490.1"
FT                   /translation="MLQLLSVAIDKPDTANFILGQTHFIKSVEDIHEALVGAVPGIRFG
FT                   LAFCEASGKRLVRHSGTGAALTELACRNALAIGAGHCFLVFLGDGFYPLNVLNAIKAVP
FT                   EVCRIFCATANPTEVVVAQSEQGRSILGVVDGFSPLGIETDEDVRWRKDLLRNIGYKA"
FT   gene            65867..66499
FT                   /locus_tag="BURPS1710b_A0038"
FT   CDS_pept        65867..66499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0038"
FT                   /product="YbaK / prolyl-tRNA synthetases associated domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51796"
FT                   /db_xref="GOA:Q3JMK6"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK6"
FT                   /protein_id="ABA51796.1"
FT                   /translation="MTAGEGRGRMSRKGGAEMPHCSDERMRPILKRSRRPAAIRSTLIR
FT                   RRCAMSMSVTLQECLRQKASRYEVIHHPYSHSNMEAAAAAHVPGDRLAKTVLLEDAQGY
FT                   VAAVLPTTHAVRLSELWAKTGRHLVLAKEVELRELFKDCDVGALPPVCMAYGMQTFLDD
FT                   SLARQPDVYFEAGDHEELVHMDRDEFLALMDKAERASFSHKIQGVVS"
FT   gene            complement(66854..67969)
FT                   /gene="ald"
FT                   /locus_tag="BURPS1710b_A0039"
FT   CDS_pept        complement(66854..67969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="BURPS1710b_A0039"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF05222; match to protein
FT                   family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52614"
FT                   /db_xref="GOA:Q3JMK5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK5"
FT                   /protein_id="ABA52614.1"
FT                   /translation="MLIGVPKEIKVYEYRVGLTPAGARELALHGHQVLVQRGAGAAIGL
FT                   QDDDYAAAGAMLADDAADVYARADMIVKVKEPQPAECAMLRRGQILFAYLHLAPDPDQA
FT                   AALVKSRAVCIAYETVRAPGGGLPLLAPMSEVAGRMSIQVAAAHLESPGGGMGLLMAGV
FT                   PGVPAAHVVVIGAGVVGTCALQMAAGLGARVTVLDTNVDRLRELDLVFGNRIATLYSNT
FT                   HAIDGAVRGADVVIGAVLVPGASAPRLVTREMISKMRAGAVVVDVAIDQGGCIETSHPT
FT                   THAQPTYVVDGVVHYCVANMPGAVARTSTFALGNATLRHAIALANKGWKRALADDPYLR
FT                   AGLNVCDGHVTHEAVARALGLAYVHADEMLD"
FT   gene            complement(68693..69022)
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_A0040"
FT   CDS_pept        complement(68693..69022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_A0040"
FT                   /product="H-NS histone family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52137"
FT                   /db_xref="GOA:Q3JMK4"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK4"
FT                   /protein_id="ABA52137.1"
FT                   /translation="MTSSKIQTLQKELGHLNLLLEEAKKKEKAEALAAIREQVKQFDIT
FT                   EVELLRAAGFVKDKPKKLPAKYYDPSTGKSWTGRGACPKWLIGKNLDDYLIRPAPEPWW
FT                   PGESA"
FT   gene            complement(69036..69638)
FT                   /locus_tag="BURPS1710b_A0041"
FT   CDS_pept        complement(69036..69638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0041"
FT                   /product="ProQ protein"
FT                   /note="identified by match to protein family HMM PF04352"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51372"
FT                   /db_xref="GOA:Q3JMK3"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK3"
FT                   /protein_id="ABA51372.1"
FT                   /translation="MQKRTAVGCYNLGLFFSELEVMGFEQLASLRDQLAKAAAQKRAAK
FT                   QPQKQPQKHSQKRDAKPAASPSSTDPVVLTIAKLQKRFPQAFPRNPAPKVPLKVGILED
FT                   LVGQASALGLSEAELRDAMRTWCQGNRYWTCLVEGAVRIDLAGGEAGRVSAADAKRARM
FT                   LKGRRPAKPRAQPSRPEQAAQQQQTSACPPQGAQRTD"
FT   gene            69758..70858
FT                   /locus_tag="BURPS1710b_A0042"
FT   CDS_pept        69758..70858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0042"
FT                   /product="hydratase/decarboxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52770"
FT                   /db_xref="GOA:Q3JMK2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK2"
FT                   /protein_id="ABA52770.1"
FT                   /translation="MPVRRETNRRVQRKPTRSRLPAEGSRPTAADSRRAARGRQPRAMK
FT                   AGRRGRLAGAASRSRRGGRDVAGRRLRRRSPRFRRHARCNRNEMAIIAPIVSIPACCSR
FT                   PPLHFESDMTSLTERIDAAARHLVAARRSRVAGPLLPAACRPDDIEAALAIQRRVAERL
FT                   GEPIGGWKCALPPPGRIVVAPILASSIRAAGGPFPVVADARAVRIEPEIAFVLDRDLPP
FT                   RARPYDEGEVRAAVREVRLVLEVLGCRYADPSRATVPELLADNQFNQGLCVGPIVSGGL
FT                   RASLETIALECRGGVNRMLDGRHPDGHPLEPLRWLVNFLAARGESVRAGQIVTTGSYAG
FT                   AIDAPLGQALTVRFGELGGLAVEWVA"
FT   gene            complement(70076..71500)
FT                   /locus_tag="BURPS1710b_A0043"
FT   CDS_pept        complement(70076..71500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0043"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53354"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK1"
FT                   /protein_id="ABA53354.1"
FT                   /translation="MSSSTKSMRRASRWSRPSSWSAASGVSSWATTGAGAAAGWGGATG
FT                   AAAGAAGASPARRRRARRASSRSPSTEKNRPKASDSLPANEMFGSVMRIKLHWARLSGG
FT                   LSCRTQDERRAGHRASCSGISSLSPTGAKPVFCLDLMSSRPRRDGRPSFSAISRRRMTG
FT                   GAPRAALHRRARNAAISRGAFARCRAGGARVSRAPPATALPRARRSRFIRCSGDPFHRE
FT                   TAELAEAHGQRLAERRVDRARVRAGRHDLAGANRFAARREEIHEPAQRLERMPVRVAAV
FT                   EHAVHAAPTLERDRLERRTQAAAHDRADAQPLIELIVREQFRHGGARRVRIAAAEHLEH
FT                   EADLADGGAHLALVVRPRARRQVAIEHEGDFRFDPNGPRVGDDGERAARRTDRRCEDRR
FT                   DDDPARRRKRAFPAADRLAEPLGDAALDRERRLDVVGPTRGGQKRAGDAGPAGRHQVAR
FT                   GGVDTFGETGHVAFEM"
FT   gene            70965..71801
FT                   /locus_tag="BURPS1710b_A0044"
FT   CDS_pept        70965..71801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52053"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMK0"
FT                   /protein_id="ABA52053.1"
FT                   /translation="MAAFRARRCKAARGAPPVIRRREIAEKDGLPSRRGRLDIRSRQNT
FT                   GFAPVGLRDEMPEQDARCPARRSSCVRQDSPPERRAQWSFILMTEPNISFAGRLSLAFG
FT                   LFFSVLGDRELARRARRLRAGEAPAAPAAAPVAPPQPAAAPAPVVAQEETPDAALQLLG
FT                   LLQRDARLIDFVEEDIAGYSDADIGAAARIVHDGCRATLREHFTIRPVRDEAEGARVTI
FT                   GEGFDAAAIRLTGNVVGQPPFHGSISHRGWRVDAVRLPKLNPGHDASIIAPAEVAL"
FT   gene            complement(71693..76774)
FT                   /locus_tag="BURPS1710b_A0046"
FT   CDS_pept        complement(71693..76774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ9"
FT                   /protein_id="ABA52249.1"
FT                   /translation="MSTGCMCTGDAGAGVGRAARSGAKAHRAPRDASSSRTGTGVGDIG
FT                   AAGVATSVDIHRRPSLCMDIGRRAARRPQAPPNRREPPVPKPRRTPVRRDGAERPAPAR
FT                   SRSAGDELQPGGQRFAERAAGIRVIQRDDLAHHADPRIRAVRRREPAQDPLAHVGRHVA
FT                   RAIARHPRDLRGRESGRLDLLPVDGEERVQPALRDLGRHDAVRAAVQRPPRADAPDRPP
FT                   ALVILGRFLQPREQLLAELDLALDGHALERRGQAHHVHVADLRGVERQLRPLRARGLPQ
FT                   PRHRVERLLLRVVVEPARRPAPQRPPLGPHPGVVHVLDAVVEQCPELRDAPVVERMAEA
FT                   GPHAIAGQVQPDALVIRRAPPPAGALPQRAEQLAQEGDVPRIARAERLLELRAQTPDFL
FT                   RIDVREPRAERAVDQLERVVERRMARRVGRRVGVSRLLASELEFELPALRRIIRRDAAH
FT                   VERADLGERRRQPDEPLARAARVLLPNDRRDGRQPDEIARAEIRELARPPCVVGDGRCQ
FT                   MEAHRVAEPQREHAIVEMHVVPFRRAARQHADAARRVRAVVDDQEIAARRAAADPRRAP
FT                   GAREPVRDRAARDRDVRMGVVQHVQRLPAPVAEHAREAPGERVRAEHAAVEQQCVGHRQ
FT                   RPIRGRRAERVARLRGEPMQERRDMPRDGRVGGVGQAEFDERRARAARQIVRAARRKKT
FT                   VDDDLLDLRAAQRGLARAADEPCAGAEQRERERIGRMLAEQLLLRRAAAFDELRQRRRR
FT                   QARAAVLREPHLGDAREREIHVVAAEHQVIAHADARQPRLAVLDVHLDQREVGRAAADV
FT                   AHEHEARARQLVAQRVAMMEQPVVERGLGLLQQAQRGQLRESRGFERECARAVVERRGH
FT                   GEHDVLPFERRIRKAAVPCGAHVREIARARRDGRHLAVRIGRAPRQDRRETIDRRVRQP
FT                   AFRARHEPARHLRAERARERADHRGRRVAGVGRSVRVDRFAGIAPRQPQVARRELAGRR
FT                   VIARRRQQRPRADFAGRDELLDVEHADRVAARLDVRHDGIARPEIDADDESFHRLRVRA
FT                   AAHVELHLPALVRAALHGFELERAGLRHARVQPHRHDLARRAARGRQRRLDRVELLQLV
FT                   GRPEVEQRADLVLPAHRRTEEAEADGLADDEAELLRRQRGVGAFLHPERRDAQRLDRRL
FT                   EAGHGRHRRFDRDVIRARRAAANAHAAAALHVAVVGRAARDREIEIGAAEQTRGRRALG
FT                   REPAVERVEHALDEQRRLEHAAVEEHRARMQEARRRVMRVPQPVELRERSGLPAEERGE
FT                   MARDAGVLRVRQAELHEARARAAHRPRRRVDGREEAFEDRLRQLGARELGADRAADQLR
FT                   AAARHDERHGLRRRIAEQRLLRAAARVGERAQLPGVGLRALRGELARDHVREREIHVVA
FT                   AEQDMLADRDAMQLEVAVALDDRDQRQVGRAAADVDDEDDVADPDVLAPRAAAFLDPAV
FT                   ERRLRLLEQRHMRVAGRLRGLGRQLARGRIERRGNRDGDVLPIERRVRMRVVPRLAQMG
FT                   QIAHRRVERRHARDFRRRVARQDAGAAIDARMAQPALRARHEADRRARAAAARELADRE
FT                   VALGRPRQRKLARRELARMRQIEKRRQQIRRVDCARRGELRDRQHAKARLLAVARREIH
FT                   VRQRAVGGAQIDADRITRVAHSATSAGAMIDASWPGFSFGSRTASTRQPRWLMLP"
FT   gene            71798..73645
FT                   /locus_tag="BURPS1710b_A0045"
FT   CDS_pept        71798..73645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0045"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53716"
FT                   /db_xref="GOA:Q3JMJ8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ8"
FT                   /protein_id="ABA53716.1"
FT                   /translation="MSDARYSIGIDLGTTHCALSYVDLAASDGEKTSLRVLPIAQLTAP
FT                   GAIDAPNLLPSFLYLPHPSELAPGELALPWAAERDFAVGELARSRGAGTPIRLVSSAKS
FT                   WLCHPGVDRRAGILPSDAPPEVARVSPLDASVRYLSHLREAWNHAHPDAPFDRQDVTVT
FT                   IPASFDPAARELTAEAAQAAGYAHMTLLEEPQAALYSWIEKSGGAWRKDVRVGDIILVV
FT                   DVGGGTTDLSLIAVVERDGNLELHRIAVGEHILLGGDNMDLALAHVVARKLAAQGTQAD
FT                   PWQLRALTYACRGAKETLLGDPSAQAVPLVVPSRGAKLIGGSIRTELTRAELTQTILEG
FT                   FFPAVDASARPVSRTRAGLMQLGLPYAQDAGITRHLAAFLGRQAGALAELDGLRHAHDA
FT                   SASFLHPSAVLFNGGVFKSPLLVERMLDTLNGWLAAEGAAPARLLGGADLDLAVARGAA
FT                   YYGYVKRGRGVRIRGGTARAYYIAVESAMPAVPGLEPPIQALCVAPFGMEEGTDAALPP
FT                   QEFGLVVGEPVRFRFFGSSVRRQDQVGTLLDFWSPDELQELDAIEATLPTAGRTPGEVV
FT                   PVRLHARVTEAGTLELEAVQGGTHERWKVEFDVRGGANA"
FT   gene            73649..76456
FT                   /locus_tag="BURPS1710b_A0047"
FT   CDS_pept        73649..76456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0047"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52886"
FT                   /db_xref="GOA:Q3JMJ7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ7"
FT                   /protein_id="ABA52886.1"
FT                   /translation="MKRFIVGIDLGTSNTVVAYVEAGGDAIRVFDVEQLVAPGEVGARP
FT                   LLPSARYHPAPGEFAPGDLRLPWRDAGESVDAHAASDAGDAPPAVIGTLARALGAQVPG
FT                   RLVTSAKSWLSHASVDRLAPILPWGAADAHGKVSPVAACASYLAHVRAAWNRRFPDAPL
FT                   ERQDIVLTVPASFDDGARALTLEAARLAKLPALRLLEEPQAAFYDWLFHHRDTLRDELA
FT                   RTRLVLVCDVGGGTTDLTLIKVHVENGEPRLTRIGVGDHLMLGGDNMDLALARVAEMRL
FT                   AQDGGARLSAAALSQLVERCRAAKEQLLGEHPPDALALTLLGAGARLVGGARKTALSRA
FT                   EVEQIVVDGFFPAGGPDDLPRRSRAALVEFGLPYAADAAVTRHVAAFLHRLAAQSRDAL
FT                   GAAAADRALPVPDTLLLNGGVFRSNALAGRLAGVLGDWRGQPLHVLHNAHPDVAVARGA
FT                   VAYGLARAGRAPRIGGGSPRSYFLVVDDGAHASRGVCVLPRGTAEGHDVHLDDRVFALR
FT                   LGHPVRFHLASTVADHAWRAGELADLGAGDFVRLPPVATVVRQQDAGGARERLVRLTTA
FT                   LTEVGTLDMRCIATDDPSQRWQLEFQLRREQARHADAAPDASRHPSLDHALELIDRAFG
FT                   ARLANVDPKEVRRLRTQLEQALGPRDAWDIALLRELFGALWERAGRRRRSADHERVWLN
FT                   LAGYCVRPGFGHPLDDWRVAQLWTLFDDGIQYVNDARVWSEWWTLWRRAAGGLDDDAQQ
FT                   QALDAMAWLRQAAGAKRPKLPFDAAKIGDMDMVRLSASLERVPVERKIELGEQLLARLQ
FT                   KPAENHQCWWAIGRIGARWPLYGSAHGIVPPEVAQRWLDALLAVDWKKVEPAAFAAAQI
FT                   ARMTGDRTGDVPADVRERVLRRLAATNGSDAWVRMVSEVVALDNADTGRAFGESLPAGL
FT                   KLVAG"
FT   gene            complement(76746..78221)
FT                   /gene="ths"
FT                   /locus_tag="BURPS1710b_A0048"
FT   CDS_pept        complement(76746..78221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ths"
FT                   /locus_tag="BURPS1710b_A0048"
FT                   /product="polyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53015"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ6"
FT                   /protein_id="ABA53015.1"
FT                   /translation="MRIDGRGVPGSGSDRARIAPRRWGARPRPPPRSHPPRVSDGARPA
FT                   PRRRKPAGGSAASPTRAARAEPLRAGMPMRATLRRYVVRRAGAPRAGGRTEQFDGDGRR
FT                   ARPSGARGDAMNETDDAPLHARVRLFLCGDVMTGRGIDQILPHPGAPRLYERYCRSARD
FT                   YVRLAERANGELPARVDCAYPWGDALAELDRVRPHVRIVNLETAITTSDARWPDKAVLY
FT                   RMHPRNVGCVSSARIDCCVLANNHSLDWGREGLADTLDTLRRAGIRTAGAGDDDAHAAR
FT                   PATLGVAPGRRVLVYAYAAETSGVPPSWAATPQRSGLNYLADLSSVRATQIGERIAAQR
FT                   REGDLVVVSLHWGGNWGFEIGDDEHAFAHRLIDTGAADIVYGHSSHHVKGIEIYRERLI
FT                   LYGCGDCLNDYEGIHGHQPFRPDLALMYFPVLDAGSGALVELSAVPMQIRNLRLQRAPA
FT                   DGKAWLHAVLERESRRFGTHVSACDVDGLHVHW"
FT   gene            complement(78456..79037)
FT                   /locus_tag="BURPS1710b_A0049"
FT   CDS_pept        complement(78456..79037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52484"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ5"
FT                   /protein_id="ABA52484.1"
FT                   /translation="MVARRGRKPAVRRHTRGRRRGDSQRDGTRLAEATAGARCSVPGAR
FT                   RRRAEARNAARAAVAAPVRRPHAPPGSARRPVCIGGRACIVSARSPASISIELDFHRTG
FT                   RKAMTMKLNSASHPATASEIRDIIGPIEDDVIAKILEIEPTSAEVLDAYTWLRSDERLQ
FT                   FRLDHEPHGRAARVFEILEREDDEGDDRRQ"
FT   gene            79486..79797
FT                   /locus_tag="BURPS1710b_A0050"
FT   CDS_pept        79486..79797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51962"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ4"
FT                   /protein_id="ABA51962.1"
FT                   /translation="MRRFATRRAGARAPRVVRRRSGTRASCDSRRSTRRAGSPTRKAAA
FT                   GAGRRLRVLKGAPAAVAAIAGVPVDTTALDALARRGLRMLDAGHDGGPVALSSGSPCA"
FT   gene            79840..80073
FT                   /locus_tag="BURPS1710b_A0051"
FT   CDS_pept        79840..80073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53319"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ3"
FT                   /protein_id="ABA53319.1"
FT                   /translation="MRAEPDRARDDSGRRRRVARDHHRAHARRTPIARSFATSGAESAH
FT                   GGSPRPTSPTSFHRVKAFRDDGHVVAMCGGRQ"
FT   gene            complement(79905..80021)
FT                   /locus_tag="BURPS1710b_A0052"
FT   CDS_pept        complement(79905..80021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52364"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ2"
FT                   /protein_id="ABA52364.1"
FT                   /translation="MTRWKLVGDVGLGDPPCADSAPLVAKLRAMGVRRACAR"
FT   gene            complement(80151..80774)
FT                   /locus_tag="BURPS1710b_A0053"
FT   CDS_pept        complement(80151..80774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0053"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52609"
FT                   /db_xref="GOA:Q3JMJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ1"
FT                   /protein_id="ABA52609.1"
FT                   /translation="MSTLAALFVTILLLNLAPAFAPPTWMAMSWLGFSRPGDDPLLMAL
FT                   IAASAATSGRLMLAKASRSLVRGRWMSDADRRNVDVAKAWIERRRRVTAWALLAYAFSP
FT                   LPSNYLFIAYGLTGLPLRLIGVPFFFGRLASYALWASLGQFTHDYVEPESNLGGAYLGL
FT                   YFAASQLAFLALVYAFAKIDWAYLQREHKLRLRRAGKDEGGPGR"
FT   gene            complement(80826..83339)
FT                   /locus_tag="BURPS1710b_A0054"
FT   CDS_pept        complement(80826..83339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0054"
FT                   /product="putative cation transport ATPase protein"
FT                   /EC_number="3.6.3.2"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52729"
FT                   /db_xref="GOA:Q3JMJ0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMJ0"
FT                   /protein_id="ABA52729.1"
FT                   /translation="MSARQAARHRRDGAPGAATPADDAWRRTPASGLSSARADELRLRF
FT                   GPNAIDTGGRRGTWRTSLDVLREPMLLLLLGAGAVYLALGELPDALTLLAFVAAIAALT
FT                   IVQSQRTAGVLAALRALSAPRADVMRGGERRLVSATELVPGDLVWIAEGARVPADGWLV
FT                   DAHELSVDESLLTGESAPVDKAAERPDAPTPDEAACRVHFGSMVVRGQGRMIVTDTGPR
FT                   TALGRIGKSLTDIAETPSPLQRDARTLANRIALVALALCAALVIAYRWRSGEWLPGVLA
FT                   GITLAMGIFPEEIPVVMTVFMALGARRIADEGMLARRMSAIEALGQTSVLCVDKTGTLT
FT                   QNRMTVRALFANGRRWTLDDDRADIDASFHELLEYLVLASEIEPVDPMERAFRRAGSRC
FT                   LAGTGHLHDDWSLVQEYALTPELPAMSHVWRAPRLDHCPVACKGAPEAIFSLCHLDDAA
FT                   ARALLDEAERMAARGLRVLGVARAAHARGEWPARQHDFDFRFVGLVGLIDPVRAEVAEA
FT                   IATCRAAGIRVVMITGDYPSTARAVAGEVGIGAAAVVTGDEIAAMSDAALDAALARADV
FT                   FARVRPEQKLRLVAALERGGRIVAMTGDGVNDAPALKAAHVGIAMGRHGAEVAREVAAL
FT                   VLLRDDFTPIVSAIRQGRRIHANLMQALGYTVAVHLPMIAAVMVPALAGWPAMLAPLHI
FT                   VSLQLVIDPACSLVFENEPARADAMRVPPRPPHARLWASPLIARGAAAGALAAAGVVGL
FT                   YALLLARGGDPAFARTAAFVALVSANVALIFVVRALAGGARASGPFAGNRYLWIVPACA
FT                   ASALLALLSIPPLASLFGLVPLLAR"
FT   gene            complement(83437..83916)
FT                   /locus_tag="BURPS1710b_A0055"
FT   CDS_pept        complement(83437..83916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0055"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI9"
FT                   /protein_id="ABA52016.1"
FT                   /translation="MRNTVHRWMRVAATVATVAALGSTAAANETPEPATQNGIAYVTGG
FT                   VGQDEVDALRAAASKYNLRMMFASRSGEYLSDVDVTIRAAAAQPVLTVRTRGPFLYARL
FT                   PAGQYRIDARYGSAEQRRSVRVPARGGVHVEFRWAEPDRRGAMQLCDPRPCPRQR"
FT   gene            84439..85755
FT                   /locus_tag="BURPS1710b_A0056"
FT   CDS_pept        84439..85755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0056"
FT                   /product="Methyltransferase small domain family"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53546"
FT                   /db_xref="GOA:Q3JMI8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI8"
FT                   /protein_id="ABA53546.1"
FT                   /translation="MLDLRNFVLCARVCTCYQNEIRRAFCSEFVRFRKCAAASIRQPHQ
FT                   RSRRHRTRPDVDDSATRIAQAAALPDRGGAMRERGAPAGHRGEHAARSCFARGRRAPPA
FT                   RKAASESWTIGGASRPGRPGRRAENPRRAPLARRRVPHERYAPSTTDACAPPPMTPQPQ
FT                   EEIERTMSRYTLGHSPIELRRLDFQSEMLKPVTRRLLESARLRPSMRVLDIGCGTGGVS
FT                   MLAAEMVGPAGTVVAIDPSEVAIEAARANAERARLHNIRFRACGLDQVEGAHGFDVVVF
FT                   RCVVIHQLHAVEFVRHAARFVKPGGYLALHEPDFVRKPMSTPAIPLWDSVTAEILERCK
FT                   RSFPSFDVAHRMVKLFAAAGLPLPKMAYEVPVDGGTATKLSSWLAEMLRALSSDPDSTV
FT                   LGNGKRIEFGRLSGDLQCEIHEARAQVEFFGQLCACAQL"
FT   gene            complement(85732..87330)
FT                   /locus_tag="BURPS1710b_A0058"
FT   CDS_pept        complement(85732..87330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI7"
FT                   /protein_id="ABA51617.1"
FT                   /translation="MGAARRPVQARDRNRMEEGAAGRRAAVHIRGRVGRRLPERSARER
FT                   RRLRVRRDLPRLFPQPELARAARGGRDPAHRRFPAVRDPGREGGRPVLQHPAARLRERA
FT                   VLPEGRRGARGRDDAHAGARRARAMHVHERDPAGQARADGRHVRAHDERRALSGRRAQP
FT                   HGRIPAAAAVERERPERRSARQPARADGDVELAERDSRAAGPVRSLGMVQRRRRARGDR
FT                   LFGIDVGDERGGAARSRLQVPAAVGHAAAAALLRGRDRREHDDPRARHARARGATRERD
FT                   RRIVDDGAKRRAGRQRRAAISVLRAAQRAAHARAALSALSEDGRAAGCARAGDVQDRCA
FT                   VAQLARLDERADRAARARPITRAAAISTPRCRSPTIAARRPCARPSARRRAAGTASGPI
FT                   SLPRRPPGSRRAAATRARRQPRRNCRARSPPAPRPAIARSRDTGGARPRRGRAGSPARE
FT                   ARAAPESPRARSNAVAQRPRRNRPASRTRGMRPVRSAYEAEPSDSGRIRAAPTVDGRLG
FT                   PARSRERALELRARA"
FT   gene            complement(85752..87509)
FT                   /locus_tag="BURPS1710b_A0059"
FT   CDS_pept        complement(85752..87509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0059"
FT                   /product="thiaminase I precursor"
FT                   /EC_number="2.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52539"
FT                   /db_xref="GOA:Q3JMI6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR030901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI6"
FT                   /protein_id="ABA52539.1"
FT                   /translation="MRAHRQTPRQAHRFARVIRQGTIMRRLLCCFTIVLGFLFAAPSHA
FT                   GDAAAVGQLTVALYPWVPRVDQFKRAIETEWKKAQPGVALRFISADAWDGGYRNDPPAS
FT                   ADVYVYDAIFLDYFRSQNWLEPLAADEIQHIDDFLPYAIQGVKAGDRYYSIPQLGCANV
FT                   LFYRKDDAALAAATTLTQVRGALEQCTFTSEIPPDRRGLMVDMSGRTTNAALYLDAAHS
FT                   RTGAYPLPLPWNANDLNGEALGSLRALMAMSSWPNATAELPGQYDRSVWFSDGEGRAVI
FT                   GYSESMSAMSEAARRDLDFKFLPLSDTPQPPLFYADVIGVNTTTHARGTRALAVQLANV
FT                   IAASSTMVQSVGPDGSGVPQYLFSARRSVLHTLAQRYPLYRKMVALLDAREPVMFKIDA
FT                   QSRNWLASMSGPIAQRARARLPVRLRYRHRAADRRLSRRAGRVPDRLRGAGRLERPVDQ
FT                   SVSRGARRAVGVRLQRVPDVSRGETAARARHPRRARRSREAVTRAAPGLAAGGPGARPA
FT                   RPAPRPNRLARGRTRLRNGRAATGRPLERAACGPCDPRMRPSRPIAGGYAPPRPSTAGS
FT                   GPPVRASGR"
FT   gene            complement(86009..86188)
FT                   /locus_tag="BURPS1710b_A0057"
FT   CDS_pept        complement(86009..86188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0057"
FT                   /product="putative periplasmic thiamine binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52986"
FT                   /db_xref="InterPro:IPR021992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI5"
FT                   /protein_id="ABA52986.1"
FT                   /translation="MCPTVCAAQGGWNGQWTNQSPAAPAGQSACGCNACPTSAAAKLPR
FT                   ALATRAAPGDRAKP"
FT   gene            complement(87530..88537)
FT                   /gene="thiD2"
FT                   /locus_tag="BURPS1710b_A0060"
FT   CDS_pept        complement(87530..88537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD2"
FT                   /locus_tag="BURPS1710b_A0060"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52103"
FT                   /db_xref="GOA:Q3JMI4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI4"
FT                   /protein_id="ABA52103.1"
FT                   /translation="MAARTPPPRAHARTGRGRPTTGASRPPTPRRPARPTAHRRRDARR
FT                   RPRGSPTAQRHNHNTTQHNETRGNMIANVLTIAGTDPTGGAGIQADLKAFSAMRAYGMA
FT                   AITAVVAQNTTGVRSFRALDPAFVADQIDAVFDDVAVHAVKIGMIATAAIAEAVAAALA
FT                   RHRAAPVVLDPVMVAKSGDRLLDPDAVDAIRDKLVPISTLITPNLPEAGVLLGRSEPRT
FT                   LAEMHAAAAELHALGSRWVLLKGGHLAGERSVDVLRGPAAATVELSAPRVATNNDHGTG
FT                   CTLSAAIAALLPSHSVEDSVCQAKAYLSDALAASGELEVGRGHGPVHHFHALWN"
FT   gene            complement(88327..90114)
FT                   /locus_tag="BURPS1710b_A0062"
FT   CDS_pept        complement(88327..90114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51360"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI3"
FT                   /protein_id="ABA51360.1"
FT                   /translation="MVSVRAQRSRIHRALRTVDGALQSGRQASARHRLRRAPAALRRAR
FT                   ARPDRARARHPVARRRREQARRAADLQRRRGTVPAQHRRVVHARPATAAARRPAAHGRV
FT                   HARERRVHRAAERRVLVHVPAGVPRVAARLRARHVCASGGLDPRVRRQSAARAGAARRQ
FT                   RCGDRHRRRAAAHAGGHARRDDRARARARRPDSRRARVARRASRHRSRSVLARRARSLL
FT                   DLSRDQGGQPAARRGARVRRPVPSRLSDEPVGHGVRLAPITHGDPDEDRLDRTRGFAAL
FT                   SRIRRPDRGALRLPAADRRADGLARHRDPRARLRLRRRQGRAAVARGGRRARDGRRHRA
FT                   DDDRTGDRGRRRRRAGLCAYRRAIAAVRRRELRRGDQLLPVRQHRGARGARARRRGGAA
FT                   RAEAGRRVLRARHEPAHDGRAIPDVPQRRAGHRLPRRRCAPRSSERAGRRRVRRRRYAL
FT                   GDPDVSSRVRDGGPRARGGDGTRLSRGGRGRRARRPCGRRRQQAVRAVQGDQAAALTRA
FT                   PRRMRGAPAWRLERRRRARTPARAEVARRRARAGRRRRGGRPDRRPTDDVTRGAARAAR
FT                   RRRSDTITTRRNITKHEGT"
FT   gene            88536..90386
FT                   /locus_tag="BURPS1710b_A0063"
FT   CDS_pept        88536..90386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53254"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI2"
FT                   /protein_id="ABA53254.1"
FT                   /translation="MPAHRACAAARASARRPGRLEQHERLAAVGVRMGAGRAARVRRAK
FT                   AEFHHRREREARRLERVTIRRDLPVRIDDVEHAFARHVQMNGARIAVAVDDARLAVAER
FT                   RVLHARRARVRVEHVVRAARLQHAPHLRGDARERRALRDVDEQEAADRRVEARVVERQR
FT                   WPVDMHIVQPVVDAGRDRLFDHRRRDVDARHARDARRAQPPRDLAAAAAVIEHADRGAV
FT                   RARQLGDQRLVAEARLDPVVVCVKALRNLVFGPVGLHRDPRALLERGGRHVPPVHQIGA
FT                   MERADERERLVGRRVARLDLAIDPEETEHVAPVRIEIDVAKRGERHAPGANPAFVLEHA
FT                   RDRRGARARRHARRRGGGDDRRIAVVEQRLHARQIVVVHVDRAHLMRIRAELAAEPRRE
FT                   VLLQEREREHVVQQPDVRVVRAHERDHVQPAFAQQQLQAERARHVDVAPVQFLVGAEDL
FT                   QHDALALGVVARQDVERALDLVEPALAVMQQARAVAGAGQMLAVRTVARHRRCVVRDEF
FT                   EIVAPGQIPQRLGVVEDDVLLARRMPAKARARIVDPCAVADDFALRVPARRAPVFVRAA
FT                   DVPERREVELAETRIAQHVSLVRRNGRSRLRSRPDRSGRR"
FT   gene            complement(88572..89312)
FT                   /locus_tag="BURPS1710b_A0061"
FT   CDS_pept        complement(88572..89312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0061"
FT                   /product="Orf34"
FT                   /note="identified by match to protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53540"
FT                   /db_xref="GOA:Q3JMI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI1"
FT                   /protein_id="ABA53540.1"
FT                   /translation="MKTDWTEHEVSQRFHAYDDRIEARFGYQPLIAELTGSHGTAIRVL
FT                   DYGCGGGKVARRLRAAGVARVTGVDIAPTMIEQAIAAGVDDGLDYVHIDGPSLPFDDAS
FT                   FDAAISCFLFVNIAERAALARVAAEVRRVLKPGGAYYVLDTNPRTTGVQYPTFRNGEPG
FT                   IVYRDGDARPVHLNVPGEGVFDVVDTHWEIPTYRHAFETAGLALAAVMELGFRAADAGG
FT                   APGAHADADGSKPFVLFKATRPPR"
FT   gene            complement(89328..90317)
FT                   /locus_tag="BURPS1710b_A0064"
FT   CDS_pept        complement(89328..90317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0064"
FT                   /product="putative thymidylate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53118"
FT                   /db_xref="GOA:Q3JMI0"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMI0"
FT                   /protein_id="ABA53118.1"
FT                   /translation="MLRYPGLSELYLATLRDVCGAYEYRSAPRGHAEREIIGYGARIDD
FT                   PRARFCRHAARKQNVVFNYAEALWYLSGRNDLEFIAHYAPSMARYSPDGKHLPGTGYGA
FT                   RLLHYGERGLDQIERALDILSRDDAESKRVVLQIFSADEELYRRNIDVSCTLGLQLLLR
FT                   EGRLHMVAFMRANDAYIGLLNDVFSFTFLQEYLASRLGCELGTYAHQVGSIHVYDDNLP
FT                   RVQALLDDSDAAIVTAAAPPRMPAGTRAATIARVLEHEGRIRAGRVSLAALRDIDLDPY
FT                   WRDVLGLFWIYREIKAGNPPPDEALAFVGPFHRAYLMNRWDMASASLQ"
FT   gene            90698..90805
FT                   /locus_tag="BURPS1710b_A0065"
FT   CDS_pept        90698..90805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH9"
FT                   /protein_id="ABA51890.1"
FT                   /translation="MLPSGITPVCLSTRDLNGPPKNMRFIGCFPFGWDD"
FT   gene            complement(90771..91247)
FT                   /locus_tag="BURPS1710b_A0066"
FT   CDS_pept        complement(90771..91247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0066"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52769"
FT                   /db_xref="GOA:Q3JMH8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH8"
FT                   /protein_id="ABA52769.1"
FT                   /translation="MTDPKGTGDAALATPRVAVIAVTFRGDDVILVRRGKEPQKGTWGF
FT                   PGGSVEPGECLREAAARELFEETGVRAEVGEPFDVVEVIGFDPHGRHHHYVLVAMLCRH
FT                   VEGALRPGDDATDCRWVRVPADLSRFPGALADHVARVAQRAHALNHPNRKENSR"
FT   gene            complement(91240..91419)
FT                   /locus_tag="BURPS1710b_A0067"
FT   CDS_pept        complement(91240..91419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51343"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH7"
FT                   /protein_id="ABA51343.1"
FT                   /translation="MECSLNREVKIFIREIPASFARIVSFINHGGGQWPSIGAPGPNER
FT                   RAKTGARMWSIDDD"
FT   gene            complement(91648..91815)
FT                   /locus_tag="BURPS1710b_A0068"
FT   CDS_pept        complement(91648..91815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH6"
FT                   /protein_id="ABA51284.1"
FT                   /translation="MFRSHDDESALSAVDSVADIECSGVTDYRECAMNRDRVRGFGMNR
FT                   PARVTSRQAG"
FT   gene            91833..92627
FT                   /locus_tag="BURPS1710b_A0069"
FT   CDS_pept        91833..92627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0069"
FT                   /product="phosphoethanolamine N-methyltransferase"
FT                   /EC_number="2.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53632"
FT                   /db_xref="GOA:Q3JMH5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR025771"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH5"
FT                   /protein_id="ABA53632.1"
FT                   /translation="MQTHTVGLSSEYEAKRYSNAHNILRSEIIYGDGFQSPGGIEGFRT
FT                   MLAENMAIEPGMRLLDIGSGLGGAAFHLASRFDVTVVGLDTAPRMTELATARQPALDPH
FT                   ARVRFVNGDVHAEALAGERFDIIYSRDALMYVHDKPRLFARCHALLATRGRLYVTDFCR
FT                   GRASPAFDAYASVSGYDLRTIDDYARIVADAGFDVLSARDVSDDARRQLRGDLDRYEAR
FT                   VAARDPSIDPLDAEHIVERWRRKIGFVDEGCLLQGLFVAQRR"
FT   gene            92684..93832
FT                   /locus_tag="BURPS1710b_A0070"
FT   CDS_pept        92684..93832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0070"
FT                   /product="putative gamma-butyrobetaine,2-oxoglutarate
FT                   dioxygenase"
FT                   /EC_number="1.14.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51978"
FT                   /db_xref="GOA:Q3JMH4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH4"
FT                   /protein_id="ABA51978.1"
FT                   /translation="MLTSHSDHLQIDWETGRSSRYHWVWLRQACECADCFNAHCRQRRF
FT                   DPAAIAPGIRPERVLLDAHGVRIVWQDAHVSTYALERLARDDYREAIPPAAAAGWTPWP
FT                   ERGAPSASHFAIGDVLDSDAALRRALNQLFESGLVVLKAGDGAAPPFDAVRERLAGFLE
FT                   PSYFGDFFDLEVKADDATDSVSFSTSALPLHTDIPYCSPPPDYQFLYGLDVDPRCAREQ
FT                   VGCTRFVDGWAVLRELRDASPEMFERLARTRVVYRADYPGARKRYEHRTPIVRLRADGT
FT                   VERLINNPTKMFFDGIGFDELMPFFRAYHAFKARLVATMRSYLHAWTQGDMVVWDNRRI
FT                   FHGRGDFGAPGIVRTLRGGYFREGELRARDAFLAAAGERAAG"
FT   gene            complement(94028..94864)
FT                   /locus_tag="BURPS1710b_A0071"
FT   CDS_pept        complement(94028..94864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0071"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51259"
FT                   /db_xref="GOA:Q3JMH3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH3"
FT                   /protein_id="ABA51259.1"
FT                   /translation="MTPSVIALVLFAAILHATWNALLKSGADRLWSLTVMSFATTAAAA
FT                   VCAALLPLPARASWPYLAASAALQVGYSVFLALAYQRAALGQVYPVVRGAVPLLVTLGG
FT                   YAWAGQRLGGAPLAGIALVSGGIASLALGRTRIHSRALAAALATALFIGGYVTIDGLGA
FT                   RVAGHPLAYAAWIFIVYGAAMPAVFLLLGRRPRAGLPRGDTLKSAAGGLISLIGYAAVV
FT                   DALSRGPVGPIAALRETSIVFSALIGWLWLGEKPSGPRFAACAAVALGAACLAYAA"
FT   gene            95034..97049
FT                   /gene="arcD"
FT                   /locus_tag="BURPS1710b_A0072"
FT   CDS_pept        95034..97049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="BURPS1710b_A0072"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM TIGR00905"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53114"
FT                   /db_xref="GOA:Q3JMH2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR022461"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH2"
FT                   /protein_id="ABA53114.1"
FT                   /translation="MAGPLSARHRRRASRHADRSIAARRPGDAAAGAHKRALSAGFGAR
FT                   DCSDRIAAIAAIARSARRAAARAGAFTPGGHASSASRRGERARAPARRGRPATPRFVTR
FT                   FVARFSTRKQPLSARRTCLVDTAFTPHSRHIHAAFTPHSRRNAPRAPLIQVNPACRARC
FT                   LNTFNIRRGGFIMKHSVRHPFHPSTPLPARASAPLRAAAPRQLPFALLTALVIGSMIGS
FT                   GIFSLPQNMASGAGAGAIVIGWAITGVGMLMLALVYQTLAHRKPELDNGVYAYAHASAG
FT                   DFVGFNSAWGYWVSAWIGNVGYLVIVFGTLGYAFPAFGDGNTRAAVIGASIVLWIMHAV
FT                   ILRGVRGAAILNALTTIAKIVPLVLFVALAALAFQPHRFTTDFWGNVHLPGVLDQVKST
FT                   MLITVWVFIGIEGASVYSARAKNRDDVGRATIVGFVVVLLLLMAVSLLSLGIVSQPELA
FT                   AMKNPSMAGVLEKAIGRTGVAIAGVGLLVSVGGALLAWTLLAAEAMFTPAKDGVMPAFL
FT                   SRENAHGVPANALWATNGLVQLFLLVTLVSNATYQALISLATSMILVPYLFSAVYALVI
FT                   AIKGEGYAPGEAVRVRDATIGAVATVYCCWLLYAAGPKYLLLSALLYAPGALLYAWAKR
FT                   ERGERPFKPFEAAILIALVAFASLAGWLVAAGRISL"
FT   gene            97277..97966
FT                   /locus_tag="BURPS1710b_A0073"
FT   CDS_pept        97277..97966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0073"
FT                   /product="family S54 unassigned peptidase"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52398"
FT                   /db_xref="GOA:Q3JMH1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMH1"
FT                   /protein_id="ABA52398.1"
FT                   /translation="MGRAGTDGAARCAHNDRRRLTLSPVAAMTLAIVVLNVIGFFVELA
FT                   APERVLSLFALWPPRAGAGLPPAAAPAFHVWQLVTYSALHAGLSHLLFNMLGLVMFGRD
FT                   VERALGRARFGALYLASVVCGALTQLALARYSAAAAAPTIGASAGVFGVLAAYALLYPS
FT                   RRVVLLIPPIPMRAWVFALLYAGGELLLGVAGAASGIAHFAHLGGMFGAIALMLAWGRP
FT                   RSEWPVQ"
FT   gene            complement(98105..100858)
FT                   /gene="ftsH"
FT                   /locus_tag="BURPS1710b_A0074"
FT   CDS_pept        complement(98105..100858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BURPS1710b_A0074"
FT                   /product="FtsH-2 protease"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52267"
FT                   /db_xref="GOA:Q3JMH0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JMH0"
FT                   /protein_id="ABA52267.1"
FT                   /translation="MWPTVDRRQSRARAIADARWCTSRRAPPLTASRRFHDCGAARACR
FT                   RQSPGTRETYDLSTRKDDDLRIERTLRGDAAAPRSPAARAPGGRLRRAGAPEERHGLHR
FT                   MRRAVRRRPLELARGGGRAAADRVPRVPPDSRARERGRARARRRLLRAPPRRHRRAAAP
FT                   PRGRRHQRAPARTHSVDRRAARAHGRAHEGLAPRAPAHRGARAHAPRRSRDRLSRRRGH
FT                   AARALDARRRLASAAVDSSASHNARRGIPMKSETGYMGFVVVLVFMVLLALQLATLSAP
FT                   ATQIAYSDFRKLAAAAQLDDLEVSPTRITGVLRSASAAAALPASDAEAIKRAGTPWRFS
FT                   TKRVTDERLIDTLAATGTRYRGADDDTWIGTLASWIVPIAVFALVWNLMLRRPRGGLQD
FT                   WSGVGKSKPRVYVEAKTGIDFDDIAGIDEAKAELQQIVAFLRAPARYQRLGGKIPKGVL
FT                   IVGAPGTGKTLLAKAVAGEAGVPFFSTSGSSFVEMFVGVGAARVRDLFEQAQQKAPCII
FT                   FIDELDALGKVRGAGLASGNDEREQTLNQLLVEMDGFQANSGVILMAATNRPEILDPAL
FT                   LRPGRFDRHIAIDRPDLTGRRQILSVHVKHVKLGPDVDLGELASRTPGFVGADLANIVN
FT                   EAALHAAELDKPAIDMSDFDEAIDRAMTGMERKSRVMSEREKITIAHHEAGHALIAQTR
FT                   AHSDPVKKVSIIPRGIAALGYTQQVPTEDRYVLRKSELLDRLDVLLGGRVAEEIVFGDV
FT                   STGAENDLERATEMARHMVARYGMSERIGLATFGDADTQGLSPLVWQRGGERCSESTAT
FT                   RIDDEIQRLLAEAHDRVSRTLKERRGALERIAGYLLEHEVVDHDKLVRLVNDEPTPEPG
FT                   ARDPGGDAAKRSGIGAAPAKPPAEVGSAELRDPARKADNADHSVPQ"
FT   gene            101138..103240
FT                   /locus_tag="BURPS1710b_A0075"
FT   CDS_pept        101138..103240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51463"
FT                   /db_xref="GOA:Q3JMG9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG9"
FT                   /protein_id="ABA51463.1"
FT                   /translation="MPRCSMPLPSRGSPPRVAGAGAGRPSRCRTKARQEAARDHASPCA
FT                   IAVPAASGAPVRATNRCVDSKQCSLAIHLDIDQCNVSAGHAGRCVAARRRPAVDGNRVQ
FT                   NSERTTIRRHLTMTRYDTIIRNGLWFDGTLAEPRPRELGIRDGRVAAVSDTPLAADGAS
FT                   VIDATGKWVMPGFIDIHTHYDAEILVSPGLPESVRHGVTSVFLGSCSLSTVHANALDCT
FT                   DLFSRVEALPREQMLAVLSRVKTWDTAAAYVRHLESLPLGPNVAAFLGHSDLRTHVLGL
FT                   GRAVDDRVRPHEAELQRMERLLDDALDAGFVGLSSMTTPWDKLDGERYRSKSLPSTFAT
FT                   WREYRRLNRVLRRRGRVLQSAPNTTNPLNGLLFMAESCGYFVRKPLRTSLLVAADSKAA
FT                   PRGTIDVQLGGVRVANALFRGELVWQHLPVPFEVYADGIDFVIFEEFGAGRAALHLADA
FT                   LERNKLLQNEGYRREFRRQVGKGFDLRLWTRDLHDTRIVGCPDASVVGKSFGQVANERG
FT                   VHPADAFLDLVVAHGQRLRWCMTIANHRADVLDRIATHPALQIGFADSGAHLRNMAFYN
FT                   APVRFLRRVREAERAGRPFMSVQQAVHRLTGELGAYFGVDAGTLRAGDRADIAIVDPAH
FT                   LDASVDAYHEEDMAVFGGLRRLVNRSGAAIAATLVNGQLVYRDGAFAEGFGDTRRSGRF
FT                   LRAAAR"
FT   gene            101521..103551
FT                   /locus_tag="BURPS1710b_A0076"
FT   CDS_pept        101521..103551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52573"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG8"
FT                   /protein_id="ABA52573.1"
FT                   /translation="MVRRHARRAPPARARHSRRARRGGIGHAARRGRRERDRRDRQMGD
FT                   ARLHRHPHALRRRDSRVAGAARIGAARRDERLPRLVLAVDRPRERARLHRSLQPRRSAA
FT                   ARADARRAVAREDLGHGGCVRAPSRIAAARPERRGVPRPFGPAHARARPRARGGRPRAA
FT                   ARGRAATDGAAARRRARRGLRRPVVDDDAVGQARRRALPVEVAAVDVRDVARVPAAEPR
FT                   AAPPRARAAKRAEHDQSAERPALHGRELRLLRAQAAAHVAARRGRQQGGAARHHRRAAR
FT                   RRARRERAVSRRARLAASAGAVRGLCGRHRFRDLRGVRRGPRGAASGRRARAQQAAAER
FT                   RLPARVPPAGRQGVRPAALDARSARHADRRLSGCVGRRQIVRPGRERARRPPGGRVSRS
FT                   RRRARAAAALVHDDREPPRGCARPHRDPSGAADRLRRFGRAPAQHGVLQRARALPAPRA
FT                   RGRARRPAVHVGAAGGASADGRARRVFRRRRRHAARRRPRRYRDRRSRASRRVGRRVSR
FT                   RGHGRVRRAAAAREPQRRGDRGDARQRATRVSRRRVRRRLRRHAALGAVPARGGALGPA
FT                   RARCALGAGRRSGRARRTRRRGYRTRSARARRAARLRRRADHSPPAPAPLGRIRYAQRR
FT                   APAGMCSMRSIVSASPSISRKISSSERQNPWHAVAAAQIGQ"
FT   gene            complement(103371..104111)
FT                   /locus_tag="BURPS1710b_A0077"
FT   CDS_pept        complement(103371..104111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0077"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53331"
FT                   /db_xref="GOA:Q3JMG7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG7"
FT                   /protein_id="ABA53331.1"
FT                   /translation="MGDCPACIAIPLHCTSPAFDNATMDDNFSKQEIPVSERVLNALKR
FT                   RGPLQAAELGAYLGTTGEAARQQLKKLEAEGLVEAQNVPQGVGRPARIWRLTSLGHGHF
FT                   PDAHADMTVDLIRIIRTTLGQPTLDLLIAARETEMRRTYAHTLAGVTDPEERIARLAEL
FT                   RDREGYFAEWSRAPDGDGWLFIENHCPICAAATACQGFCRSELEIFREMLGDALTIERI
FT                   EHIPAGARRCAYRIRPSGAGAGGE"
FT   gene            104193..105290
FT                   /locus_tag="BURPS1710b_A0078"
FT   CDS_pept        104193..105290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0078"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52497"
FT                   /db_xref="GOA:Q3JMG6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG6"
FT                   /protein_id="ABA52497.1"
FT                   /translation="MGRRLLLALALLAFIFGGLFLWRESRVQAADHPPAPPAALTVSAV
FT                   AVRAAPERVTLDAVGSLDAVRQVTLAPEVAGRVVALQFDAGSAVRKGQLIVQLFDEPER
FT                   AKLASIQAKAAYAKRQLDRSQALAQTGAEPRNLFDRHRFDFDAAAADIRETQAVITQKA
FT                   VRAPFDGVLGLRRVNLGQYLNAGDAIATLTDLDTLYANFTVPQKNLSQLRLGQSVSITT
FT                   DAYPERTLVARVSAIEPQIGTDTRNVAVQATLPNPDHLLRPGMYIQARLELPPRERALT
FT                   VPDTAVQTSQRGESVLVVGKPGRDGLGVVRLQPVRTGRRADGRIAIADGLRPGDVVVTS
FT                   GQVRLAAGDRVKVALDDGAGSGAAQ"
FT   gene            105287..108397
FT                   /locus_tag="BURPS1710b_A0079"
FT   CDS_pept        105287..108397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0079"
FT                   /product="hydrophobe/amphiphile efflux family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51925"
FT                   /db_xref="GOA:Q3JMG5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG5"
FT                   /protein_id="ABA51925.1"
FT                   /translation="MNAGAPHDSGAARARFTDVFVRRPVLSLVFSLLILLVGLRALMSL
FT                   PVRQYPALESATISVATDYPGASQELMQGFVTTPIAQSIATADGIEYITSTTTQGKSVV
FT                   KARLRLNANADRAMTEVMAKVQQVKYKLPADAYDSVITKLTDAPTAVMYLGFASDALSI
FT                   AQITDYVVRVAQPLVTTVPGVASAEILGGQNLAMRVWLDATRLAAHGLSAGDVAAAIRA
FT                   NNVQAAPGQVKGSLTIADISANTDLTDVGAFNEMVVKSAPNGGGLVRLKDVATVEIGGE
FT                   NYNSSALMNGRRAVYIAVNATPAGNPLEIVRGVGAVLPAMERNKPASVQIANMFDGARF
FT                   VNASIAEVRSTLTEAIAIVVVVIFLFLGSFRAVIIPVLTIPLSLVGSAALMLAAGFSLN
FT                   LLTLLAMVLAIGLVVDDAIVVVENIHRHIEQGEPPVRAALIGAREIASPVLVMMATLIS
FT                   VYAPIGLMGGLTGSLFKEFAFTLAGAVLVSGIVALTLSPMLGSLLLTSRMSEGRVAKAI
FT                   ERTLERVTHAYRRGLHASLAARPAILLIGAGVLAGIVLLFSGVKRELAPQEDQGSIMVA
FT                   VKAPQYANLDYMERYAPDIERVFRTLPEADTSFILNSYGGSNLGFAGVNLVDWDKRTRS
FT                   AAALQALIQARGDGIRGERVFAFQLPALPASSGGLPIQMVLRTPSGFADLYAQMERIKA
FT                   AAQKSGLFAVLDSDLTFDSRAVGVTIDRNQANTLGVTMKDIADTLAVLVGENYVNRFNF
FT                   KGRSYDVIPQVSRSERLSSEMLSRYYVKTGSGQMIPLSTVIQVTNGSQANALSQFNQMN
FT                   AATFSAVPAPGVTMGDAVAFLEAQKLPAGFSIDWLGESRQYVQEGNRLAVTFGFALIVI
FT                   FLVLAAQFESLRDPLVILVSVPLSICGALAPLYLGFATLNIYTQIGLVTLIGLISKHGI
FT                   LMVSFANDLQRHEGLDRRAAIERAAAVRLRPILMTTAAMVAGLVPLVFAAGAGAASRFA
FT                   IGITVSTGMLVGTLFTLFVLPTVYTFVAKDHGAAMRSERAQLLAATR"
FT   gene            108412..110067
FT                   /gene="oprB"
FT                   /locus_tag="BURPS1710b_A0080"
FT   CDS_pept        108412..110067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprB"
FT                   /locus_tag="BURPS1710b_A0080"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52627"
FT                   /db_xref="GOA:Q3JMG4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG4"
FT                   /protein_id="ABA52627.1"
FT                   /translation="MDRFPHDTAAASRRCRRRAGGAARASCASCAASRVACASLVRTAV
FT                   RAAAVAAAFFAAGCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIG
FT                   WREFFVDPRLQRLIEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQR
FT                   TPAGVSITGQPLISRTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLV
FT                   ASVADQYLTLLSTDDLLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETAL
FT                   ASQQAQARARAQALNALVLLIGEPLPDDLPAGLPLNAQNLLTDIPAGLPSDLLTRRPDI
FT                   MQAEETLRAANANIGAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPI
FT                   FEGGQNIANLDLAHVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQ
FT                   QRRYDLSDLRYRNGVDSYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGWLE
FT                   RAGETPRPADAPVDYGKAAPAPASASARTAAVTG"
FT   gene            110454..111041
FT                   /gene="toxB"
FT                   /locus_tag="BURPS1710b_A0081"
FT   CDS_pept        110454..111041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="toxB"
FT                   /locus_tag="BURPS1710b_A0081"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53178"
FT                   /db_xref="GOA:Q3JMG3"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG3"
FT                   /protein_id="ABA53178.1"
FT                   /translation="MPIRPRTAQQRFDAEMVTFQGLCDSAEHLALVFGPLADAPLVRVH
FT                   SECLTGDVFGSARCDCGEQLDESVAMFGREGGILLYLRQEGRGIGLYNKLDAYRLQISQ
FT                   GLDTFAANRALNFPDDLRDFRVAAQMLQALGVTEISLVTNNPDKVSQIEKHGIRIRRVL
FT                   QTGVFVNTTNHGYLRAKIDHHRHAINLSQELQ"
FT   gene            111038..112735
FT                   /gene="toxC"
FT                   /locus_tag="BURPS1710b_A0082"
FT   CDS_pept        111038..112735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="toxC"
FT                   /locus_tag="BURPS1710b_A0082"
FT                   /product="WD domain protein"
FT                   /note="identified by match to protein family HMM PF00400"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52189"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG2"
FT                   /protein_id="ABA52189.1"
FT                   /translation="MITHRAPISGIAAHRDQYVLTAGYDNQVILWDAKTQRPLARAMHD
FT                   HLANQGAFSPDGAYVVTSSSDYSARLWTVPDLRLVAVFADQEDDVEMSVFHPDKPLVAT
FT                   ASRDHRVRVYDFGGKLLHTFSGHTADVISVEWMRGADEIVSSSDDGTIKRWSLANNGLV
FT                   ADIDLDGIETDTIAIAADGRIFAGNDEGEIVSIGVDGARATIAAHDAGVKRLVLDGERG
FT                   LLVSLSYDRTMRLWKAGAAGEPRALGGAALPPEVWPRSCSFEGDEHIVFSTFHSSYRRY
FT                   NWKTERWDAAELPPTHGVNAVQPVDGHLWTIGDAGIVRVDQREHARTGSLCNFLAPAGE
FT                   LILTGGQLGKVFDARSGRELHQHRSPLNCGVAFARDGAAHAVIGTYTGEGIVLRIDGTR
FT                   ATHVADLPLHANAVKGIAISGDLIFSVAADASATWYRASTLEPAFELKRAHDKIANGCA
FT                   GLGDGYFASVSRDLKLRIWSPDSHAEVIATPHTHSIKCVAASADGRYVATGSYNGRVAV
FT                   YDRVETRWALDARVTTAGVSSLAYDPAARAFLASSYDGNVYRIPLERA"
FT   gene            112732..113442
FT                   /locus_tag="BURPS1710b_A0083"
FT   CDS_pept        112732..113442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52050"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG1"
FT                   /protein_id="ABA52050.1"
FT                   /translation="MSAAEPHYIDAQRTIAPVDAPLAAPHEYAAVLRSDFVSSYHDGRD
FT                   VWTDEAAMRPASAILHAHLGRPADVLDAGAGRGRDTAYFLEQGHQVTAVDLVEPPEWAQ
FT                   LAQRWGERVRFVARPVSELDGEARFDGALDNGCLHHQHPDAYRAYLARIHALLRPDGRF
FT                   TISVFESDGPGRLYANHAQRLYREFTEPELAELLRAAHFTPVDSQRVPRPKAGLHYLVM
FT                   TARKTDSTDASARR"
FT   gene            113439..114422
FT                   /gene="toxD"
FT                   /locus_tag="BURPS1710b_A0084"
FT   CDS_pept        113439..114422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="toxD"
FT                   /locus_tag="BURPS1710b_A0084"
FT                   /product="TRP-2"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52919"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMG0"
FT                   /protein_id="ABA52919.1"
FT                   /translation="MTLKLADNPNRLSDRAAMALPDDLFVARTSATVLSTHVDLLRMTS
FT                   AQWIAIAEAPDAPFERRYAAGTLLGFAGDPRIRALDPPMCDVPAARARLGTEPARVPQV
FT                   IAEWSRVGVIDEWIEKECPRHTVELAAYRMMRYPVTNLEYRRFLEETGAPWLPTSWTFG
FT                   VYPLERANHPVWSVPAEAADAYAAWLCEATGRRFRLPTEAEWEYAASGGADVEYPWGDA
FT                   FDPRAANTVEAGPLSTTPVGIFPLGRSAFGIDDLAGNVEEYVADDYRPYPGGEAIADDL
FT                   AVTQGGYRIARGGSFTRFGDLARCARRHGRYQRDIYAMGFRLVESR"
FT   gene            114364..115728
FT                   /gene="ribD"
FT                   /locus_tag="BURPS1710b_A0085"
FT   CDS_pept        114364..115728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="BURPS1710b_A0085"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53486"
FT                   /db_xref="GOA:Q3JMF9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF9"
FT                   /protein_id="ABA53486.1"
FT                   /translation="MAAISATSTRWVFASWSRDERRIERRPARTASVDATRPRGASGAG
FT                   GARAALDRADGPPTMSAFSDIDRTHMAHALRLAEQGLYTTHPNPRVGCVIARGARTLGA
FT                   GWHRRAGEPHAEVHALREAGERARGATAYVTLEPCAHFGRTPPCANALVAAGVARVVIA
FT                   ARDPFEQVAGRGAARLADAGIVVEQGLLAAQARELNIGFFSRIERGRPWTRATLGLPID
FT                   APPALDSAELAALDAALSEARDDLRHWRARSSLVLERAPDAGRAVGCNAAAPRYVVSAR
FT                   DCAALGAASAACAPADGVPTLALHRDDNSASACEDAHGIGHRARRVDRVDHADARPAGA
FT                   PSASASDTDAGLPLPDAFARLARQGVNELLVDADLALCDALFGSDLADELLLYAHPARR
FT                   DAPVSASRLAAAIDDVARRWGLRPLERLAIGRGERILLRRARGPEPRQGEPGVIP"
FT   gene            115788..116840
FT                   /gene="grhL"
FT                   /locus_tag="BURPS1710b_A0086"
FT   CDS_pept        115788..116840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grhL"
FT                   /locus_tag="BURPS1710b_A0086"
FT                   /product="putative O-methyltransferase"
FT                   /note="identified by match to protein family HMM PF00891"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51185"
FT                   /db_xref="GOA:Q3JMF8"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF8"
FT                   /protein_id="ABA51185.1"
FT                   /translation="MNASAVETIYESTEDKAALTSVVDLVKLSDQYRQSAILHYAVADK
FT                   LFDLTQTGRTPAEVAASFGMVESKAAILLHALAALGLLTKDGDAFRNTALSARYLTTTS
FT                   ADYIGPIVEHQYLQWDNWPRLGEILRSEKPLAFQQESRFAHDTRARDAFNDAMVRLSQP
FT                   MVDVVSELGVFAHARTVIDLAGGHGTYLAQVLRRHPQLTGQIWDLPTTRDAARKTIHAH
FT                   GLGGRVEFFEKNLLDARNFEGGAADVVMLNDCLHYFDAREAREVIGRAAGLVKPGGALL
FT                   ILTMTMNDDRVTPALSADFSLHMMVNTNHGELHPTPWIAGVVRDGGLAVGERSIGRYTL
FT                   LIGQRSSGEV"
FT   gene            116843..117706
FT                   /locus_tag="BURPS1710b_A0087"
FT   CDS_pept        116843..117706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0087"
FT                   /product="putative glyoxylase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52433"
FT                   /db_xref="GOA:Q3JMF7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF7"
FT                   /protein_id="ABA52433.1"
FT                   /translation="MLVFELINLDAAPADAERLTRTLSAQCTAAGYRLRAPQADGPAPD
FT                   GVFVLSRAALPAAGAGRAGAPGWAAAAQVRVDAAGHEGEAPAIWRDGHPGAFCYPLALL
FT                   LRTADASADVARDWLAGFATFTACIKMWRRLRDAPEQGHPRELRVNHINILARDLGRSV
FT                   DFYRRIFGASYCYNLGPKKVVMELNGFDFFIEQADVVAYPPGYHFGVRADPDGVKAIAA
FT                   LVEAHGGIRIVKGNGPAPGFHAGPDRVRTAFYFQDPDGLEIEVYSPEIEMLESNPQLIS
FT                   QHLSPS"
FT   gene            117738..119141
FT                   /locus_tag="BURPS1710b_A0088"
FT   CDS_pept        117738..119141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0088"
FT                   /product="major facilitator superfamily transporter
FT                   homolog"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53627"
FT                   /db_xref="GOA:Q3JMF6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF6"
FT                   /protein_id="ABA53627.1"
FT                   /translation="MSSITAPSWGELLSGRNGLRSIALAGGVALHAINIYIATTILPSV
FT                   VRDIGGLEYYAWNTTLFMAASIVGAPLSANVLSRFGPRAAYLVALVVFCAGTLACAGAK
FT                   DMPWMLVGRAAQGFGGGILFALSYALIRIVFDERLWSRAMAMVSGMWGVATLCGPAIGG
FT                   VFAQSGTWRLAFVALVPVAAVLALIVIVQLPAREASGARAARPAIGKILLLAVSVLVVS
FT                   VASLSKAIVANVAGVAAGLAVALLIARLERGATRRLLPTGAYDVRAPLGAIYACMSLLV
FT                   IGMTTEIFVPYFLQIIHGYPPLLAGYLTALMAAGWTAGSLFSSGRSGAAAQALVRGGPL
FT                   VVVIALVALALVVPPQHLLAGGAGLAALCAALAAVGVGIGVGWPHLLTQVLTNAPAGQE
FT                   DLASTSITTVQLYATAIGSALAGLVANLAGFSAPGGLAGAQHAAAWLFAVFAAAPVLAA
FT                   IVARRVRAR"
FT   gene            complement(118954..121176)
FT                   /locus_tag="BURPS1710b_A0090"
FT   CDS_pept        complement(118954..121176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53113"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF5"
FT                   /protein_id="ABA53113.1"
FT                   /translation="MCATSSAPIVARQSLAERAARGAPGRRVAAPPRIGRRRPCGGRDR
FT                   QQPFQLVHDRLRRHAARLRAVVAEPRHDVLHAVVLPAACVRLGRTQRAREDRQVAPRPG
FT                   RGGYAFDPALVALMHDDVAMRDDRERRQRRAVVKTDRRQAEIAPRRACAQRRRGGQAKH
FT                   REIERGVLLERGVRMVEQRFGRGVVAIGVAPQFLERRRVEQIAQRGQQRTKEPRDAGAL
FT                   VVRRADLARRARGHGVQREREPPRRIRAAAREIAEARELDEPRLVAQRMVGRDEAVHRR
FT                   KPVEIEVIGRHVAHVGGVGPLGREAQHALRRQVRLVARGRAVRRPVRQREPRRRVVRGV
FT                   RRDVRHVARMLERHEREPVAGRKADGLHARSRRGRRRRARGFTGERGGQAGGVGLGVAH
FT                   RELAVAAEVVMQRAEVAAAQVVRIAVARERAVARDQVLQVDEPVLADRHDAAREQPQLE
FT                   AGEPDRDVVVELHGVIAVMEGKQGRHRGDSVRSGCRTEVEQQTGGDRPDDERDVRQLQA
FT                   FLAYPVAVPQPAEQQHERACGEAGRAGVEPRQRGRVRRRRGEQQPHAAPHRDRGERLQQ
FT                   HDDRERDAVQRAGRRRAAQQRRIDGRVLPEQRHAHRAADGARRRGECLHVVDRDDRRPA
FT                   GDRDGVQGLEQIDAGQRGHRTHRACPLSRGGRATRAPFGACAALIARARGARRSRRARA
FT                   PPRTPRTATRPHAARRRGRRARRSRRGSRQGPRARSRSRSHRAGRS"
FT   gene            119206..119706
FT                   /locus_tag="BURPS1710b_A0089"
FT   CDS_pept        119206..119706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0089"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52423"
FT                   /db_xref="GOA:Q3JMF4"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF4"
FT                   /protein_id="ABA52423.1"
FT                   /translation="MSTMAPLTGIDLFKTLHAVAIAGWATIVTINNVQTFAATTSTVGR
FT                   TMSMALLRQDPPVDTPLLRRATASRALHRVALAIIVLLQAFTAIAMWGGVRLLLATAPP
FT                   HAAALPWLDAGATGFAACALVLLLGGLWYGYWIRQEGLQLTHIALVVWSIAACLLFHLG
FT                   TTT"
FT   gene            119833..121134
FT                   /locus_tag="BURPS1710b_A0091"
FT   CDS_pept        119833..121134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52988"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF3"
FT                   /protein_id="ABA52988.1"
FT                   /translation="MAIRENRFIDLQNLIAGDGAFTRDGDPHDLRRRNLGTLHYDFGGH
FT                   GELAVRDAETDAARLAAALAGESARPPSPAAPRSRVQAVRLSPGDRLAFVPFEHARDVP
FT                   NISADATHNAATRLTLSHWPANRTPARYKANLSTQSVLRFAAERADAADVRHVTTDHFD
FT                   LDGLASVYGLIAPDHALRHQARLVELARFGDFARGRSDAARRLAFALDTVAARASREIG
FT                   ATDDESARVARLFRALLPALRDLLDAPPLEELWRDADRHHAATEALLDHPDAALEQHPA
FT                   LDLAVFRLPAAPALRAGAARRYFGLSPIGFHNRTPLSTLAIVAHGDVVVHQRYEGWVER
FT                   VSAAPRPRRDLSILARALRAAEPHACRWQYDGVQHIMPRLGHDGAQPSGVPAETIVDEL
FT                   KRLLAIAPAAWTPTPDARRRGDAPSGRTASGALG"
FT   gene            complement(121348..122151)
FT                   /locus_tag="BURPS1710b_A0092"
FT   CDS_pept        complement(121348..122151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0092"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52591"
FT                   /db_xref="GOA:Q3JMF2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF2"
FT                   /protein_id="ABA52591.1"
FT                   /translation="MPIGGQMSCFVDPLKLIFDHYPGLWGCQDSESRFIHVNDAFAKVV
FT                   GVRDPRELEDKSAFDLPCGSSNCAAQFQAQDREVRETGRAIKVLDIHPYASGVWMAFVF
FT                   TKIPLVDRNDEIVGTIFHATELSQIDMITLGRVIGDSYAGKRIGGPVEQGSYRIDSPRD
FT                   ALELTERERQVLFFLARNKTAKDIANILGLSARTIEQYMENLRCKFSASSKNELIDLAA
FT                   GAGYCNRIPQSLLRNQLSVVLERGEPQMRDAREAARVPPAIIAML"
FT   gene            complement(122532..122972)
FT                   /locus_tag="BURPS1710b_A0093"
FT   CDS_pept        complement(122532..122972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0093"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51777"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF1"
FT                   /protein_id="ABA51777.1"
FT                   /translation="MTSIPAAVHPCVRQSLERWHAMVAARDMSTLADIADPNAVFRSPI
FT                   AHSAYAGAAALTLAIGTVVNVFEEFTYHRQMATDDGLSVVLEFSARVGDKRLKGIDLIR
FT                   FDEAGKIVEFEVMVRPASGLQALGAEMGARIGARLPEFKSNV"
FT   gene            complement(123069..125090)
FT                   /gene="fadH"
FT                   /locus_tag="BURPS1710b_A0094"
FT   CDS_pept        complement(123069..125090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="BURPS1710b_A0094"
FT                   /product="2,4-dienoyl-CoA reductase (NADPH)"
FT                   /EC_number="1.3.1.34"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00724; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51431"
FT                   /db_xref="GOA:Q3JMF0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMF0"
FT                   /protein_id="ABA51431.1"
FT                   /translation="MTFYPHLTAPLELGFTSLKNRALMGSMHVGLEEAANGFERMAAFY
FT                   AERARGEAGLIVTGGIAPNERGRMMPGGSMLTTEEEAERHRIVTRAVHDAGGRIAMQIL
FT                   HFGRYAYHPALVAPSALKAPINTFTPHALSASEVDATIDDFARCAALAQYAGYDGVEIM
FT                   GSEGYLINEFIAAHTNHREDEWGGAYENRIRFPVEIVRRVRERVGTNFIIIYRLSMLDL
FT                   VEGGSTLDEVIRLAQAIEAAGATILNTGIGWHEARIPTIATKVPRAAYAWVTKRLVGRV
FT                   GIPLVATNRINTPEIAEQLLAEGYCDMVSMARPFLADAQFVRKAREGRADEINTCIGCN
FT                   QACLDHIFSGRITSCLVNPRACHETELVIEPAERRKRIAVVGAGPAGLSFAVTAAERGH
FT                   DVELFEASPEIGGQFNIAKKVPGKEEFHETLRYFRRQLELRGVTLHLNTRADVARLAGG
FT                   GFDEIVLATGVTPRRPDIEGIGHARVMGYLDVLRDGKPVGASVAVIGAGGIGFDVSEYL
FT                   THTGESASVAPSTFYAQWGIDVDYGARGGVRMPHVEAAPRNVHLLQRKASKVGDGLGKT
FT                   TGWIHRTSLKARRVAMSSGVSYERIDDAGLHVRIDGEPRTLAVDNVVVCAGQEPQRELY
FT                   DGLRAAGCSVHLIGGAHVAAELDAKRAILQGTTLAASI"
FT   gene            125206..125796
FT                   /locus_tag="BURPS1710b_A0095"
FT   CDS_pept        125206..125796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0095"
FT                   /product="PadR-like family regulatory protein"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52114"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME9"
FT                   /protein_id="ABA52114.1"
FT                   /translation="MRGFRSFGCLAMSLPHALLTSLAERPGSGSELTRRFDRSIGYFWH
FT                   ATHQQIYRELARLEDEGWVESTPVEQARGRKRAYRILPAGRKELKRWIAQHDDPKPLRD
FT                   ELMIRLRAEAVVGPTGLADEIRRRLDLHRQKLALYREIEARDFTHGMDTRERRLQHLVL
FT                   HAGIMQESQSIELLRQALDILSMPEARAKPRGA"
FT   gene            125793..125894
FT                   /locus_tag="BURPS1710b_A0096"
FT   CDS_pept        125793..125894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52803"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME8"
FT                   /protein_id="ABA52803.1"
FT                   /translation="MTPAGAAAAMHAAAEQAAGPRPGIDDARRSLSA"
FT   gene            125992..126882
FT                   /locus_tag="BURPS1710b_A0097"
FT   CDS_pept        125992..126882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0097"
FT                   /product="putative hydroxyethylthioazole kinase"
FT                   /note="identified by match to protein family HMM PF02110"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53542"
FT                   /db_xref="GOA:Q3JME7"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JME7"
FT                   /protein_id="ABA53542.1"
FT                   /translation="MRKRTPSSARARANAIWNDTMESISWNTPSVRDALAAVKRDAPFI
FT                   YGLTNYVAANLSANVLLAVGAAPAIGAAADWPARFGAGANALWINTAALMSSGADTLLT
FT                   AARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAAGK
FT                   GVDTTASPESALAFIGDLARRSGAVVSVSGPTDYVTDGVATLAVAGGDARLTRVTGAGC
FT                   ALGALIAALLAQRGAALAAASAAHAIYATAAERAADARGTASFAVRFVDELSLLDPAES
FT                   SRDRSAGQIGAKRRE"
FT   gene            127045..127266
FT                   /locus_tag="BURPS1710b_A0098"
FT   CDS_pept        127045..127266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53265"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME6"
FT                   /protein_id="ABA53265.1"
FT                   /translation="MPDSRIGEKTFNPFLHFAHSILAPAFQQHVGRVDRTKSLEAISAI
FT                   SAYSSSCGNKTGRTGFSCDFTHRISHSN"
FT   gene            127428..128264
FT                   /locus_tag="BURPS1710b_A0099"
FT   CDS_pept        127428..128264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0099"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52445"
FT                   /db_xref="GOA:Q3JME5"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME5"
FT                   /protein_id="ABA52445.1"
FT                   /translation="MLTLTSSHSAQALSRQPFDGTLPLSEVTLPIRTPRTMTDDEVSGM
FT                   IETFNRYGFVILDCESSERDDLLALKTWLGNAAPHKRADADGVVPINAFEPVAGHIDSS
FT                   HEAHLPHTDGAFSDTPERIITLQCVRPSRNGGLSTLSSAKAAYRHVVACYGDITPLTRA
FT                   DALTIERTTQKSTAAVFKEDDDGWSIKFRMNDGAATATPAPAAADMYGSLACFLTDPEN
FT                   MLLFPLEPGQILIGDNTAVTHGRTSYPPHQRRNMRRLNFDGRGALARELVFGFSDD"
FT   gene            128379..129266
FT                   /locus_tag="BURPS1710b_A0100"
FT   CDS_pept        128379..129266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0100"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53239"
FT                   /db_xref="GOA:Q3JME4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME4"
FT                   /protein_id="ABA53239.1"
FT                   /translation="MQNDFSLVVVPIFACSLIGLLWVKLRLPMNAACLSALVSNIGIPC
FT                   LLLSSLDQPNLTARVLVHTFAAGAVALACFAALGALFLRALKLPLRQYLPSLMLPNTSN
FT                   LGLPVALFTFGEQGLLYAVAFSALVQIGHFTIGVWLLSGRASWKSIAASPTIWAVAAAL
FT                   FMTVNGLHPSAPLAATAKQLGNMAPPLMLLMLGASLANIRLAGLHRVALLALVRVAGGL
FT                   GVGLALACLLGLPSVAAGAFVVQCTMPVAVLSHLIAQQHDGPTEDIAGMILISTGLSLA
FT                   GLPLMLASAKLVVG"
FT   gene            129311..130030
FT                   /locus_tag="BURPS1710b_A0101"
FT   CDS_pept        129311..130030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51655"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME3"
FT                   /protein_id="ABA51655.1"
FT                   /translation="MPARDARDPRDPFRPARRTSHTPRMSDTSRSRATRDAPAGNRAAV
FT                   RRRAARRIPRRIRQAAQRLPIAHRQRNQPCSTITSTSSAWSSSSRRTRACHSSRNSATS
FT                   PGGAVIARQRGSRSAIRGSPGTRSSRADTPTLAPVSTRAKRSCSRIGSPNVSSRRRSKR
FT                   PPMPLKPVSNVAPVNMPTTFAITPVTPSVAGSRSATRIAPRSAGAPPYSAPSAARVIRY
FT                   ADATVGHECPASFTTSA"
FT   gene            complement(129526..130239)
FT                   /locus_tag="BURPS1710b_A0102"
FT   CDS_pept        complement(129526..130239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME2"
FT                   /protein_id="ABA52490.1"
FT                   /translation="MRQSRRPRYSFRPVRRDSRAERLADPILMQPSPPSDRFPDFFDAA
FT                   PRIALRDPLAAFLGAAHDGGAIEYGYADVVKLAGHSCPTVASAYLMTRAALGALYGGAP
FT                   AERGAIRVALREPATEGVTGVIANVVGMLTGATFDTGFKGIGGRFDRRRLLTFGEPMRE
FT                   QLRFARVDTGASVGVSARLERVPGDPRIADLLPRCLAMTAPPGDVALFRELWQARVRRL
FT                   LLDHADDVDVIVLHG"
FT   gene            130231..130536
FT                   /locus_tag="BURPS1710b_A0103"
FT   CDS_pept        130231..130536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME1"
FT                   /protein_id="ABA51995.1"
FT                   /translation="MSQSARTTRMPRREGRRPCGRRRRSLNGEIDHDRAGLALPVLDAH
FT                   PRAVVLPDLFEQRKRIVIIDEAHRLAGLKRVDRAEDRRVAKALRDTARVERIDRGR"
FT   gene            complement(130303..130560)
FT                   /locus_tag="BURPS1710b_A0104"
FT   CDS_pept        complement(130303..130560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53662"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JME0"
FT                   /protein_id="ABA53662.1"
FT                   /translation="MSQPHLHLSPTAIYPFDARGVAKRFRHAAIFGAIDALQSGETMRF
FT                   VNDHDPLPLLEQIRQHYGARVGIEYRQREPGAIVIDFAVQ"
FT   gene            130897..131856
FT                   /locus_tag="BURPS1710b_A0105"
FT   CDS_pept        130897..131856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0105"
FT                   /product="universal stress protein family"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52226"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD9"
FT                   /protein_id="ABA52226.1"
FT                   /translation="MESTMSTDTPNSAPLSLPQRVLVAVDASKASQRAIDYLKYVVPAG
FT                   AAVRFVSVVDTPRAYMLPHTFAPSEFAAAHTELVNDASNALDGATLTFGRVDVTVETAI
FT                   VDLAKKGGDVVDALLDETRDWHADLLVVGSRQYQGLLRWVEGSVSEPLLARTDCAILFV
FT                   PPGVESATHAPTRVLFATDGSPIAARALRYGAQFATPDTHLRAIYVIDRAVRLTDFVPI
FT                   HMLEDAFVEESERALAVARQLLDEVPGQSSTAALSTDLTSDDVAHTIVREAERWPADLL
FT                   VMGTHGRRGVSRWLLGSIAQRVARLTPIPLLLVHGPNA"
FT   gene            complement(132075..132491)
FT                   /locus_tag="BURPS1710b_A0106"
FT   CDS_pept        complement(132075..132491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51436"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD8"
FT                   /protein_id="ABA51436.1"
FT                   /translation="MGLLRSFRAWRKLRRLPSIKIETKAAEAGSEPAAHAKWAVVIRNA
FT                   QGARIGEAIYGLSQLTDRLYVHSLEIAPSARRRGYALAFLMMLNRYYKVPIVPMSDRAA
FT                   GNPFWAAVRKLRPGGLAVLFEERGEGAGGLPPRA"
FT   gene            complement(133440..135143)
FT                   /gene="hyfG"
FT                   /locus_tag="BURPS1710b_A0107"
FT   CDS_pept        complement(133440..135143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyfG"
FT                   /locus_tag="BURPS1710b_A0107"
FT                   /product="hydrogenase subunit"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by match to protein family HMM PF00346"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53302"
FT                   /db_xref="GOA:Q3JMD7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD7"
FT                   /protein_id="ABA53302.1"
FT                   /translation="MSGQTRIASAAGQPRAVFASVDADAWTRAAETIRTAGGRLVTLWG
FT                   GEPAAGRYEVCAAYELDDGLLWLRLPVEPAANVGREAGDTSNAGNASNAGDADGVRQRG
FT                   EAGSYPDLSAIFASATRMQRALHDLVGLRARGAHDTRPWLAHGAWPRDYHPLRRRATGG
FT                   ERFEYATADYPFVPVAGDGVHEIAVGPIHAGVIEPGHFRFSVVGEKVLRLEERLGYAHR
FT                   GVERLFERADALAGSRLAARIAGDSTVAFAWAYCMALEQALRIRVPDRALRLRALLLER
FT                   ERVANHLGDLGALGNDAGFAVGLAHFSRLKEDWLRMQDRIFGHRYLMDAIVPGGVARDI
FT                   AADDAAAIVAQCDRIEREVRAMQTIYDDQSGLQDRFAGTGRLDAQAVAHFGVCGLAARA
FT                   SGQPRDVRADHRLAPYDALRIDVSRDARGDVAARVAVRFAETYESMRAIRALLADLPDD
FT                   GLAAEIAPGATVPGARADAGGACEGEEGGDAAFCPGDARRRGIGWIEGWRGPVFVALEL
FT                   DARGAVARCHCHDPSWHNWPALEHAIIGNIVADFPLINKSFNLNYAGHDL"
FT   gene            complement(135168..136628)
FT                   /gene="hyfF"
FT                   /locus_tag="BURPS1710b_A0108"
FT   CDS_pept        complement(135168..136628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyfF"
FT                   /locus_tag="BURPS1710b_A0108"
FT                   /product="formate hydrogenlyase subunit, similar to NuoM
FT                   subunit of complex I"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53010"
FT                   /db_xref="GOA:Q3JMD6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD6"
FT                   /protein_id="ABA53010.1"
FT                   /translation="MIDGYVLPALLGLPLAAGGCLALVRRQHVARALNVGFSFLTCAAA
FT                   LALAARTVAHGPMYAVGALFFVDPFNVFLVALTAFVGWTTSLFSNPYMRIEHDRGKMSD
FT                   GRMRLYHCMYQLFIFAMLLALLTNNVGVLWVAMEAATLATVLLVSVYRTAASLEAAWKY
FT                   FILCGVGIAQALFGTILLYLAAGRRLADGDALLWTSLNAVKTQLDPTIVSIAFVFLLVG
FT                   YGTKVGLVPMHSWLPDAHAEGPTPISAVLSGLLLNVALYAVLRCKVLADGALGNGLPGH
FT                   LLVGFGLVSVLVASFSLFRQKDVKRLFSYSSIEHMGLMTFAFGLGGPIATFAGLLHMTV
FT                   HSLVKSAIFFAVGHAAQKARTQAIDGIRGLLQVSPTVGWGMMLGTLAILGMPPFGVFAS
FT                   EFLILTTAIAKLPWSAPFLLVALAAAFAAIFMRVQPMVFGESSVASLEHPPALLPVFVH
FT                   LALGLMLGLYVPPYLAAWYRQAAAMIAG"
FT   gene            complement(136621..137280)
FT                   /gene="hyfE"
FT                   /locus_tag="BURPS1710b_A0109"
FT   CDS_pept        complement(136621..137280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyfE"
FT                   /locus_tag="BURPS1710b_A0109"
FT                   /product="Hydrogenase 4 membrane component"
FT                   /EC_number="1.12.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52367"
FT                   /db_xref="GOA:Q3JMD5"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD5"
FT                   /protein_id="ABA52367.1"
FT                   /translation="MHGYATQLVNFLAAILLLLSFAMLSQRRILSLTHLYTLQGVALVS
FT                   ANLILGFVTADTHLYVSAALTLLLKVGLIPWILHRLVQRLNVKADVEPLLNIPTTLVAG
FT                   IALVIVAFNVAAPISRLAESAARGTLGIALACVLLSFMMMITRAKAIPQVIGFLSMENG
FT                   LFFAAAAATNGMPMIVELGIGLDVLVGILILGVFMFQIREQFDSLDIHHLEKLKDD"
FT   gene            complement(137281..140208)
FT                   /gene="hyfD"
FT                   /locus_tag="BURPS1710b_A0110"
FT   CDS_pept        complement(137281..140208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyfD"
FT                   /locus_tag="BURPS1710b_A0110"
FT                   /product="formate hydrogenlyase subunit 4"
FT                   /note="identified by match to protein family HMM PF00146"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51608"
FT                   /db_xref="GOA:Q3JMD4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD4"
FT                   /protein_id="ABA51608.1"
FT                   /translation="MRAVRRARVARARLRRTREPAPHRCDRTRPLPARRAGRARARGAR
FT                   PGRRVRRAVERRAAARAARPAVPSACRSAVRILPVRARRGDGGRRRVLVRLLPQGRGHG
FT                   ARPHLLRVPRVRREHGAAARRGRCVLLHGRVGDADAVGDLPRDDEPPDRRDPPRRIRVF
FT                   PDLARRRARAAAVLRPAAGGHGRLHVREHAHPASRRARRIGRVRARARRLRREGRHLSA
FT                   ARLAAGRASGRAVAGIRAAERLRAEDRPVWNIAHGARSAARAGGVVGRAHARARPVRRV
FT                   ARRRVQHDPDRHEAAARLFVDRQRRPDVREPRAHDPVPRLPAALARRAVADGAAVSDRR
FT                   ARVLQEPAVPRHGRRAARDGRAQSRPARRLDPLHAVDRVGDARRRRRERRAAAVERLRV
FT                   RMAARAELPVHAGAAGFGARDDGAARRGARRADGGARRLRDGQVLRHRVPRPAARGQAR
FT                   ARARREPVGADRVRLVRGRERAARPRARSVREGARCAHARARRRGHRGHESRVAAVRAR
FT                   VHRARELHAGALHAVLRRVLRARVAARAALLSRQAAARGAVVVRQSVRDRAHAGHGRRL
FT                   RPADPRDLHAVLPDRAATAVAVRSAAGLPDERRGPHVAPAVRADRRARKPRRRARRAVA
FT                   DGPHRDLSDVQLHRADRPSDGGETMVSASGILSQTLEILVALAAAPLLTGWVNQCRAWL
FT                   QNRRAPSIWQPYRMLHKLFNKESVVAEHASPLFRGAPYVVWAAMALACAIVPTLSTELP
FT                   FSPAADAIALVGLFALARVALSLAAMDIGTAFGTLGARREMLIGFLAEPALLMVLFSAS
FT                   LITRSTLLTSIVAALGHRELAIYPSLAFAGIAFTLVSLAENARLPVDNPATHLELTMIH
FT                   EALILEYSGRHLALMEWAASLKLFAYSCIGLALFMPWGIAEAGSPLALLLALPALFVKL
FT                   LVGGAALAVVETTNAKMRLFRVPEFLASAFLLAVIGMLVHFLLGA"
FT   gene            140590..141363
FT                   /locus_tag="BURPS1710b_A0111"
FT   CDS_pept        140590..141363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0111"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52170"
FT                   /db_xref="GOA:Q3JMD3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD3"
FT                   /protein_id="ABA52170.1"
FT                   /translation="MPVAYFRRLAGKDRNLDANRHLGFSLAFVAGAANAGGFLAVKQYT
FT                   SHMSGIVSAIADQAALGDIALVFAGIASLASFLLGAATSAVLVNWGRRKGLHSRYAFPL
FT                   LLEALLLLCFGLLGSHLALWRAFFVPVTVVLLCFIMGLQNAIITKLSNAEIRTTHMTGI
FT                   VTDLGIELGKLFYWNSAHAGPGEPDVYANRQKLRVLGTMLAMFFAGGLAGALGFKHVGY
FT                   SATIPLAGLLVVLTGVPMLDDLREWAGRPSGGRAR"
FT   gene            141590..142087
FT                   /locus_tag="BURPS1710b_A0112"
FT   CDS_pept        141590..142087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0112"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD2"
FT                   /protein_id="ABA51881.1"
FT                   /translation="MAQPLAPIAARLAPDARMFDMRVALLAHDYARRAPRDVMGAQGLV
FT                   IVGVGKSGERGFQMLYRFSDACTRLEALGTNVIFVYPKESARHVLDPISVSSAQIRQRP
FT                   CLFLDDEGRFFQRPCPPRSLSLVHLSRDMKPLDTAKIVLHDHAWDGELLAFFARAQARV
FT                   TH"
FT   gene            142145..142405
FT                   /gene="ptsH"
FT                   /locus_tag="BURPS1710b_A0113"
FT   CDS_pept        142145..142405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="BURPS1710b_A0113"
FT                   /product="Phosphocarrier HPr protein"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53780"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD1"
FT                   /protein_id="ABA53780.1"
FT                   /translation="MAQALIEIGPKWGRYDTARAGEALAGAAGRFQSDIVVVANGRHAN
FT                   AKDAMSVVALRAKCGTRMQILSSGPDEDDALDSLASLLTQR"
FT   gene            142426..143256
FT                   /locus_tag="BURPS1710b_A0114"
FT   CDS_pept        142426..143256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0114"
FT                   /product="transferase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by match to protein family HMM PF01564"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53418"
FT                   /db_xref="GOA:Q3JMD0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMD0"
FT                   /protein_id="ABA53418.1"
FT                   /translation="MQPRFPGMPADASGPLRAPHRCARENSPVVIETPHLVSLCFDEHG
FT                   MQSCMYVDGPDLLALGYTRTMAGFLLLHPQPRRIAMIGLGGGSLAKYCYRHLPDARITS
FT                   IEINPDVIALRDRFRIPPDDARFTVLCADGARYVAEAGEACADVLIVDGFDAGGLPLAL
FT                   GTRQFYADCRRHLADGGVLAVNLLVDDPRVADCLAALRDAFGASAALAPAEDSALNLIV
FT                   FAWKSDAPLPSLETMIERANALADRHSVDLGEAAVRIELGASYDWSRFGEPVDA"
FT   gene            143363..143581
FT                   /locus_tag="BURPS1710b_A0115"
FT   CDS_pept        143363..143581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0115"
FT                   /product="CopG family protein-related protein"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51594"
FT                   /db_xref="GOA:Q3JMC9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC9"
FT                   /protein_id="ABA51594.1"
FT                   /translation="METKSARLTVLIDPFKKKAFEQLCAAQDLTPSQVVRQMIRDYLEQ
FT                   HGVSYKTRSTVAARGAAKSQPRRKPAA"
FT   gene            143622..143948
FT                   /locus_tag="BURPS1710b_A0116"
FT   CDS_pept        143622..143948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51970"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC8"
FT                   /protein_id="ABA51970.1"
FT                   /translation="MIPCDVCRPLACERHPASVDVPLDALGKPTKLRPLLRKPVVIAKF
FT                   RCRACGANWIREADASAPGEVHWLCLGDATSILEPVARGRKPADAAAAEARPAAPRAGA
FT                   ERLA"
FT   gene            complement(143953..145227)
FT                   /gene="narK"
FT                   /locus_tag="BURPS1710b_A0117"
FT   CDS_pept        complement(143953..145227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="BURPS1710b_A0117"
FT                   /product="nitrate/nitrite transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52593"
FT                   /db_xref="GOA:Q3JMC7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC7"
FT                   /protein_id="ABA52593.1"
FT                   /translation="MGSRHGSGAFDPAPAIPARAWSVLFASTLAFLVCFVVWMMFGVLG
FT                   VPLREDLHLNSTEFGLLTSTPVLTGALMRLPLGAWTDRFGGRIVMTVLLVVCSVPVYGV
FT                   SYANALWQFLLIGLFLGCVGASFAVGTPYVARFFPPRRRGLAMGVFGAGTVGAAVNLFV
FT                   TPLLLAAYGWRVVPRVYALALVVTAAVFWFASAPDPGAGAQKGSWVDSFKVLRDPRVWK
FT                   LCQYYSITFGGFTALSLWIPQYLKNGYGMSLVAASAFAAGFSLPGSVLRALGGALADRY
FT                   GAHAVTWWGLWVAWICLFLLSYPPTDLVIHTIDGTATLRLHVPLAAFVVLTFVLGAVFA
FT                   FGMASTFKYVADDFPNNMGVVTGIVGLAGGLGGFLLPIIFGALVDLLRVRSTCFMFLYG
FT                   IVWVSLILLYLAEIRRVPVTGAPPR"
FT   gene            complement(145252..146049)
FT                   /locus_tag="BURPS1710b_A0118"
FT   CDS_pept        complement(145252..146049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0118"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51341"
FT                   /db_xref="GOA:Q3JMC6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC6"
FT                   /protein_id="ABA51341.1"
FT                   /translation="MDTIDETLEARPHARVSVNGVEIGAAEIADERAHHADADDPLDAA
FT                   RRALVVRELLRQRAVALGLAAEGAPLGDDALDALLARELTPLPEPTRDACERYYLNHAA
FT                   RFRRRDIVYASHILFAVTDATPLAPLRREAEATLARVLAEPQTFEARARELSNCPSAQV
FT                   GGSLGQLLRGDSVPEFDAAVFDTTDSGVLPRLVNTRFGFHIVRIERRVPGDPVPFDAVA
FT                   AEIAAFLAERVRHKAIQQYVTILASGARIEGVALGDANGPLVQ"
FT   gene            complement(146069..146752)
FT                   /gene="narI"
FT                   /locus_tag="BURPS1710b_A0119"
FT   CDS_pept        complement(146069..146752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="BURPS1710b_A0119"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF02665;
FT                   match to protein family HMM TIGR00351"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52029"
FT                   /db_xref="GOA:Q3JMC5"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC5"
FT                   /protein_id="ABA52029.1"
FT                   /translation="MSDYLNTFLFGIYPYICVAVLLIGSLIRFDREQYTWKSDSSQLLR
FT                   RGALRLGSNLFHWGVLVVVIGHFVGFLAPHWLVSPLMSASSHQLLAMVGGGVAGAVAIA
FT                   GLTILIARRLGDARVRRNSRKSDILIVLMLWAQLALGLGTVALSARHMDGAMFEALTDY
FT                   VKGIVTFQPGVAALVAGVPWTYRAHILLGFTLFLVSPFTRMVHVWSGFASVAYLIRPYQ
FT                   LVRKR"
FT   gene            complement(146931..147620)
FT                   /gene="narJ"
FT                   /locus_tag="BURPS1710b_A0120"
FT   CDS_pept        complement(146931..147620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narJ"
FT                   /locus_tag="BURPS1710b_A0120"
FT                   /product="nitrate reductase 1, delta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF02613;
FT                   match to protein family HMM TIGR00684"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53100"
FT                   /db_xref="GOA:Q3JMC4"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC4"
FT                   /protein_id="ABA53100.1"
FT                   /translation="MSDAPAAPRGAVYSALSALLDYPEDALVDALPAIDACVRDAKGLT
FT                   KDARAGLARLIAYLGERDLLTLQENYVALFDRGRATSLHLFEHVHGESRDRGQAMVDLL
FT                   RMYERHGLYLSAHALPDYLPVFLEYLSRLPERDARNLLTETAQILQALAAALAKRGSHY
FT                   AFAIGALLSLAGKGPPDVPAAPDDDAHPTVDHRALDADYADEPVRFVGAATPGAEPVRF
FT                   YDKRPAR"
FT   gene            complement(147617..149146)
FT                   /gene="narH"
FT                   /locus_tag="BURPS1710b_A0121"
FT   CDS_pept        complement(147617..149146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="BURPS1710b_A0121"
FT                   /product="nitrate reductase, beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR01660"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53539"
FT                   /db_xref="GOA:Q3JMC3"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC3"
FT                   /protein_id="ABA53539.1"
FT                   /translation="MKIRAQIAMVLNLDKCIGCHTCSVTCKNVWTSREGMEYAWFNNVE
FT                   TKPGIGYPKDWENQARWRGGWKRRADGRIEPLLGGKWRLLAQIFANPHLPEIDDYYEPF
FT                   TFDYAHLQEAGDTKAMPVARPRSLVSGERLEKIEWGPNWEEILGGEFDKRSKDYNFEHV
FT                   QKDIYGQFENTFMMYLPRLCEHCLNPACVAACPSGSIYKREEDGIVLIDQDKCRGWRMC
FT                   VSGCPYKKIYYNWQSGKAEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADRIGE
FT                   AASVERETDLYEAQLSLFLDPNDPAIAAHAERDGVPAAWLDAARRSPVYKMAIDWKIAF
FT                   PLHPEYRTLPMVWYVPPLSPINAAANSGALGMNGYLPDVESLRIPLRYLANLLSAGDEA
FT                   PVKRALERLLAMRAFMRARHVDRVDAPGVLKQAGLSVAQVDEMYRYLAIANYEDRFVIP
FT                   TAHREYAEDAFDLRASCGFSFGNGCSGGTSETSLFGMKQGQRTIPIKEVEQ"
FT   gene            complement(149143..152946)
FT                   /locus_tag="BURPS1710b_A0122"
FT   CDS_pept        complement(149143..152946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0122"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM TIGR01580"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51634"
FT                   /db_xref="GOA:Q3JMC2"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC2"
FT                   /protein_id="ABA51634.1"
FT                   /translation="MSHFLDRLRFFTTTRPQFSDGHGAVTDEDRKWEEGYRQRWQHDKI
FT                   VRSTHGVNCTGSCSWKVYVKGGIVTWETQQTDYPRTRPDMPNHEPRGCSRGASYSWYLY
FT                   SANRLKYPLVRSALVRLWRERRRTMAPVDAWRSIVDDEHARRGYQSRRGLGGFVRATWD
FT                   EVDEIVAAANVHTVARHGPDRVVGFSPIPAMSMVSYAAGSRYLSLIGGVCLSFYDWYCD
FT                   LPPASPQTWGEQTDVPESADWYNSTFIMMWGSNVPQTRTPDAHFLVEARYRGTKIVSVF
FT                   PDYSEGAKFGDLWLHPKQGTDAALALAMGHVILKEFHVDGASDYFSDYCRRYTDMPCIV
FT                   RLVPHGAGYVPERLVRASDFDGALGEAEHPEWKTVMIDDATGEFVVPVGSIGFRWAQPG
FT                   GGDRGKWNLKEQTSRGAALAPRLSLASAHDEVVDVLFPYFGNQPHAHFAPTPHAGELSR
FT                   RIGARRVTTPGGEMLVATVYDLFVANYGIDQGLGGRDVATSYDDDVPYTPAWQEAITGV
FT                   KREDAISVARQFAQNAHKTQGKSMVIVGAGINHWFHMDMTYRAIINMLIMCGCVGKSGG
FT                   GWSHYVGQEKLRPQTGWTALAFALDWHRPPRQMNATSFFYAHTDQWRYDPMDPAALLSP
FT                   LADKSRFHGAPIDYNVRAERMGWLPCAPQLAANPLRVGADIADPAHAGAEIARRLASGE
FT                   LKMACEDPDAPENFPRNLFVWRSNLLGSSGKGHEYFLKHLLGTAHGVQGDEIREGGGVR
FT                   RPEEVTWHADAPRGKLDLLVTLDFRMSTTCMYSDVVLPTATWYEKDDMNTSDMHPFIHP
FT                   LSAAVDPAWQSKSDWEIFKGIAKRFSELAEGHLGIERDVVLAPIAHDSAAELAQPFDVR
FT                   DWKRGECDAVPGRTMPAVTVVDRDYPSTYRKYTSLGPLMERLGNGGKGIGWDAKDEVAL
FT                   LGALNYRVTEAGCAQGRPRIDSALDAAEVILALAPETNGAVAVKAWQALSAITGLEHAH
FT                   LARAREDEKIRFRDLQAQPRKIISSPTWSGIESEHVSYNAGYVNVHELVPWRTLSGRQQ
FT                   LYQDHPWMRAFGEVLCAYKPPIDTGSYAHMVGQRSNGHPEIVLNFITPHQKWGIHSTYT
FT                   DNLLMLTLSRGGPIVWISERDAQAIGVVDNDWIECYNANGALCARAVVSQRVPRGMVMM
FT                   YHAQEKIVNTPGSEITGTRGGIHNSVTRVSLKPTHMIGGYAQLSYGFNYYGTVGSNRDE
FT                   FLIVRKMKRIDWLDGENESARAPNVSTSGADDERHAGAGETR"
FT   gene            complement(153056..153520)
FT                   /locus_tag="BURPS1710b_A0123"
FT   CDS_pept        complement(153056..153520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51375"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC1"
FT                   /protein_id="ABA51375.1"
FT                   /translation="MRQRAGIADRILSKITHRRNPCAPACPRAAAACAYARALAPARGT
FT                   RIVRCGIGAAKKDCRREASHFFMGCHTCAICFVDIMAAIRVVHRDRHVSRIDADPVIAS
FT                   RVIFMAVFRRVDATECVLAARIRSRGERRRGRGAGGGGEGAREPCAAASR"
FT   gene            153331..153477
FT                   /locus_tag="BURPS1710b_A0124"
FT   CDS_pept        153331..153477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52673"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMC0"
FT                   /protein_id="ABA52673.1"
FT                   /translation="MPHADNLFSPRRYRTARCACHAQARGHAHTRRPPPRAGMRAHMDC
FT                   ADA"
FT   gene            complement(153336..153557)
FT                   /locus_tag="BURPS1710b_A0125"
FT   CDS_pept        complement(153336..153557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51888"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB9"
FT                   /protein_id="ABA51888.1"
FT                   /translation="MPVFCVIPAIFGNAATRRHRGPNSFKDYASAQSMCARMPARGGGL
FT                   RVCACPRACAWHAHRAVRYRRGEKRLSA"
FT   gene            153824..155683
FT                   /locus_tag="BURPS1710b_A0126"
FT   CDS_pept        153824..155683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0126"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF07730; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52301"
FT                   /db_xref="GOA:Q3JMB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB8"
FT                   /protein_id="ABA52301.1"
FT                   /translation="MTTTLRQELLTTATVLRGARGMLGERASPASVGWTNYQAQLDLDR
FT                   ARSPIRSLGFVDAKTVIGAGAQTGADPQTRAALLRAADSGLATLDAHAAPSDGAYAPDS
FT                   GAGALALYLPVYAANGPLPAAERRRADTAGFVVATLDARRLVELSSANDRDIDLRLSAG
FT                   EAGLLVYTTERDYSGADASHPPLVRTDSLNFGGTPLTLAYTTENRWAAIRSNAVATTVF
FT                   VAGAATSALLAVLAYLLVGARERAADDSPLNEARMMGIIRSSMEAIITVDETQTIVIFN
FT                   PAAERVFGVSAMDAIGSPLARFIPERFRAAHAKHVEQFGVTGVSERQMGRQRVLFGLRE
FT                   NGEEFPIEASISQIRDGSGKLYTVMLRDVTERVRNENALRQSREELRELSANLQNVREE
FT                   EKTRIARELHDDLGQQLTALKMDVSAVAIALARYRDTQADAPPIAAVEQQLHGMRRLID
FT                   STVASVRRIAADLRPVMLDDLGLVPAIEWLVNDFTNRYGIDVERRLDTADTSFSNAGAT
FT                   TLFRIVQEALTNVARHADATRVDLTLAIDQDFCLLQIRDDGRGVPSDERRDANGDKSFG
FT                   LIGIRERAHMLSGTVTIDSAPGQGFSIKVALPLAAIRQTDALL"
FT   gene            155680..156327
FT                   /gene="vsrD"
FT                   /locus_tag="BURPS1710b_A0127"
FT   CDS_pept        155680..156327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsrD"
FT                   /locus_tag="BURPS1710b_A0127"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52997"
FT                   /db_xref="GOA:Q3JMB7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB7"
FT                   /protein_id="ABA52997.1"
FT                   /translation="MIKVLIADDHALVRDGLRHILGAETGFEVVGEACDGISTIELTRS
FT                   TDAQLLVLDLSMPGRNGIDLIRQIKEEKPALRILVLTMHAEQQYASRAFRAGASGYMTK
FT                   ESASAELVGALTKIAAGGLYVSLAMAERLAQSLNEPVESLPHQRLSDREFDVFRRIAAG
FT                   ETITEIAQALDVSAKTVSTYKARILEKMQMPHDAALVRYAIRHKLFDDGDEI"
FT   gene            156935..157345
FT                   /gene="gacA"
FT                   /locus_tag="BURPS1710b_A0128"
FT   CDS_pept        156935..157345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gacA"
FT                   /locus_tag="BURPS1710b_A0128"
FT                   /product="putative response regulator receiver domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52780"
FT                   /db_xref="GOA:Q3JMB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB6"
FT                   /protein_id="ABA52780.1"
FT                   /translation="MDAREPIPSLKVFLVDYAALVRNRLTSLLETIRGVEVVGEAEDVP
FT                   AALAGILETGADVAVIELRLTGGSGLELISALTRAAPRVVKIVLTNLSGAAFRAACSDA
FT                   GADFFFDKTADVDAACRTVRTLAGAHRPRAAE"
FT   gene            157358..158137
FT                   /gene="fnrL"
FT                   /locus_tag="BURPS1710b_A0129"
FT   CDS_pept        157358..158137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnrL"
FT                   /locus_tag="BURPS1710b_A0129"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51569"
FT                   /db_xref="GOA:Q3JMB5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB5"
FT                   /protein_id="ABA51569.1"
FT                   /translation="MLQAQTQNAYTPAQQRVTVPLRAAKCDDAAKRTAARCSSCAMRSV
FT                   CMPVDLNTHEFAKLDALICSTRQVKRGDTLFRTNDGFQSIYAVRTGSFKTVVMHRDGQE
FT                   HVTGFQIVGETLGLDGVCAGHHNSDAVALEDSTVCIIPFAQLEAVCREVKPMQHHVHRL
FT                   MSGEIVRESSQMMLLGTMTAEQRVAAFLLNISERFQKRGYSAAEFNLRMTREEIGCYLG
FT                   MKLETVSRMLSKFQRDKLIAPRGKQIRIIDPVGLARV"
FT   gene            complement(158551..160269)
FT                   /locus_tag="BURPS1710b_A0130"
FT   CDS_pept        complement(158551..160269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0130"
FT                   /product="hydrolase CocE/NonD family protein subfamily"
FT                   /note="identified by match to protein family HMM PF02129;
FT                   match to protein family HMM TIGR00976"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52151"
FT                   /db_xref="GOA:Q3JMB4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB4"
FT                   /protein_id="ABA52151.1"
FT                   /translation="MRLARLIAGASVALAASFAHAGVSCRPATPAEAAVYTSPFQFPGV
FT                   SSPKDGTCWVNNQTVVATDGTRLTADVFLPKITSPDQKFPTIVMISSWAAADFFEYLGQ
FT                   QRKLAQDGYIVLAYTARGFYLSGGQVEVAGPQDVKDVSSAVDWVSANTPADPDRLAVSG
FT                   ISYGAGLSLLALAQDKRLKTAAALSGWGDLADQLYPGQSPNATWSAVLFLSGKVTGRLD
FT                   PIVDQYVKALLDPNTTQAKADEIIAWAQVRSPSTYLDALNRRGAPVFISKNFEDDMFTP
FT                   NSSMKLFSKLTVPKKLLLNPGIHAQAEIPGALVGAPNYPYDQAHRWFDRWLKGVRNGVD
FT                   TEPQVSMQIKFTNTRESFDTWPASNVHAQTLYVGPRGALRWDLSCLCTKGVSGTLQAAP
FT                   NGAAGADLIQNFSDTTATSGPIPVLSTFGESLGAPVVNQLATVNLATGVRYEGAALAQP
FT                   LHLRGAAQLNLRATPSQARAQVVAYLYDVDALGFGKLITHGARTVHWASPGVAIDFPIE
FT                   FSATAYDVPAGHHVGVVLDTFDSLYQPPVNPGERFGVKFEFDPNRQSTLVLPVRS"
FT   gene            160763..161746
FT                   /locus_tag="BURPS1710b_A0131"
FT   CDS_pept        160763..161746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0131"
FT                   /product="dioxygenase, TauD/TfdA family"
FT                   /EC_number="1.14.11.17"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52694"
FT                   /db_xref="GOA:Q3JMB3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB3"
FT                   /protein_id="ABA52694.1"
FT                   /translation="MYSGRYFFNAFNSIRNPIFDRISKITPHSDSDRSASRSNIVTTGI
FT                   RMISRKLSPALGAEIRGIDFSKPLSSQARDDVIGLLSEHQLLVFPGQCLSCEQQIAACG
FT                   AFGELEPHPMTTNTSSFPEMTIVSNVTSDGKPVGYPTPPFELWHSDLCYLEHPAKMTFF
FT                   YAESVPDAHGDTWFANMFRAYETLPDELKAAIDGKHAVFSLDSSLVKRCRKIGFDLNIA
FT                   EDDFKPTVSHPAVRTHPHTRQRSIFVNWAHTDRIEGYSPEESDEILDRIFAHCRNEDFI
FT                   YRHRYANEDLVIWDNASLIHTNSPNPPVGNRIMRRVMVSGPKPFYQ"
FT   gene            complement(161997..163259)
FT                   /locus_tag="BURPS1710b_A0132"
FT   CDS_pept        complement(161997..163259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0132"
FT                   /product="putative transport/efflux protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53596"
FT                   /db_xref="GOA:Q3JMB2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB2"
FT                   /protein_id="ABA53596.1"
FT                   /translation="MSETSKRHPSLVLILIPVVMLGQLSMDMYLPALDSLRASMRATGS
FT                   ELQLTLSAFVVSLGVSQFLVGEFARRAGRGRAIRIALVGFVGATAGCAITSSIAFFIVC
FT                   RAVQGISAAVCVALSYAVIADNAKDSHESMRGMTMLTVASTVAPLIAPVAGSQVLQLAG
FT                   SWRAVFVLLLCVASAATLAFFTQPAARFDARASDASKPARQIYLGIARSSRFWRYALLC
FT                   SIGTTINFCFFSFLPGILLVQNGLTQNAFSAAFFLCGLTEIAGSLLAPRISKRIGHPAL
FT                   TGLACACCALGGFGVAYLSTMQGAVVPIVVAFSIVELGTGMLIAPCFSAALYLFRSASN
FT                   EASAICGFQQFMIAAGVATFAAAMQWQSSYALGILIGVAALLGAALACTPAGGAAADER
FT                   ADERADERADERVARAAANPD"
FT   gene            complement(163315..164190)
FT                   /gene="pteH"
FT                   /locus_tag="BURPS1710b_A0133"
FT   CDS_pept        complement(163315..164190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pteH"
FT                   /locus_tag="BURPS1710b_A0133"
FT                   /product="putative thioesterase"
FT                   /note="identified by match to protein family HMM PF00975"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51719"
FT                   /db_xref="GOA:Q3JMB1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB1"
FT                   /protein_id="ABA51719.1"
FT                   /translation="MTSIPVRLDRFAPAADPAAPADSAAATDGAPAAAFPATAAKAAIR
FT                   TLVAPSPGGAHVLCIPWAGASIERFFAWKRHLPAGVGLSGVQLPGRGARAHEPSPTDLV
FT                   ALLDEIAAEYLALRDPPRILFGHSFGALIAFEIATRVSRAAGQAGGDPFVRLVVSGLSA
FT                   PSVIAEEERIAHLDDDAFSAQVHALNGMPPEIARSPESLRYFMTVLRCDFRLYESYAFD
FT                   ANRPPLRCPIAVCSGRDDPSVSEHGLNAWAALTTGECRRHDFDGDHFFIADHAAAMLGL
FT                   ALDAESTLAG"
FT   gene            complement(164171..165016)
FT                   /locus_tag="BURPS1710b_A0134"
FT   CDS_pept        complement(164171..165016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0134"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53567"
FT                   /db_xref="GOA:Q3JMB0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMB0"
FT                   /protein_id="ABA53567.1"
FT                   /translation="MDRAHRSPAGPVDTLLDGLIAKNAYYPRRIGGAMRVHALGDHAVV
FT                   NSGLATDTFNLVISRAADGAQANAIAPIARDFDEAGLPAAWWTCGEWSDAAFARALGEA
FT                   GFVADETSVGMLAELDALPCVAAPRGLRVRQISGADDVARFGALICALFDPPDPFVDAF
FT                   YLHVAALEIDPAEPLKLFLGEIDGCAVSTAALYLDAGTAHVFDVSTAAHARRRGYACAV
FT                   THFVLAHARDRLGAARAALQASPDGLNVYRRLGFRPVCEFRVYSNRAAVLERSHDQHPR
FT                   "
FT   gene            complement(165021..166613)
FT                   /locus_tag="BURPS1710b_A0135"
FT   CDS_pept        complement(165021..166613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0135"
FT                   /product="polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51396"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041141"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA9"
FT                   /protein_id="ABA51396.1"
FT                   /translation="MTSQYFLKKNVKIEPLVNRWHANPWLVYPPTAAYLMRHHLEIMTS
FT                   FVKHAALHEKAAASRKIRGGPFVQGLNAQDVPAMEALIETTRRDGAHLFGLADDLDALG
FT                   ATLGAADGHSLVPFYEQVPPRLRGMVELAYQAGNRAYARLMEGLYYDAYDTSALQSFAL
FT                   APLWDDSRPFCLSTPRLDTSDDVLLDIPFADPLAVALTASRRNGLTPAQFEALLDRRSK
FT                   GTRADAVAALFSDTAPPRGAADAHEPRVRYFGHACVLVQTGSENLLFDPLISYPFPGQS
FT                   PRFTFDDLPDVIDYVVITHSHHDHFVLETLLQIRDRVKTIVVPQNTHGQLMDPSLKHTA
FT                   HALGFENVIMMSEFDTLELGGGKLHAVPFLGEHGDLDIRSKLGFLVEAGDRRVLMVADS
FT                   NNLDDRLYEHVRRRYGKVDLLFIGMECEGAPVSWLYGPMLDTKLARSMDDSRRLNGSGS
FT                   SAGLRLAEIVGADRVFIYAMAQEPWLTFISSLEYDESSFAMREARKMIAACGQAGIDAC
FT                   LLNGCVDIALGAR"
FT   gene            complement(166626..169034)
FT                   /gene="epoB"
FT                   /locus_tag="BURPS1710b_A0136"
FT   CDS_pept        complement(166626..169034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epoB"
FT                   /locus_tag="BURPS1710b_A0136"
FT                   /product="polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52072"
FT                   /db_xref="GOA:Q3JMA8"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA8"
FT                   /protein_id="ABA52072.1"
FT                   /translation="MDIAIVGLSARVPGAGDADALWSLLMSGGDGLTTFEPHALTAELA
FT                   QLTDVERARYVARRGVLDGIEAFDAGFFNLSAAEATLLDPQHRVLMELVWEALEDAGAA
FT                   DCAGRRVGVFTTSGLSHYLIKHLLPDPSIGERHGQLQLLMLNDKDFLATRIAYFLNVHG
FT                   PAVNVQTGCSSSLVALHYACLSLLRRDCEMAVVGGVSIALPQQSGYVFSENMIGSRDGF
FT                   CRAFDSDASGTVRGNGACAVVLRPLADALANRDPVWAVIKGTALNNDGRDKVGFTAPSP
FT                   KWQADVIDAVYRRSGVAPDDVDFVEAHGTGTPLGDPIEARALNQVFAGARRPRYLGALK
FT                   TQIGHLDTAAGLAGLIKLCMSLRNGVIPPTAHFRTLNPRISFDDSRFTINTEPVAWPRR
FT                   DAPRYAALSSFGIGGTNAHVVVADGPADARQAGAPCDERASSAQRGPHLIVVSAKSAAS
FT                   LAALTRAYADAIAALDDAALADFAYSTRVGRRGFEHRLAVCADDRESAVARLRAARARF
FT                   SAKPIAGVSVAAADAHAVAAQLGVTPPDGASRAIDAIAARLAEWGIAIDAGSAVRLGAA
FT                   GGRLHVAAPGAPSETIDAATPGTIGCYLQAALWCAGVAVDFSREAAREAAGAVAGEIGG
FT                   EAGEKARAPARRRIRIPTYRFDRRRHWIDAPGERRGDGRDSGPGDAAAPEAAASDARPR
FT                   KPPAEQPTSLVALEAVLLSHWRSLLGLPTLRSTDNVFEQGADSLTVAQFVAQLSAERAL
FT                   PVHVVDCYSEPSVGGQARLVGARIGLGGRAAAAAQASAPAPEVERFDNL"
FT   gene            complement(169075..172551)
FT                   /gene="lgrB"
FT                   /locus_tag="BURPS1710b_A0137"
FT   CDS_pept        complement(169075..172551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgrB"
FT                   /locus_tag="BURPS1710b_A0137"
FT                   /product="putative non-ribosomal peptide
FT                   synthase/polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52535"
FT                   /db_xref="GOA:Q3JMA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA7"
FT                   /protein_id="ABA52535.1"
FT                   /translation="MTQSVFARFEQVCRSNAQAAALESAEHRLTYAQLHDRVASIGARL
FT                   AAAGVTPGTLLGIFLPRDVRLPAALLASLGSGAVYVPLTEKYPPERLREIIETHGIEHV
FT                   VTTEALASQLPASCGKIVLPAEGSETAGPRPAGERADWRPAGERARNAPVYVVFTSGST
FT                   GTPKGVLIGERNLGNLIDWYAASFSAEQRRSVLASTQITFDLSVFELICTLCTGSKVVI
FT                   VENVLQLLDEGAPCDVSLINTVPSAARELVRHRKFPAAARVVNLAGEALYQDLVDDIYE
FT                   AAPQLEQVFNLYGPSEDTTYSTGHAVPRGGASRTVSIGRSLPGKRAHILSDALTPVAPG
FT                   EVGEICLSGEGVALGYLNDATLTAEKFPTIGHGPLAGERVYRTGDLGSVDGDGLLRYLG
FT                   RADRQVKVRGVRIEPGEVEVALRSIDGIADAAVVKIVDAANNDQLVALVVAQPSCPAEH
FT                   AILDRLQALIPAFMVPSRVERIDAIPLNGNGKTDRTKLEQIAGALFGAAPPADDIQARV
FT                   AQIVAKLMSRTDVAADADFFRIGGNSLLSAQLTFMLQKQFSVTLSIADVFRHRTIGALA
FT                   AIIRERTHKAAQTAPAAAGQQPAAVRSTSGGAGAGQPVVFATPAQRGIWLLENSPGGRA
FT                   VSNAPLVFEYAGTLERALLERCVTQLLERHAILRSNYVWEDGSLRIKCNAPVPFRVETV
FT                   DLGSLAPDAQQAKARELVAREVMRPFDLRRDPMLRVTDIAFGERAGQLVFVFHHIAVDD
FT                   RALNIVFSELQRLYAAGGDPAAIGAAPARQFADYAAASREASARLGEHLDYWRHKLADY
FT                   RGATPYLVDPQAKPAARFAGRLHLHRVARHVSRQLDAAAARRGLTPFALFAAAVACIVH
FT                   RASGSDDVTIGTFFSNRDHFQDNDLVGFFVNTLPLRVRIDAGWDVDQLAQAMSATLAQA
FT                   HAHRDVTTEDVFDALQVNNALRRAAFRVMVNLEPEQAEVLTMGALSARRMLLDRHVAKY
FT                   DLLFSLRKEDGDYRVLVEYNTELYDGDVMAGVCANLDRSLAALTGTASERLDAIALPDP
FT                   LERGAPGDAAAGPADADAPAAAAADIDLREVVRDIWASEVGHRTFGDDDNFFDIGGSSL
FT                   KIMTVYEKLSNFLKRHGIEKEIDIVDLFEHVSVAALTDFLGALIEHDAIAQ"
FT   gene            complement(172591..176652)
FT                   /locus_tag="BURPS1710b_A0138"
FT   CDS_pept        complement(172591..176652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0138"
FT                   /product="TubD protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00550; match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53249"
FT                   /db_xref="GOA:Q3JMA6"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA6"
FT                   /protein_id="ABA53249.1"
FT                   /translation="MRARMRIGVAATTTKAENTAWSRKVNNLDVAIIGMSGAFPGASDV
FT                   REFWRNLEAGRCSLERYTEQELLDAGVDPAHLKSPQYVPVGGRMRDIECFDNEFFGISN
FT                   HDARLMDPQQRVFLQLAWHAFEDAGFVPGAHPGRVGVYAGVSLNSYLHTIVFRSDEVDL
FT                   DRDGQSILFGNLSDYLTTRLSYLLDLKGPSVNIQTACSTSLVAIHEACQGLLSYQADVA
FT                   LAGACSINVPNTRGYLYSQDSFFSPDGRVRAFDEQAAGTVFSNGAGLVVLKRLDDALRD
FT                   GDQIYAVLKASAVNNDGSDKVGYAAPSVSGQSAVIRDALHACEIRPEQIQYVETHGTGT
FT                   SLGDPIEIAALTQAYAGERRRGAATRHATCAIGSVKTNIGHIDVAAGVAGVIKTALALR
FT                   HKTLPASLGFEKANPRLGLESGPFYVNDRTRPWASDTPRVAAVSSFGIGGTNAHAILEE
FT                   APAREPLPAAKSAYCLTLSARTASSLEALRASYLTFLNGDDLPAFADLCFTSNVGRKPF
FT                   AHRIAIAASDAADAARQLAAAAATASDGQPHRIVVSAQADDANATWQAIRGGDIDPREP
FT                   LFEAADRFSAEERVAAYAVLLVAQLRRLGLAAALQRPAQLPQSLVERLAPRQDDPLRRL
FT                   IAEPPIEAAQSDYALTLRAACELRIGPAVRALGAPSLRGRFVAELLAAGWAAGVPVDWA
FT                   SFHADEARRKTSLPAYAFAKKVLWLSTATDAERRNRKIEDIGQWFYKPTWRETAALAAR
FT                   TRRADELADANVLVFSADRLHRLKAGWALAAQCLYVVPGAEFGQLSDDTYCIDPASEDD
FT                   YRRLIEALVARGRLPRHVVHAWLAAEAAWDGTPANFANCQALGLFSLIFFARSLNRVTV
FT                   GAAACSIVVAASQMAALTPQEAVNPDKATVLGISRTLQKEYPLIDCRVVDIASHELFDA
FT                   TDSAMQLGLEFLAPLTPDNEIVALRGGRRWRTAYQRFAVPARCEPQVRASGVYVIFGGL
FT                   GELGLNVAGYLASRAPCTLLLVNSKRFVARDEWAAWLDEHGADHPYSKKIAKIREMEQA
FT                   GATVRVQQCDVADAARVHAVLDEARERHGEIHSVIHAAGRVENGMIDNKDVRHFATVFE
FT                   AKVYGTYNLLSYLKRHPVTKVILCSSMNSIIGGLGQIDNAAANAFVDALAQTPLAASLG
FT                   DICSTNWGAVNAERLTRPNVLPQFADLSREHMRNHMTEREIAAVYDRILHWNFGPRLVI
FT                   STIDFDSVLEHWGEVSKVTELARLRHVAAEAGERAPEDDGYAYRSELHRFVETSWARIL
FT                   GVAHVDWDGVLLELGAHSLSAVQFVSMIKDRYDVSLHAMIIYEIRTLGLLVEHIETKLL
FT                   EKAAQLEVSQ"
FT   gene            complement(176573..181165)
FT                   /gene="tubF"
FT                   /locus_tag="BURPS1710b_A0139"
FT   CDS_pept        complement(176573..181165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tubF"
FT                   /locus_tag="BURPS1710b_A0139"
FT                   /product="TubF protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00550; match to protein family HMM PF00698;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53652"
FT                   /db_xref="GOA:Q3JMA5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA5"
FT                   /protein_id="ABA53652.1"
FT                   /translation="MEQVALIGSRLRLPGADTVDAFWQNVLAGRDCIDSLSDAQLLAAG
FT                   VDPAFSGLPDYVKRAGVLADVDRFDYRFFGYTFREAQAIDPQQRVLLTLAHQLLEQVGA
FT                   PGRDVGVYTSVGFPHYLLNNLSTQPPGRVALSDVVFGNSGDCASTRIAYKLDLHGPAMS
FT                   IQSGCSSALMALHNARIAILTGQCRMALVGAAAIRTPQTEGYLYQRDGVLAKDGVCRPF
FT                   DARASGTVFTNGAVVLALKALSAAQRDGDDIIGVIRGSAINNDGQRKSGYTAPSVAGQS
FT                   EAIRRAYERSGIGPETIGYVETHGTGTALGDPIEIQALKDAYGGDAGVGARARCALGST
FT                   KANIGHTDVAAGLAGVLKAALCVKHAIKPPLAGFERANPNLPLDGSPFYIPSTPEPWPN
FT                   AEGQPRRAAVSALGVGGSNAHVILEQAPQRDLSRCVDTGPLLMSAQTPHALDALDAQYD
FT                   DAFARQVLPRGDACYTSQLFRRHLPEKRAFVFDAAGRRRRVAPSGDWRHAHAALLFPGQ
FT                   GTQYAGMGRALYARGGQFRATFDDCADRFVREGCADPRELLNADDARIRDTAVLQPYLF
FT                   TLEYALGATLLAMRLPVAAAIGHSLGEYVAATLAGVFDLADAIAIVAIRARIMSRAPRG
FT                   AMLAVLAEEARVTAFLDEALSLCAVNSDTSCVVGGTEQAIDALAARLAGAGLASVRLQT
FT                   SHAFHSHLMEASSREFAAAFDGVPLRAPRFPIVSNLDGRADLPERFATAGYWVDHLRRP
FT                   VRFNDGLATLASLVPFGAWVEAGPGKSIANTLARMPLTEVACLSTMLPGSETALFDTLA
FT                   AQCWANGIEIDWTPLYGDTRGNVVPLVPHPLDEISCWIDAPAKRAVAGEAPEYEKQGDI
FT                   DQWFYEYDWAPVQPDGEAAPGHAAARAPIADSVLLIGDASRDAARLAERVAQDAESFFV
FT                   VDGAHPQALDGALATVAAQAAAKRVRISRVLIVVPSRRGGADTQADGARDESGCALDAM
FT                   LAMQRTFDALRNALPGKLDVALIALSGARGDGGEPSVASAWIDSFATVVHQEFSRVVCR
FT                   AVHVDAAPAAGEADDAAARRCTIDTLAHACLRHPGRFLRIRDGRLIERGLKRGGARAAN
FT                   AHLAPDAPDATPKSPRTVLVVGGAGNVGMIYATFFATVVGADVAIVSRRARAFADSLRD
FT                   PSAATDRALRRRKALYERMVAAGGRIMFVDADATDPRQLERAARSVADAFGSLDLVVHA
FT                   AGAPADMHYRTFDDTDVAYLDALVSPKLDVCANLHALTRSLRIARVMIVSSISATLGGI
FT                   GLYGYAASHSLLNAYAQSASSAACRWTVIDWDAWEFFKDTRDEANDDVGIDHYAISEQE
FT                   GLSVLERLHALGWPAHIVVASGDLIQRYRNWVLSERDDTPAAAQIVAPRPLLKDELVAP
FT                   RTGTEAALAKLWSECIGVEPVGVRDNFFELGGHSLIALKLVDRINQTLDWDLSAVDMFK
FT                   FPTIERLADANAAHAPGDADDAGAPHGAGHDARDDAPRPPAQPDAGAHADRRRRHYYQS
FT                   RKHSMESKSE"
FT   gene            complement(181173..185777)
FT                   /gene="acmC"
FT                   /locus_tag="BURPS1710b_A0140"
FT   CDS_pept        complement(181173..185777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acmC"
FT                   /locus_tag="BURPS1710b_A0140"
FT                   /product="putative non-ribosomal peptide/polyketide
FT                   synthase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52987"
FT                   /db_xref="GOA:Q3JMA4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA4"
FT                   /protein_id="ABA52987.1"
FT                   /translation="MLQAVNDTLPLTNSQMAMWLQWKYAPDDPAYNNPLLFELDGDIDV
FT                   ERLKDAFAAVADAHPAIRMRFIERAGVPLQYGASHSHGPLEFIDLSDVEPAARAPRIDA
FT                   AIGACLLEPFDLLTEPVYRFVLVRTRPRGYLLALNIHHICVDGASALILLEDISSAYAD
FT                   PAAYAAASAARTGEGFGDVLEVERRRWADGVHAQAETAWRAHLADRVCSVEFGKLAFDG
FT                   ERAAGGGAGQYRWTLPDTLPAKIKAVNRLTRTTPFVVLMSAFGVLLHRYLQQDALAIAY
FT                   PVDTRPAGFARIFGSFINFVPAFVDVSPDLTAGALFDKVREQRRRTKAIADFPQVDLMR
FT                   LARRTLADAALPCLNVALVPARFALDSLRFDGVRVEQRHCFTGAAKQDLALLYDGDETL
FT                   SLILEYRHGLLDEAIARRMAGDLNVIVERIVERPDLRLGDLTLSDHRAFAERYATLADA
FT                   APRTPALAAIERGWREQPERIVAGEPGNAVSARQLLDASNRVARRLAAANVKPGERVGV
FT                   RMDRGGALLAALVGIWKLGAVYVPLPTDLPGARRAHIADDAQLAACLHRAEPADPTPRD
FT                   LVLADDIFDASDAEALADFAVDPDSVAYLIYTSGSTGAPKGVEVTHRNVASFLLAMARA
FT                   LPMGRDDRLLATTTIGFDISLLELLLPPTVGAAVIACPEHVRIDAKALERVIADERVTW
FT                   LQGTPSFFNVLRAGGWRGDKRLNILCGGEPIDASTYGFLRETCAAVWQVYGPTEATIWS
FT                   TIAGPDADGVEGLGEPLRNTTIHLLDAHGQQVPRFSKGEICIGGHGVARGYRHRAALSA
FT                   ERFVHVAGAGRVYRTGDFAFRDAHDRLRFLGREDGQVKIRGFRVELGEIERQIEALGGV
FT                   RKAVVLVRRATAAEPTLIAWCEPHAGRALDADALRAALADALPAYMTPARIEPIDAWPL
FT                   NANGKIDRGALAGRASAPQAPPLEPRDSVDPLVPTLQAIYADVLRLDTVDPRATLMSLG
FT                   GHSLSAVRIIARIQQQLKVDVGLETFMANSSVIGLIGSLRASGVPADGGSGGAVAPGGD
FT                   ERSSPPEAAHAASRTSDTARRPATAEGATPAPESNAASGCAPHVSPRTLQPSASEKALY
FT                   FLDSVSAVRQTYNIPVGLHFPEGVNADALERALRHVLDTHGALRAAFEPSADGLVKRMV
FT                   PTPAGALIARHAPTDFATLVPTLNRMLLEPFELHEGPLMRAHHFPLEDGGAAVFYLFHH
FT                   IIVDGIGCGNFLRELAGAYEALVGGMEPGGDGASSGDGNDNGNDNSDGDGDGDRQTNAA
FT                   ARVDELIERFGIVDRVLNLPYRAPFPEVRTLAGDSLPLEISAGLRAELDEYSRAAGVPL
FT                   ATLLLSAFVLTLHRLSGDRTINVGLATMNRTPETLGKIGLYTNTIVLPVDIEPADRLGD
FT                   FVDRVTAALFSIYGYADVPFEEVAGRLVEYASLGRTPVFQAFFNFIDRSMYAFSMAGLP
FT                   VREIALRPTGSKFELSLEVNDFRTHTQVFFEYSKDVFDEALVGDIASEFARSLLACVRS
FT                   PGDAVERFALTTQS"
FT   gene            185972..188041
FT                   /gene="prlC"
FT                   /locus_tag="BURPS1710b_A0141"
FT   CDS_pept        185972..188041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="BURPS1710b_A0141"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="identified by match to protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53715"
FT                   /db_xref="GOA:Q3JMA3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA3"
FT                   /protein_id="ABA53715.1"
FT                   /translation="MTQITLANPLLDRSQLPRFESIRDFHVRPAIDALLIDLDNAISRA
FT                   SAKNLSPNWGNAIEPVSLALESLDYAWGAVAHLVSVRDCAPLRAAYGACAGRVSAALSR
FT                   FRQNGALLDRYRAVAASAGFRALSPERRQVVRNLIRDARLAGAELPPGPRARLNELRER
FT                   IAQLAAVYQDNIADATRAFARIVTTDEELDGIPDYARAAAARRAAAGFEFTLDFASYQP
FT                   VMQFSTCRALREEMYRARSTRASEFDAAGANDAARRDNAPVMAEILKLRREQAALLGYR
FT                   DFAQMSLEHKMARTPARARAFLERLHRRVSPKASLEWQALQSFARAELGLADVQPWDIA
FT                   FVAERMRERCFGVSTQDVRRYFPEHAVLRGLFALVETLFDIRIRADEGSVWHQDVRRYR
FT                   LETLRGEPVAHLYLDLYARDGKREGAWAASGRSRGTGADGAIRTPVAYLMCNVAAPAAG
FT                   MPACFAFDQVVTLFHEMGHCLHHMLTGVAESAISGTNGIEWDAIEFPSQFMEHFCWDPE
FT                   VVSTLSAHVDTGEPLPDAMFERMLAARHFNQGIEMAHQIALSMLDIALHSGESIESVNS
FT                   MQNTMHEIYQKYEFTPLDRRARSANTFSHIFSGGYAAAYYSYQWAQVLAADAYAAVEEA
FT                   RAEHADAGKREAGMRYRKEVLEPGGSRPALDSFVAFRGRAPSLDALLRHCRIDR"
FT   gene            188602..189306
FT                   /locus_tag="BURPS1710b_A0142"
FT   CDS_pept        188602..189306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0142"
FT                   /product="N-acyl-homoserine lactone dependent regulatory
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51570"
FT                   /db_xref="GOA:Q3JMA2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA2"
FT                   /protein_id="ABA51570.1"
FT                   /translation="MHDFLQFWLNEFSRSENPQHVISVLTRAAATLGYEYAAYGMRRPF
FT                   PISNPPILMVSNYPARWQERYIEARFANIDGAVKAALGSDRPVTWSAPANASKSAFWAE
FT                   ALSFGIAHGWSSASRGADGAIGVLTLSRTQDPIDTAEKFRNESIVHWLANVAHASMAPF
FT                   LPAADEFDPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKI
FT                   QAVAKAALMGML"
FT   gene            complement(190331..191563)
FT                   /gene="nhaS4"
FT                   /locus_tag="BURPS1710b_A0143"
FT   CDS_pept        complement(190331..191563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaS4"
FT                   /locus_tag="BURPS1710b_A0143"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52344"
FT                   /db_xref="GOA:Q3JMA1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA1"
FT                   /protein_id="ABA52344.1"
FT                   /translation="MVMWLLQLAAIIAACACFGWLAQRVGQAKVVGELAAGIVLGPAVL
FT                   GAIDSNVHAMIFGPAASSGMAQLGEVGVIALMFQIGLHMNLGGAPTLRSLRKMPPAVVV
FT                   AGIGMLLPLAGGMAIGCLSHDALAPRIAAWPYVLFCGVALSVSALPVMARIVIDMELVD
FT                   APPSLLALSAAMLTDLAGWIMLAFVSAIAVAGADAAGPSHIVAGIAAFVLLAKLAARFV
FT                   VTPLAADAAKRASPARLMSVVVPYVLVCAWATTAIGVHSAFGALLAAVMLRGVPGLQAQ
FT                   WERQMEGFVNAVLLPVFFVHSGLRVTFDSFDGASPWLWLVPFLCVAFVGKFGGAYLGAR
FT                   LCGMNRGDAALVGSLMNTRGLVELVVLSAGLQIHALSQSAYAVLLLVALTTTAMTTPFV
FT                   RLWRRAVLRPA"
FT   gene            191821..192603
FT                   /locus_tag="BURPS1710b_A0144"
FT   CDS_pept        191821..192603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53079"
FT                   /db_xref="InterPro:IPR032598"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JMA0"
FT                   /protein_id="ABA53079.1"
FT                   /translation="MTVQFRADRISYAINCLRIDHRLGRIRRTKRFVAALPLHCRRIAD
FT                   IAAGPVGVTRHVRPSLTPATMRQERRSVTFAPRRRCPRRVARAGVPACRGRRACAPARR
FT                   SFNHRRGQAMRRAPRVGRRSHVAQRLAPASSAPAAAGRDGYVRLSLPQLARVSLAPICA
FT                   AADDQILSELWDLGIGALRAGYCEWIDAHGAAPATLGWSWFVDVERIWRIVPDSLTSNL
FT                   MIISAKGYDVGPANTRQCLLNWLTKFDWRGLLVPLIHD"
FT   gene            192686..193306
FT                   /gene="bviI"
FT                   /locus_tag="BURPS1710b_A0145"
FT   CDS_pept        192686..193306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bviI"
FT                   /locus_tag="BURPS1710b_A0145"
FT                   /product="N-acylhomoserine lactone synthase"
FT                   /note="identified by match to protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53162"
FT                   /db_xref="GOA:Q3JM99"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM99"
FT                   /protein_id="ABA53162.1"
FT                   /translation="MIDTTVISAAQLDSTVKAALGNYRRAIFIEKLGWPLPLVDGLEID
FT                   QFDRPDTIYVVGKTESGDICGCARLLPTTRPYLLGEVFPDLMGDAAPPCSAHVWEISRF
FT                   SSSILSGGPDALRQAHRNTRILLAKIVRFAQAAGVKRLITVSPLAVERLLNRLKVHIHR
FT                   AGPPRLIDGKPVFACWIEVDDITLQALDIEPAADSAAGALRHS"
FT   gene            193375..194892
FT                   /gene="lgrC"
FT                   /locus_tag="BURPS1710b_A0146"
FT   CDS_pept        193375..194892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgrC"
FT                   /locus_tag="BURPS1710b_A0146"
FT                   /product="nonribosomal peptide synthetase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51303"
FT                   /db_xref="GOA:Q3JM98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM98"
FT                   /protein_id="ABA51303.1"
FT                   /translation="MTSTSVNRLFTSQARLAPEALALSSGDTRLTYGELERCANHLARR
FT                   LVDSGVRPRDRVLLCLPRSVDAVIAMLAIMKTGAAFVPVDPAYSDAIKRGYASDSGARH
FT                   ALARAADAAAFRGGALGVIDADDLSAARDDEGPEVDAGHDGETPVYVMFTSGSTGRPKG
FT                   VIVAHRGVARLVRETNYIRITREDTLLLLSPITFDASTFEIWGALLNGARLAIYEDATF
FT                   DPNAVSRLIAREQVSVMWLTAGLFHLVARRFVGMLAGLRVVLAGGDVLSAAAIGAVFDA
FT                   FPSITVINGYGPTENTTFTCCHVMTADRRPTGTVPIGRPIAGTDVRILDAALREVPDGE
FT                   EGELCASGLGVALGYLNAPDATRAAFVDCPATGSRLYRTGDRARRRADGVIEFLGRSDR
FT                   LVKIRGYRVSLDALQSVLAGIPGVEEALVKVSEEATGEKRLSAIVQSGRAEPDMKAYVR
FT                   RELAKRVPPFQIPDDIRIFPHIPLNANGKLDRHRLPVSETSTLGEKP"
FT   gene            195125..196189
FT                   /gene="syrB2"
FT                   /locus_tag="BURPS1710b_A0147"
FT   CDS_pept        195125..196189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="syrB2"
FT                   /locus_tag="BURPS1710b_A0147"
FT                   /product="CmaB"
FT                   /note="identified by match to protein family HMM PF05721;
FT                   match to protein family HMM TIGR01762"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51993"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR010092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM97"
FT                   /protein_id="ABA51993.1"
FT                   /translation="MTSDAAQRRAAACPRVAPAPAARHAHERKHKHEQAERATTRIQRN
FT                   NTMSQFKLTPDEIARFREQGYIGPFKLYSEDEARERYRQIRAQLFDREYAIYELPPNSP
FT                   IANYDRHLDVNLLSEHIMRAEIVHKLNAILGPDLICWRSEMFPKYPGDEGTDWHQADTF
FT                   AHASGKPQVVWPGDGRFGGAVTVWTAFTDCDEENGCLRFMPGTHEEMFYDESKKMTFDP
FT                   SNINALEKDGIKRGFFGYDYRSLQKDPDWKPDERNAVSIKMKPGEFVIFWSTLMHSSFP
FT                   NSTKDRTRLGYACRYVPAAVQIYPDTDTVSEYGSEVKLDKYGVVLVSGEDGFRHNRRVE
FT                   RNARGVPFVRHAGA"
FT   gene            196280..196576
FT                   /locus_tag="BURPS1710b_A0148"
FT   CDS_pept        196280..196576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52788"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM96"
FT                   /protein_id="ABA52788.1"
FT                   /translation="MTPHVEVPHVQRIDHAVLAVVRAVLDRPDAAMNDAFLSIGGSLQA
FT                   AQRVVAQLQHRLCADIAPHLLLNSACIGDFADTLARTLNGAPGDACAPPPRPA"
FT   gene            196714..196971
FT                   /gene="shiA"
FT                   /locus_tag="BURPS1710b_A0149"
FT   CDS_pept        196714..196971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shiA"
FT                   /locus_tag="BURPS1710b_A0149"
FT                   /product="shikimate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52879"
FT                   /db_xref="GOA:Q3JM95"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM95"
FT                   /protein_id="ABA52879.1"
FT                   /translation="MRASTDGAQAFVEQVEHGRRRLKLPVREALTRHPKAFVYIVALCL
FT                   AEPFTMYVVTAFALSYSTSNLGMSRDLFLNIGLLAGRRPK"
FT   gene            complement(198378..198785)
FT                   /locus_tag="BURPS1710b_A0150"
FT   CDS_pept        complement(198378..198785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM94"
FT                   /protein_id="ABA52217.1"
FT                   /translation="MRSVRAFLLDGTELGVLDAQGAWHVVPHNLTLRQEIRKAQGRKRL
FT                   RASLDARGIEKYIRGKLKQAGKTRRAASDLAQAARILAAAPIVRTPPGPVSTSMSTSAA
FT                   VAYPVISLAAPAVPQARAHPHKLKIGTGQVG"
FT   gene            complement(198993..200363)
FT                   /locus_tag="BURPS1710b_A0151"
FT   CDS_pept        complement(198993..200363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51424"
FT                   /db_xref="GOA:Q3JM93"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM93"
FT                   /protein_id="ABA51424.1"
FT                   /translation="MARRKPEFQTLDLSTWPTVAWTVFDAAERESIRARTTAIEQYACG
FT                   ATIKEIEQSTGVNRRQLYRLLERALTAHPDGRLYGFRALILHARVGDYVRLSPVKLSGE
FT                   RGSRGAVGALSQLLERFPSLAAWLQLQIKQHRVALIEIRAGGELRTRLQGLQGLHAGFL
FT                   QQCRQCGLVAADYPFNTASHAIRSLSARLKRELLSGFGTAARAAGATHLKGMPRSDDVA
FT                   APAATRPYQVVEFDGHRLDVRLKVVMPDPLGFTHEFEIERVWLLVIIDVCTRAVLGHHL
FT                   VLAREYSRYDVIKAIEAALEPHQARSFTIRELGYGPMDGYPSQRMPELAYVTWEHIKLD
FT                   NAKANLATETLAALCEFVGGQVAAGPKHSPNERPYIERFFGTIATRLSSRLPGYTGGHP
FT                   RDLRRALSDPKGNLRLFVSFDELEELVEYSIASYNGTPHTGLNNVSPLEAMESFVRG"
FT   gene            200357..200557
FT                   /locus_tag="BURPS1710b_A0152"
FT   CDS_pept        200357..200557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53657"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM92"
FT                   /protein_id="ABA53657.1"
FT                   /translation="MPSCRLGCDEARQQRQRLSTQVDRVHVPCMHEPENRRTDQRRIAD
FT                   RQLALDLEQGMRYRHENFDCA"
FT   gene            201164..201520
FT                   /gene="fhaC"
FT                   /locus_tag="BURPS1710b_A0153"
FT   CDS_pept        201164..201520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaC"
FT                   /locus_tag="BURPS1710b_A0153"
FT                   /product="outer membrane hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52918"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM91"
FT                   /protein_id="ABA52918.1"
FT                   /translation="MLYAVVASIDNSGTRATGRLQGNLSLGIDNPLGLNDIFNIGVSQD
FT                   LEFGDKRLGSHGWNGFYSIPWGYWIATLSAYTNTYYQRTAGVNQTFIASGNSKTVEFKL
FT                   NRVLSRSQNDVFGA"
FT   gene            201740..202105
FT                   /gene="fhaC"
FT                   /locus_tag="BURPS1710b_A0154"
FT   CDS_pept        201740..202105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaC"
FT                   /locus_tag="BURPS1710b_A0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52561"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM90"
FT                   /protein_id="ABA52561.1"
FT                   /translation="MAVLDANLSVPFAIAQQPFRYVTTFHGQYTGNTLYYIDDLTIGSR
FT                   YTVRGFDGETMLAAARGFYWRNELQAPIGQTGQAVYAGIDYGRVWGPQPVALVGTQLAG
FT                   AVIGVKGSLATRFGVCG"
FT   gene            complement(202482..202832)
FT                   /locus_tag="BURPS1710b_A0155"
FT   CDS_pept        complement(202482..202832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0155"
FT                   /product="yni"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51780"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM89"
FT                   /protein_id="ABA51780.1"
FT                   /translation="MFRFDEGLKVYLHRDPVDFRMGINGLSILVEQAMHLNPMISALFV
FT                   FGNRRRDRIKILGRGGNGFWLLLKRLEADRFVWPNGGDTITLSTEQLHWLLDGIDLTVI
FT                   QKHPQRYYARMS"
FT   gene            complement(203258..204109)
FT                   /locus_tag="BURPS1710b_A0156"
FT   CDS_pept        complement(203258..204109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0156"
FT                   /product="transposase B"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51417"
FT                   /db_xref="GOA:Q3JM88"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM88"
FT                   /protein_id="ABA51417.1"
FT                   /translation="MSAPARRQQVTYAKARGLSERRACALMSVARSALHYESTLAVRDA
FT                   PVLAAMSILSAQYPRYGYRRIQIFLERQDHPMSADRAWRLWRLAGLQVPRKRPRRRVSV
FT                   QRPRPQPATAARHVWAYDFVFDACANGQQLKCLTVIDEYTRECLAIDVAGSIRSGRVIE
FT                   VLSQLVSLHGAPRYLRSDNGPEFVSRATLKWAAQNGMDMALSDPGKPWQNGADESFNGK
FT                   FRDECLSLEWFRTRTEAKVVIEQWRRHYNAIRPHSSLAYLTPDEFKQRYCSTEATEAVL
FT                   QD"
FT   gene            complement(204106..204369)
FT                   /locus_tag="BURPS1710b_A0157"
FT   CDS_pept        complement(204106..204369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0157"
FT                   /product="transposase A"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53276"
FT                   /db_xref="GOA:Q3JM87"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM87"
FT                   /protein_id="ABA53276.1"
FT                   /translation="MKKSRFTEEQMVTILREADKAPVAEVAKKHGVSEQTIYNWRQHFG
FT                   GLEAADVKRLKQLEQENARLKKMLAERDLELDVMKEINAKKW"
FT   gene            complement(204570..204737)
FT                   /locus_tag="BURPS1710b_A0158"
FT   CDS_pept        complement(204570..204737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM86"
FT                   /protein_id="ABA52837.1"
FT                   /translation="MFRLSQKPSSRMGMKKAFVSVLPPADASISFKGYRFPPDVISYAV
FT                   WLYYRFPQSR"
FT   gene            complement(204784..212037)
FT                   /gene="tcdB2"
FT                   /locus_tag="BURPS1710b_A0159"
FT   CDS_pept        complement(204784..212037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcdB2"
FT                   /locus_tag="BURPS1710b_A0159"
FT                   /product="Insecticidal toxin complex protein TcdB2"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF03534; match to protein
FT                   family HMM PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52082"
FT                   /db_xref="GOA:Q3JM85"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM85"
FT                   /protein_id="ABA52082.1"
FT                   /translation="MSPLPTTTPTPPLQVVTAAFPKGGGALPGLGQTLSPSGMSGAAQL
FT                   SIALPLPPVRLAPALALTYHSQQGNGPFGLGVALTLPTLARQTSRGTPSYADGRDVFVF
FT                   EGDELVPDAAGPTEVDNERLTRYHMRHEGRFDYLELHQPLTPADAPAPAWWRVWRADGR
FT                   CEVFGRCAAARTAVPGNPAQVLEWHLEETVSPHGEHVYYSYAPREAEAARTQLACLKQV
FT                   RFGNVRADPAPWSTAQGFDPATERWLFALVFDYGEHADTPQGPAWAASRPWRRRADPFS
FT                   RFDGGFELRCERLCQRIVLFHQLAALGAEPVAVRALQLSHTETAYLTQLTGVRQHGYRQ
FT                   TGGALEQAALPPLALEYTRFDLGRADFRALEAGLVGLNAGFYQVVDLYGEGVPGILYND
FT                   GQSYRYRRAKNVKRGDQGLDVEYEAAQSLSVPGGEMSAAALMDITGDGILDAVRTEPGM
FT                   AGFFTRDGDKGWQRFIPFAAFPSEFLHPRALLADLSGDGLADLALIGPSSVRLFVNRGH
FT                   DGFAPPRQIDHLGPDRLPVPPGGGQTLTAFADVLGSGQPHLVRVRHNEVTCWPNLGQGR
FT                   FGAPRTLRLRLDPAITAANFDPARVWLADLDGSGAADLLYLDHRTLYVHRNQCGNRFAR
FT                   AQTLSLPAALQYTDLHQVSVADLYGNGTSVLIISRLHPQPAHWVCDFSRGLKPYLLAGL
FT                   NDNMGAQTRLTYASSAHEWLDERRADSQARCRLPFPVSVLKRLEQVDEINHNTLEQTLQ
FT                   YRQGYYDGEERQFRGFGLILSTDMPSPLGAAQRDAAGTPYIPALQTRTWYYTGDPDSPG
FT                   AVDGNVGGSSYNGDPLAAALSPLRIERRDGQAIPLPPGTPERRVLLRALRGRVRREEVY
FT                   GLNPTTGQPQATPFRVMSLRYCVREWQPATASGVPAVLLAFVLESLDYNYDQVSTDPQW
FT                   QQTVALAVDTYGMVTKTVSLHYPRRAQVMPPIMPLPEAAHCSDAQQDTFLVTETRIRVT
FT                   HLQEPKPNRAGWRLGLPVENRDEMLGRVAPPTSANRVYSYEELTKADGPLASATRTLAR
FT                   WQQQIYADPSTGDPLPLAQATREGLVCQVRTAALSQAELRRSFEGLIPSQQLEPLLTQL
FT                   EDELVNQAGFVQGTAEDDKDYFWNPGLTATFADLAGFYTVRYHTDPFGNRTTYERDALT
FT                   LAPTLLSNARFTAAWIDYDPWSLLPAQITDANGTVHEVSYDPFGRVHLSALKGSERAFT
FT                   DSLGEARVGFGPLAGYRSSVKTVEAALRDPTGALGNAAQAYFHADHSWMGALTEAGLRA
FT                   AGLPDSEVQAVWQILLQQRLITVEGYVQARLHQLAKAGTPVPGLSDTQSAAVHRAVAAV
FT                   SRVPVHAATLSAERYRDEHADDPVPRPTDPVIRIALAYVDGFGRPLQGKIKAEGGLSAI
FT                   VEDDGKLKLDTSGRPLQERSEERWLTQGHVVYNAKGLPRQQYQPYYLNRPVHLTDPKLD
FT                   QLSASDTLYYDAPGRLAQLTKADGNRRTSQYRPWYRIETDEMGAPVATVHDGRGLAVRT
FT                   VQRPPPGAATADKVRITRHAYDAAGRLVSSSDPRFFDRQQAGETTLAGNERYRYGLSGS
FT                   AVTRESRDAGWQVDLLDAGGALWRSYTARDHQWRREYDALRRLSAVWLASGMSRTERCT
FT                   ERLRYGDDAGIDAVTARRANLRGRLVSHYDPAGLREITSYSLGGMIREEQRRFLQQRDW
FT                   SSDWPATPGAAAAHLEEQIETSRWQCTALGDELMLLDAAGHRHRCAWHVSGRPSGSWLQ
FT                   LSGGAEQAVVSELSYTADHQLLHEQAGNGVTSDFEYDPQTRRLSRAQTTRTASGRAATV
FT                   LQDLRYTYDRVGNVTQLADQATRVRYFRNQRVAAVRTYQYDWLYQLVRATGREQANAGQ
FT                   EGVALPPVGNPDALVNYTRTFAYDAAGNLTRTVHRGATRYVLALAVSRSSNRAVAGRRV
FT                   GADDVEAQFDAQGNPHRLGSNQPLTWSADNRLSRAVQLPRTGGEDDSEAYGYGGDGQRV
FT                   RKWSSQQAGAVTHRREVRYLPGLERRTNTATGEVLEVVSSAVAGRTAMRCLHWRASRPG
FT                   GLDNDMRRYSVNDHLGSSGLELDQSGQRLSAEEYYPYGGTAVWLPKSQVEGNYKFVRHA
FT                   GKERDVSGLYDYGYRHYAPWLARWLNPDPAGTVDGLNLYRMVRNNPVTFIDRDGIAATR
FT                   LNWLDLAPAPSPAAVAVASRKLDSRHTSFPPTTGLIQNVKVKNEALIGQVLASHLEASR
FT                   GLSAPIEAKKFPQLELPPDMIFRLGRIDEDSYLLFPTAAGKVQKIPYGTLSYVIRYEDP
FT                   LSIYVFEHSELAERKDLTEKVIPRLANYGHSSLTYKEDKPNMFDRSIPKAERFRQSAKP
FT                   VLLAGNLNFEMAEYPQLGAGRLISWSVESGHFQPTDKDAVKNRIGFIQQLLPIGKFNRI
FT                   DWEEKRKQIQRP"
FT   gene            complement(212267..215125)
FT                   /gene="tccC4"
FT                   /locus_tag="BURPS1710b_A0160"
FT   CDS_pept        complement(212267..215125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tccC4"
FT                   /locus_tag="BURPS1710b_A0160"
FT                   /product="TccC4"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53494"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM84"
FT                   /protein_id="ABA53494.1"
FT                   /translation="MFSTPDMSLHAGTPSMTVMDARALVVRRIACHRAVAGEAPDLRIT
FT                   RQYYDVLGRLRHSYDPRLGEMAPLPVPNFIKYHDLSGAVLRAESVDAGCSALLLDIEGR
FT                   PVYMMSATGMIRRYQYEAPDLPGRLLAVSEQAPGAVTRVIERYHWAGTSAPEQDENLAG
FT                   QCIRHYDTAGVIELQRCSLHGATLTLSRRLLRDAWEVNWSGEDESVWLPALENMRYGSC
FT                   STVDATAMRITHIDARGNVQRWGYDVAGQIKGAWVQLAGQEERVILASLSYSAAGQKLC
FT                   EVHGNGVITEYRYEPETQRLVGMRSARASGHAAGARVLLDLRYTYDPVGNVLSERNEAQ
FT                   PVLFWRNQRVEPENTYRYDSLYQLIEASGRELAQRGQQGSALPRPVTPLPAHLGVYSNY
FT                   RRTYRYDHAGNLVQIRHSDPATNNSYTTDITVSRRSNRAVLAQEGLLPEAVDTCFDAGG
FT                   HQLVLLPGQALTWNGRGELEQVVPVSREGGDDREWYSYGGDGMRVQKVNERKASGSTRQ
FT                   QRVVYLPELEVHRTLNGASLCEALQVLTVSQSGQVQARLLHWETGRPAGLDNDGVRYSY
FT                   GNQLGSSMLELDDAGELISQEEYYPYGGTSIWCARSQMEADYKAIRYSGKERDATGLYY
FT                   YGFRYYQPWVGRWLSADPAGPVDGLNLFCMVGNNPITYTDMEGNARYVFPAFADDDLIM
FT                   MLAAHNAQRRLVAKQGDVPVFLTEKERIRFMRKLEGFIVNSNKFKELFDFGKRHIDEVG
FT                   YDVTPESFDRLNLRKISTQMTDLEKIREGSLSVSLYDSLVNIYIEGKSEERDRVFQNIQ
FT                   GGDKLYVLGHGKADYAGLEGAAEGGKALTFKKLARNFRKANLPDVNMKIALFSCESGNF
FT                   GISEIDREEGAGVKPKFITPAQALLNELKDKGYRNLMTVGYRGNVMNLGFFRDPTYHHQ
FT                   QVLGEGNARVFTRSSQSKKVFH"
FT   gene            complement(215181..219638)
FT                   /gene="tcdB1"
FT                   /locus_tag="BURPS1710b_A0161"
FT   CDS_pept        complement(215181..219638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcdB1"
FT                   /locus_tag="BURPS1710b_A0161"
FT                   /product="TcdB1"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF03534"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52036"
FT                   /db_xref="GOA:Q3JM83"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM83"
FT                   /protein_id="ABA52036.1"
FT                   /translation="MRTPEEPSGLRQGPLSLPSGGGSIRGMGQTLSAIGPDGMAEMSLP
FT                   LPMSAGRGYAPALGLTYSSGAGNGPFGIGWQMGTMSIRRRTSHGTPRYDSTDSFLGPDG
FT                   EVLLVASDTEGQPDVRSANALQGVILDTRHTITRYQPRTERNFSKIEHWQPSDDTGAGF
FT                   WLIRSADGQVHILGKTAQARISAPGNSTHVAQWLLEESMSAGGEHVYYEYYAEDDVGCS
FT                   AAEKHAHPDTSAQRYLAIVHYGNIHPSDCLFVLSDTAPSSAGWLFVLVFDYGERAASID
FT                   AVPKFASSQPWLSRTDPFSRYEFGFEVRTRRLCRQVLAFHRLQTLAGVANGDDVPALVH
FT                   RMVLQYDENPVVSMLVACRVLGHELDGRPVPMPPLEIDYQRFTPTAIWQPMRELENFDL
FT                   PQRWQLVDLFGDGLAGVLYKDDHAWCYCAPQRQEGGAPDAITWRKSHMLPQIPVLNGMD
FT                   TATLIDVNGDGRLEWLVTHPGLQGYHRVLPEGKWTHFTPLTALPVEYFHPRAQLADLMG
FT                   AGFSDLVLIGPKSVRLYANERDGWTQGQTVIQSDGITLPIPGADACKLVAFSDVLGSGQ
FT                   PHLVEISADGVTCWPNLGLGRLGVPLKLPGFNQPTETFDPGRVFLADLDGSGAVDLIYA
FT                   HSDHLQIYTNQSGNGFAAPQSLSLPDGARFDDTCLLQAADIQGLGVVSLVLTIPHPTPH
FT                   HWRCDLSRNKPWLMSDVCNNMGAHTTLYYRSSVQFWLDEKAAANVDTPPVTNLPFPIHT
FT                   LCRKELLDEITGNRLVTNMRFAHGVWDGNEREFRGFGRVEQFDTDMRACGDVSQRTAPS
FT                   LTRSWFATGMPTVDERLADEFWHGDAQAFAGFSPRFTIWDTASGHDEPLTPSESARYWL
FT                   SRAMKGQLLRSEVYGLDETGSEGIPYTVTESRLQLRLIASAETEQPAAWPSVVEIRSYQ
FT                   YERIGSDPQCSQQVQLALDAFGFPLQSVAIAYPRRPKPVDNPYPETLPDALLDNSYDAQ
FT                   QASVTLVRRTTRYHHLTSGETWRLGLPDCERSDVFTYESTRVPADGFSLEKLSGSESLI
FT                   GAGRPFAFAGQQQVHYTMCQSEEPIAFPTSQALVAFTETAMLDDAALLAYDGVVAPEDL
FT                   GPLLLECGYLRVPRLLGDGAENAVWAARRGYTDYGGAQQFWRPLRQRASLLTGVTTLTW
FT                   DPHYCVVAGTRDAAGLTMQAAFDWRFLLPFKVTDSNNNQHHGALDALGRLVSRRFWGTE
FT                   GGLPAGYSAPEDAPFTAPSSVDEALALTPGIPVAECFVIVPDSWMPNLSESQVSELDGE
FT                   DASLWRDLRIAGVVSEDNRVCALARRRWKQQGTALDSWLAQAQRVPPHTLTLTTDRYDT
FT                   DLAQQLRQQVTFSDGFGRVLQSSVRHEAGDAWQLAEDGSLVTGATGVPITAYSDFRWAV
FT                   TGRVEYDNKGQVMRVYQPYFLNDWRYVRDDHARADAFADRQDYDPMGRLIRVVTAKGYL
FT                   RRTQYYPWFVVKEDENDTEALEQR"
FT   gene            complement(219726..222695)
FT                   /gene="tccC3"
FT                   /locus_tag="BURPS1710b_A0162"
FT   CDS_pept        complement(219726..222695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tccC3"
FT                   /locus_tag="BURPS1710b_A0162"
FT                   /product="TccC3"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52023"
FT                   /db_xref="GOA:Q3JM82"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM82"
FT                   /protein_id="ABA52023.1"
FT                   /translation="MATTTISELATAQRCRDTPTLSVFDNRGLQVRTVRYNRSAVDEAP
FT                   DELITRQTWSPRGDPASTIDARLFDEQRQNPAILPNLRYTSSLSGRPLAILSQDAGERL
FT                   SLCDAEGGLVLQRDGRGQQLSRIYDTLHRLVAVTEQAEDGAVRVSERLVYGDAAPPNGA
FT                   NLCGRLRQHYTAAGLNVIPAYSLAGQPLSNQQQFLRDDRLDSDWAGDDPAAWGRDLLPD
FT                   TYTSRWAYDAYGREIERTDARGNLQRLHYNIAGQLAASDLRLDGQTNWQPLLRAITYSA
FT                   AGQVQHEEAGNGVVTDYTYEPQTQRLAELRTTRAAQTGRSPVVQALAYQYDPVGNLLAI
FT                   DDAAQTTRHTRNQRVAPASGYTYDALYQLTRATGRENANAGRQSQALPPAIVPLFQETD
FT                   ALTNYTRTYRYDRGTNLIEIHHQGTTPYTQQMVVARTSNRAVPQTDGLTPGDVNSYFDA
FT                   CGNLRELGPGQPLTWDSRNQLQRTAQIVRRGADDDYERYWYDGAGQRATKLNSARTSGT
FT                   TRIERVRYLPGLELRQTEQARDGEESATPLEILQVLTLGAAGRQSVRVLHWERGRPETI
FT                   ENDQLRYSLGDQVGSSMIELDAQADLLTREEYYPYGGTAVWSARSDIEAKYKYVRYSDQ
FT                   ERDATGLYYYGFRYYAPWLARWINPDPVGPIDGLNLFCMVGNNPVTRKDVGGLAREEEQ
FT                   PLLQLPTQNAGRSLSNLASGAQSGIRRTGRQIRAQFIPSERSEPYVVFENGVYGSTTEQ
FT                   VEVRHSGISRLAGALRTRVTSALTSLIPRPRERAPETIPLLDIAPETSRGSIYTALRPA
FT                   ESERAVRPRSSGYRRLSEPPSSRLAEEAARLLNPQSASPGGQGAEIELNTLSRENAGWE
FT                   EAISRAHQILGQAPATLNPNEFELVHPADINEINMMLGEMEVLNIAEALYQITSEGPTS
FT                   LLESALEATPLLGEERARGRMDPWSFVSFTWWASPFLSSAFAFSFFGFSWAINARRSGL
FT                   "
FT   gene            complement(222719..230272)
FT                   /gene="tcdA4"
FT                   /locus_tag="BURPS1710b_A0163"
FT   CDS_pept        complement(222719..230272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcdA4"
FT                   /locus_tag="BURPS1710b_A0163"
FT                   /product="TcdA4"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52604"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="InterPro:IPR041079"
FT                   /db_xref="InterPro:IPR041568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM81"
FT                   /protein_id="ABA52604.1"
FT                   /translation="MNTQTLSRLQSSIEPLGIKTLIEIALFSFDEFRNKVRDVLSWHET
FT                   RVMYRAAQRSLNESKLYEALLLSRSNPQLSQAVGLAIAPPRVQLHDYESMLGQRASQYV
FT                   APGSVASMFSPAAYLTEMYREARALHYANFPYHLDVRRPDLAALGLSQRNLDESVSTLD
FT                   LSNEILQAAIRAHDTSLTGDESVPQRLATWRAQGATPFNEAFEQVRRALLTLDPEGKHE
FT                   GTAPDVAGLMSAASRLGIRAGISPELHAILTEAVPDESADQEFERNFGNVSVNELLNVR
FT                   ALAQYYDISDDLCSEFIENYALKGYRQNRTNTLSRLAYPKMDQAGNLSLLHVTRFYASA
FT                   ESSFVHYIELIPARYSHNFELLRFSFASVPSTAAKLEVFTSVNATRWQSIFVDEQFNDG
FT                   KSDQEYRLPINIEIPGDWQNIQVSLNCYDSSGRLLITPNAGFIPGRNLDKNVLLEINKS
FT                   IRAHKATGLAPAAVDAVAASVHADWTMDEAAVRRMLEMQSSMQRNAIDYDRALCLCNGD
FT                   ISRLRFGGQSGQFDRLFNSPPLNGYVFGTGGPRIDLKPDSSGDDLRKAVLKRAFQVDDV
FT                   ALYRLLLVADPGNKDGTIPNDLAHLSALYRAHLLADVHRLSVDDLALLMAGLGEAATGL
FT                   IGISDEALFGLLHRLRTAVRWLNDMKWNPYDLFVMTTTVYADTLTPDIGNLLEALNNGL
FT                   PDADLNDGELIEAMAPYVAASLRLTSNEVACAVLLWLDQLQPNGMGVDAFWAAVANHAP
FT                   PPAAAIQFCHALAQLALVYQATGLDANSFRRLVEQPDSLVTLPEGATVAGHDARTLMQL
FT                   TAYAEWVGRLAGNAATVLSAFEVDALTPAQLAQAMALDEQLLRQAGKQAAQHEQIEDSE
FT                   LLHTWPEIDVVMQWINLANGLGVAPKGVADWLALDYMRPADAAVLAYPEWERVATSFVA
FT                   ALPADQADTVAGTVAESLAATLAGYYLAEVADPTLNLRTRDDLYSYLLIDNQVSPQIKT
FT                   TRIAEAMASIQLYVHRALSRSEPQVLTAVSSRQYFADWETYNKRYSTWAGVSQLVYYPE
FT                   NYIDPTLRIGQTGMMNNLLQSVNQAYLTADTVDDAFNIYLTAFEQVANLDVVSAYHDNV
FT                   NVDQGLTYFVGSNRSSEAEFSWRSVDHNKCHDGQFAANAWSEWRAINCALKPYHGVIRP
FT                   VVRNTRLHLVWLERTERAEAKAEGEDVFNEVTYQYWLKLAYLRYDGTWSAPLTYEVTTT
FT                   LAKLQLANDEAPGLYCAESPTHQSLLVLFYKVQAAAAAAPAAGLVILQDLSSRELTSEQ
FT                   SRYYRDNVHAQFDTPNRRRVNNRYGEHYQIPNSVTVNSGFEWGAHQISRAFGGRIVGIM
FT                   YEASLEKLYIQCNISVDVVFDVTKDVNGMAYLHLYTLQRRATPGAMVTLFNEADPCFGM
FT                   IWQHGASHLSLTSHEDYVFPPSDYYHGEPRIGVGIGASYGVAFDNYMGAGGYDIFSGGD
FT                   VKRFSSIQVFKEVMGQYTIYKNSAILNTIDLNTSLPLDKVDVIVDEGEGVKFRAIDYVK
FT                   HAPEPSLRRMSFPFEKLTIDASRLVYVDNKASVDISCEARFADGQLAGREFFSIPVVRV
FT                   VEGTSNVLSLHREDSGAQYMQWGAYRVRLNTLFARQLIERAAVGLDRILTLGTQYLAEP
FT                   PLGEGGYVKVTLPAYNPTLHGSTRGVRLVLRSGTASASTEFAFLNASLTDIVQHHMLFV
FT                   PVSQVRAGDALDFPADLSTGLGVVLACQRGQFKAGQLRFDPATLKPTDFVKDSGWTSGR
FT                   DADVQIDPIYIEPMDFGGANALYFWELFYYTPMLVAQRLLVEQRFDEAQRWLQYVWNPA
FT                   GYVVEGLLQDYQWNVRPLEEDLGWNAESLDSTDPDAIAQVDPMHYKVATFMRWLDLLLA
FT                   RGDRAYRQLERDTLSEAKMWYVQALQLLGEQPYLPRAAEWSEPSLAAAADETAQLARLQ
FT                   ALEALSAGGQPAPLTANSLTALFLPQANDVLQGYWRTLEQRLYNLRHNLSIDGQPLSLA
FT                   PYATPANPKALQSAAVSASSGGKPLPPSYLTLWRFPQMLENAKSTVSQLMQFGSNLQGI
FT                   IERQDAEALSELLQNQAKDLVLISLSEQDQRLAEVDSSILALTEAMEAATQRRNHYTKL
FT                   YDENINSGEQAVLGLRASSSAITATATALQMAGALAEMVPNIFGFSIGGSRWGAALNAS
FT                   AFGAQVSAAVTMITADQLSQSEMYRRRREEWDIQAKNAQADVDQIKAQQTTLRHQWEAA
FT                   MLQRDYLQRQQEQTEAQLEFLKIKSSSKALYSWMRGRLLAIYSQFSDLAVARCVMAEQA
FT                   FQWETHKVDSFIKRGAWQDAYYGLLCGEELMRNLAEMEAAYLIQDARALEVVRTVSLAD
FT                   FYAGLPDDKQFDLAEKVVTFIEEKGGRAGSDANSLLLENGRLSATVTLRDLKLVDDYPA
FT                   NMQLGSLRRIKQLSVSLPALIGPYQDIQAVLSYGGSIVLPRGCEALAVSRGLDDSGQFE
FT                   LNFNDGRFLPFEGIPVDDVGTLTLAFPNALGKQEAMLRTLNDIVLHIRYTILR"
FT   gene            232157..232612
FT                   /gene="toxR"
FT                   /locus_tag="BURPS1710b_A0164"
FT   CDS_pept        232157..232612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="toxR"
FT                   /locus_tag="BURPS1710b_A0164"
FT                   /product="transcriptional regulatory component of sensory
FT                   transduction system"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53209"
FT                   /db_xref="GOA:Q3JM80"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM80"
FT                   /protein_id="ABA53209.1"
FT                   /translation="MEASGHVREPMITRNESTGRTNDTPPSLSNITISELFNYSYKRRF
FT                   LIANSIDFDPKTGKLHIASSPDAIPLTSLSARLLSIFCTFPGNIIDRDIIMEILWASRG
FT                   MIVTDNTLTKAISHLRIKLNVANKDIKFISTLNRIGYIFVADVTPID"
FT   gene            complement(232772..233410)
FT                   /gene="tnp17"
FT                   /locus_tag="BURPS1710b_A0165"
FT   CDS_pept        complement(232772..233410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp17"
FT                   /locus_tag="BURPS1710b_A0165"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51791"
FT                   /db_xref="GOA:Q3JM79"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM79"
FT                   /protein_id="ABA51791.1"
FT                   /translation="MGSRHGVKARQVRQHVWLRRIELPAGIGQSVAATCLVAREFDAPS
FT                   GVKPIEWRLLTNREATTLPEAIELIDWYRARWEIEILFNVLKNGCRVEALQLGTIERLE
FT                   RALALLLVVAWRITHLMRLGRSCPDLDAELFFDADEIRGAYLLTDVKQSVQSKLNEVLR
FT                   LIARLGGFLGCKGDGEPGAKAIWLGLKEVHVAAKTLQKLRAGGHADNCV"
FT   gene            233826..234089
FT                   /gene="tISRso14a"
FT                   /locus_tag="BURPS1710b_A0166"
FT   CDS_pept        233826..234089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tISRso14a"
FT                   /locus_tag="BURPS1710b_A0166"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51826"
FT                   /db_xref="GOA:Q3JM78"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM78"
FT                   /protein_id="ABA51826.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            234113..234946
FT                   /locus_tag="BURPS1710b_A0167"
FT   CDS_pept        234113..234946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0167"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52399"
FT                   /db_xref="GOA:Q3JM77"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM77"
FT                   /protein_id="ABA52399.1"
FT                   /translation="MLAIREKVNISELRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTQANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(235411..235722)
FT                   /gene="tnp"
FT                   /locus_tag="BURPS1710b_A0168"
FT   CDS_pept        complement(235411..235722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="BURPS1710b_A0168"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52858"
FT                   /db_xref="GOA:Q3JM76"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM76"
FT                   /protein_id="ABA52858.1"
FT                   /translation="MYRLEVSHRWTSSVRVTEAVIDKACEWQQRPLEFMYPVVFLDALR
FT                   VKIRNEGAVRNKAMYLALGVRRDGTRDVLGLWIGQTEGAKFRLRIVNDLKLRVVCATF"
FT   gene            238891..239532
FT                   /locus_tag="BURPS1710b_A0169"
FT   CDS_pept        238891..239532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0169"
FT                   /product="sigma-54 dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51496"
FT                   /db_xref="GOA:Q3JM75"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM75"
FT                   /protein_id="ABA51496.1"
FT                   /translation="MVVSSSAMQALFRTISKVAKSDASVFIFCEYGTGKELTATEIHKR
FT                   SGRADSPFVVINCDAIPPQLLQSELFGYERGAFTGATHRKIGRLEEADGGTLFLDEIGD
FT                   MQLESQVNLLRFLEERKLQRLGGRDSIMIGARIISATHCDIEQMIREGRFRSDLYHRLY
FT                   VLSIKEPPLHERDQDIELLAWHMLDRYKNDPGRRLHGLSADAVRALHSYD"
FT   gene            complement(239795..240478)
FT                   /locus_tag="BURPS1710b_A0170"
FT   CDS_pept        complement(239795..240478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0170"
FT                   /product="transposase B"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53250"
FT                   /db_xref="GOA:Q3JM74"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM74"
FT                   /protein_id="ABA53250.1"
FT                   /translation="MAAAQEVPRFGYRRMSAWLAPGESRVRRMWRALQLNIPRRRSRRR
FT                   RCGNDIRLPGATHPNSVWSYDFVHDQLVDGRALKMLCVIDEYTRECLAIEVGASLRSQD
FT                   VILTLSRLMRLYGKPAFVRSDNGAECTAAKVMRWLRDAAIGPAFIAPGSPWQNGFVESF
FT                   NGKLRDELLNREWFRSRAEAKVLIERWRQFYNERRPHSAHRYQPPATVRRAWLDSDNID
FT                   ARLTA"
FT   gene            complement(241315..242073)
FT                   /locus_tag="BURPS1710b_A0171"
FT   CDS_pept        complement(241315..242073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM73"
FT                   /protein_id="ABA52772.1"
FT                   /translation="MSEDLGRNVDNVRVNVGRGGFDSGYGWGCGPGGYGGGLAAAVGAA
FT                   IGAALFRRFGFGDGDGGAAVNQLTDDMLLSKLGNIEGQIGISTGQIQNGLLQQTLALNG
FT                   SLSGVKDAVTNSGFMNLQATNGVAQAVQSVGCSIKEAVRGDGEATRALISAQFQAQQSE
FT                   KINALAAEVIELRNEGRMQKQTHDINLNVTNLQNQISNQAQANTQVTLDRLATGLAALT
FT                   SQVSRQSEVIFNSGTMAASGNQRLSQTNVG"
FT   gene            242924..243298
FT                   /locus_tag="BURPS1710b_A0173"
FT   CDS_pept        242924..243298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0173"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM72"
FT                   /protein_id="ABA51648.1"
FT                   /translation="MLLGTGLKDYGEGCKDVADGDILTDLLDQIRPVERLDAVGGDGTY
FT                   DTKSCDAAITARGAASSISPREGAARLRAAAPGSAWRNEAVYAIAKLGRREGKKHRGSR
FT                   RWLLAAKAMDRLKMLPGKHP"
FT   gene            complement(243007..243171)
FT                   /locus_tag="BURPS1710b_A0172"
FT   CDS_pept        complement(243007..243171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM71"
FT                   /protein_id="ABA52064.1"
FT                   /translation="MRHAEPGAAALKRAAPSRGEMLDAAPRAVIAASHDFVSYVPSPPT
FT                   ASSRSTGRI"
FT   gene            complement(244606..244830)
FT                   /locus_tag="BURPS1710b_A0174"
FT   CDS_pept        complement(244606..244830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0174"
FT                   /product="IS1478 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53122"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM70"
FT                   /protein_id="ABA53122.1"
FT                   /translation="MSLMPLLAHRDSEGRAAEDVDLFGPTVQLAGAGRNAADRPRLSIR
FT                   LMVGQLYLKHAYNESDESVCERWAENNYW"
FT   gene            244979..249565
FT                   /gene="tcaC"
FT                   /locus_tag="BURPS1710b_A0175"
FT   CDS_pept        244979..249565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcaC"
FT                   /locus_tag="BURPS1710b_A0175"
FT                   /product="YO185-like protein"
FT                   /note="identified by match to protein family HMM PF03534"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52281"
FT                   /db_xref="GOA:Q3JM69"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM69"
FT                   /protein_id="ABA52281.1"
FT                   /translation="MTQHTGSATVVPPSLPKGGGTLRGMGESLGEAGITGQAGLSVPLP
FT                   VSAGRGYAPSLSLEYSSDRGNSAFSLGWQVPLLTISRDTRSGAPRYGEQDAFLAPNGEV
FT                   LVPERDDQNRLVSRSVSAYGALTLDQTYTVTRYLPSVTQEFERIERWQGPLPDDFFWLI
FT                   HSVDGQLHCLGKHAAARVADPTAAHARIGRWLLEESVSPTGEHICYQYEADDTTNVDLN
FT                   GAEASRLHTASRYLTEVRYGNREGYAPLYAWDDPKALRPEWLFSLVFDYGQRTLDAHTV
FT                   PGRDPSLPWPCRADAFSDYSLGFEVRMHRLCHQVLMFHHFPDELTEPNTLVRRLLLTYD
FT                   QTPYVSQLILAQMLAYERDGTMRSMPPLELTYTPFAPVLSADGYQPLPAFAGWNDGRPY
FT                   QLVDLYGEGLPGILYKEGSDWRYQAPQRDPHALPDGIIYGPWKGLPSLPALQPETRRLL
FT                   MDLTSNGQLDWIIMQPALNGYFTLGPDRQWSHFVPLPALPTEFFHPATQFVDTQGGGLM
FT                   DLALISPNSVRIYPNGREAGFGNSFTVAQSAAAPLPVSRDPAALVAFSDVLGSGQQHLV
FT                   RIRHDCLECWPNLGGGHFGAPLRLASLSFDARTFNPDRVFLADLDGSGAADLVYVESDC
FT                   IRIFLNRCGNGFDTEPRVLPLPATVRFDRVSQISFADVEGTGTSDMVVSVVGPEPRHWR
FT                   FAFAASKPYLLRTVCNNLGATTTLSFRSSAQEWLDQKQEDPASECGLPFSLPVLSRTVI
FT                   KDEITGNTLTDLYRYRNGVYAGREREFRGFGQIEHIDAASAIDVTTQGLIYATPTLTRQ
FT                   WYHTGQEHGATEGVPAPYQDDVLFTLGATRFTRLDSRSGFDEPLSNDVLATVQAQLWRA
FT                   LKGCPIRTETYNALDEREHAVPFTVQAWRYQVRLVQSAATAGADCVSLPMPLEELNVNY
FT                   ERIAHDPTVKHSIAVQVDSYGVPLRSVTVNYPRRPKPAANPYAPDLPDAWWQASHDDTQ
FT                   FALRLNETRQRVHHLDDPQVWRLCLPFEQRQNVITDPSGRDAYYPASKTGLSHEALREP
FT                   NGVLGTAQTRVLAGQHVTYYFDRNGVEAQPVDTLPPPLALVHHVEVAELDETALAALDT
FT                   LPNLEAMLDQAGYRRASTVLVDPGANEASVWVVPRGYATYVDQAGRWLPFYRPRSTQSS
FT                   RIMGAQQFTYDLHTCVVRSVTDALGNRVTAQHDYRFLEPSQLTDPNGNVQEVRFDAFGR
FT                   VIASSVHGSELDELGTPRAVGFAPLTTFDPNVAALDSIEAALADPAGALQDAASICLYD
FT                   LYCWTGQITSTLLALDVPAEQIPALWQTLQQAHLVTASGHILTRGHVWARNGLPLAGIP
FT                   PAVQTRLRRTPQSPVQAAVLSADHYLGSPGRQIPITLTLSDGFGRALQTKRKAEPGPAY
FT                   MVDDQGRFLLDANGQPGIADTGSKPRWAVSGRVIYNEKGEPVRVYQPYFLDQPRYVDDL
FT                   DMVNWGYADTYMYDPLGRWRERLTALGFRHRIRYYPWFNVEEDENDTLDEVLGAETHPP
FT                   HADQESQP"
FT   gene            249936..257213
FT                   /locus_tag="BURPS1710b_A0176"
FT   CDS_pept        249936..257213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0176"
FT                   /product="toxin complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53341"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="InterPro:IPR041079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM68"
FT                   /protein_id="ABA53341.1"
FT                   /translation="MPWRDEIVQAAAIVRASVRDAWVSHDPTTRASPHFHEPDPELRNL
FT                   PVETGEFCDPDSLQSKLSPARYLMQIYGTATKQITPTDEQRRLETRRPDLKDLALTSDH
FT                   LLTEVTTLSLANQAMEALAKTPSQERDELYKKLATDRSAFSLPFDSYQTRVRLGLAALD
FT                   GASLNGIARATSSDANVLVSANWALVPNPRDRLGLCDEDMAILTATAGADDAKQLWDVE
FT                   KFLSHTSISLDDLNLLICSSGIRAEDGVASPDRVAAYYAKYINRGTPPAIRVAKVNAGV
FT                   NEGKLALMRGTGLTTTEYLGNMERMVRLYRRTGLPFHQLDHLICTAAMLENRNPPLLND
FT                   FALSLIARYREWHARFGLSVDAYVGLMYWSNEFVREGLQEMSYLRQQFGDAAQWIARYC
FT                   AAEVSEEKKYLRNPHVPIRQRLTAEEIAALQRGLQLTQTDWDTIVGAIDPRMDRAFDWP
FT                   CVAALQRFSRPFRSFGWSVQDAVLMLQQIAQIQLTKLSEGGKDVLGTLDQLVWLNDTLT
FT                   AWQATPAQIVTIVRTPPDEALKATQETANWINDLHQNLLPTLLTASSFDSYETVPLDTP
FT                   ATSPVTIDWLAELQKAPAAVNAIGLVLNHTKAEFETKVQNVLVAKGASRATSMKDGVVA
FT                   TLLLAQTSAMAALSAAVAKRMSGASDVVIPMLAWMNLQDSLKDPINYYTVLDKLLTWNL
FT                   GNKGAIDVPTLNQQSDTLKLLALMSRYAEAVRLFRLEREDIRLVVDRPEAFGALRQKLS
FT                   LNFDLLLALGRLKGLQHDQAGADAWRMYFTRRATAAAERDPNRKAAQIAALTDTLSQLL
FT                   GCPVEELKLMLDDLPTPVKELPDTVQEVDLMHRHLVQARALALDYAQLKPVKTMATRTG
FT                   YGSEGSRDGDRLPWGDKRTAADAVMTGVARYGALATAVDHPLDEACRDALVGYLLKKIL
FT                   PDKRVQNVTNAEQLYSYLLLDVNVSSEISTTQLLEATGAIQLYINRALEGAEPATFKSN
FT                   PPVRNETSDAAKRTLVDQWAIDREYQLWRANQELGLFPAHYVDPERIQNASADYMAFAD
FT                   ALNQGRLDDNAIRAALNPYLSDLSSRGRATIGGLSQVPVPGTRNVTLYVTARTPGDAGD
FT                   WYLRTLTLTDTGPKETLPWEKIDVAIPRDEFSAPIPIMFRGAIYLVWVEYDEKSYQNSH
FT                   DTSVIEKDYHYRVKRTRRLGAASWDEPEALPMQRFVLNTHSVELAGIRQIGSEFKPLGA
FT                   GHLAARQLAPDQWIIFRRGNAKTVSDKDVGFMVYVDTNMFAAQFSPGSVTSSYQPSLRH
FT                   LVLGSLVFTSGKVSFPQAPAGAFELTLEYCLYAEPELESSMNNAVAFAHHLTIDKLEVA
FT                   DDLMIEEIRLKDISQLLYRNTRTTGWGVFPRAVSPTTSSYTIEIAYRYRGVSATFTSNF
FT                   QLAARRIEPLPLLGDAAGNSCFVSDLGQVTSSAAQLTWLFNNFDEGSKTYPATDGSSPF
FT                   SVVGDEPVSANGPSAHVPAAIVIGDSVKSMRATPQNGIMGAHFSLSFWFKTRGQVQPLV
FT                   AMFDAANKEGLRMALDVNGCLSTRRANADTDASLRTKAGTSFNDGAWHHVIYTCSLRAG
FT                   QALHVDGHRMAAARVPSPLPPLRTIELATFGPSLVDRGAIGERAVTLAELKLFDHALTQ
FT                   AEIDMLLPPPGVALRLRTQTAAQLREQIEPPVGEPPFLYKARNYKKLQEQKEWDARLLI
FT                   GAYNASDEGKKLPVTVCPATQFDFGGYDGRYGWELFLYIPWLVAKRLAITGDYDRARQW
FT                   LHCIFDPTYVDPKERWICRPLRDSLSSATSVAMTDPDAIARANPIHYRTAMVNAYTDVL
FT                   MAAGDAQYRNPTRESLSRAKMYYVMAKEIRGSRPLLLQVDNWASPKLGAAKEGDFKRPM
FT                   DEKNLAYWDTLEARLDNLRHNRSIDGQPLNLPLLAPPVTPAALQQSAVSGGTSALVEVE
FT                   RNTPIPHYRFAVMLEKARGFVMTLSSLGNALQQTLERDDSEALGLMQLEQQVSLIDLGR
FT                   AMQHEQIEMAQHTLSALQHGRTAASERYTYYHALHEQGISAAEQAAMDLMTSAGALRIG
FT                   ASVPFTVAGVLEALPNIFGLAVGGQQPAGIPRAVGTGMLGVADMLQITADRLGAVEQYR
FT                   RRSDDWQLQYQQAEREGQNLDEQIAGAQRALALAQEGLRQQTLQQEQARATQRFLQQRF
FT                   GSRALYRWMSGRLATLYWQAYDGATNLCRQAEAACLYELGDFTLRFVQAGKAWNDQFRG
FT                   LLAGEALLLDLQRMELAYRQRDSRLHEIIKTFSLKAINAMALAALKSNGTTQFDLTEAI
FT                   FDKDYPTHYLRQIKTMALSFPAVLGPYQEVGAMLTQLSNTLYLKNDRRTADGANNSNRS
FT                   KMTNLRAYQQVALSQGINDSGLFQLDFNDERYLPFEGTGVESKWKLEFPGWANTTENAA
FT                   KTLLESLDDVIIQVRYTAAS"
FT   gene            257254..264630
FT                   /gene="tcdB2"
FT                   /locus_tag="BURPS1710b_A0177"
FT   CDS_pept        257254..264630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcdB2"
FT                   /locus_tag="BURPS1710b_A0177"
FT                   /product="Insecticidal toxin complex protein TcdB2"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF03534; match to protein
FT                   family HMM PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52747"
FT                   /db_xref="GOA:Q3JM67"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM67"
FT                   /protein_id="ABA52747.1"
FT                   /translation="MSPLPTTTPTPPLQVVTAAFPKGGGALPGLGQTLSPSGMSGAAQL
FT                   SIALPLPPVRLAPALALTYHSQQGNGPFGLGVALTLPTLARQTSRGTPSYADGRDVFVF
FT                   EGDELVPDAAGPTEVDNERLTRYHMRHEGRFDYLELHQPLTPADAPAPAWWRVWRADGR
FT                   CEVFGRCAAARTAVPGNPAQVLEWHLEETVSPHGEHVYYSYAPREAEAARTQLACLKQV
FT                   RFGNVRADPAPWSTAQGFDPATERWLFALVFDYGEHADTPQGPAWAASRPWRRRADPFS
FT                   RFDGGFELRCERLCQRIVLFHQLAALGAEPVAVRALQLSHTETAYLTQLTGVRQHGYRQ
FT                   TGGALEQAALPPLALEYTRFDLGRADFRALEAGLVGLNAGFYQVVDLYGEGVPGILYND
FT                   GQSYRYRRAKNVKRGDQGLDVEYEAAQSLSVPGGEMSAAALMDITGDGILDAVRTEPGM
FT                   AGFFTRDGDKGWQRFIPFAAFPSEFLHPRALLADLSGDGLADLALIGPSSVRLFVNRGH
FT                   DGFAPPRQIDHLGPDRLPVPPGGGQTLTAFADVLGSGQPHLVRVRHNEVTCWPNLGQGR
FT                   FGAPRTLRLRLDPAITAANFDPARVWLADLDGSGAADLLYLDHRTLYVHRNQCGNRFAR
FT                   AQTLSLPAALQYTDLHQVSVADLYGNGTSVLIISRLHPQPAHWVCDFSRGLKPYLLAGL
FT                   NDNMGAQTRLTYASSAHEWLDERRADSQARCRLPFPVSVLKRLEQVDEINHNTLEQTLQ
FT                   YRQGYYDGEERQFRGFGLILSTDMPSPLGAAQRDAAGTPYIPALQTRTWYYTGDPDSPG
FT                   AVDGNVGGSSYNGDPLAAALSPLRIERRDGQAIPLPPGTPERRVLLRALRGRVRREEVY
FT                   GLNPTTGQPQATPFRVMSLRYCVREWQPATASGVPAVLLAFVLESLDYNYDQVSTDPQW
FT                   QQTVALAVDTYGMVTKTVSLHYPRRAQVMPPIMPLPEAAHCSDAQQDTFLVTETRIRVT
FT                   HLQEPKPNRAGWRLGLPVENRDEMLGRVAPPTSANRVYSYEELTKADGPLASATRTLAR
FT                   WQQQIYADPSTGDPLPLAQATREGLVCQVRTAALSQAELRRSFEGLIPSQQLEPLLTQL
FT                   EDELVNQAGFVQGTAEDDKDYFWNPGLTATFADLAGFYTVRYHTDPFGNRTTYERDALT
FT                   LAPTLLSNARFTAAWIDYDPWSLLPAQITDANGTVHEVSYDPFGRVHLSALKGSERAFT
FT                   DSLGEARVGFGPLAGYRSSVKTVEAALRDPTGALGNAAQAYFHADHSWMGALTEAGLRA
FT                   AGLPDSEVQAVWQILLQQRLITVEGYVQARLHQLAKAGTPVPGLSDTQSAAVHRAVAAV
FT                   SRVPVHAATLSAERYRDEHADDPVPRPTDPVIRIALAYVDGFGRPLQGKIKAEGGLSAI
FT                   VEDDGKLKLDTSGRPLQERSEERWLTQGHVVYNAKGLPRQQYQPYYLNRPVHLTDPKLD
FT                   QLSASDTLYYDAPGRLAQLTKADGNRRTSQYRPWYRIETDEMGAPVATVHDGRGLAVRT
FT                   VQRPPPGAATADKVRITRHAYDAAGRLVSSSDPRFFDRQQAGETTLAGNERYRYGLSGS
FT                   AVTRESRDAGWQVDLLDAGGALWRSYTARDHQWRREYDALRRLSAVWLASGMSRTERCT
FT                   ERLRYGDDAGIDAVTARRANLRGRLVSHYDPAGLREITSYSLGGMIREEQRRFLQQRDW
FT                   SSDWPATPGAAAAHLEEQIETSRWQCTALGDELMLLDAAGHRHRCAWHVSGRPSGSWLQ
FT                   LSGGAEQAVVSELSYTADHQLLHEQAGNGVTSDFEYDPQTRRLSRAQTTRTASGRAATV
FT                   LQDLRYTYDRVGNVTQLADQATRVRYFRNQRVAAVRTYQYDWLYQLVRATGREQANAGQ
FT                   EGVALPPVGNPDALVNYTRTFAYDAAGNLTRTVHRGATRYVLALAVSRSSNRAVAGRRV
FT                   GADDVEAQFDAQGNPHRLGSNQPLTWSADNRLSRAVQLPRTGGEDDSEAYGYGGDGQRV
FT                   RKWSSQQAGAVTHRREVRYLPGLERRTNTATGEVLEVVSSAVAGRTAMRCLHWRASRPG
FT                   GLDNDMRRYSVNDHLGSSGLELDQSGQRLSAEEYYPYGGTAVWLPKSQVEGNYKFVRHA
FT                   GKERDVSGLYDYGYRHYAPWLARWLNPDPAGTVDGLNLYRMVRNNPVTLCDTDGRRPER
FT                   KQIIENYAQIKRFQYSAELLSKNLAASDAKITGRALANIIIDLAAIGINYGLALVVPPI
FT                   PAFPGPLEGLSGTIAGELANRALAAAGSSDLSTTLFSGQKTQMLTAAAMEVAEYAVAIA
FT                   HSNTFPAGPGNVRNYIRSNMITRHVDPASQLIWERAAVAQRAYHAARNAVSTVERLEEE
FT                   ARKLFENFDEGAGGQIKISPRDYLLNTLTGYDTPKLIKLAKPLTAESIASSAASAKKAL
FT                   GHLTHVAREIGYPALSWGTEQAELAGPNRRSPLAYWTEGDIDRMLPFRRTSWS"
FT   gene            complement(264627..265709)
FT                   /gene="tISRso5"
FT                   /locus_tag="BURPS1710b_A0178"
FT   CDS_pept        complement(264627..265709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tISRso5"
FT                   /locus_tag="BURPS1710b_A0178"
FT                   /product="ISRSO5-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52530"
FT                   /db_xref="GOA:Q3JM66"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM66"
FT                   /protein_id="ABA52530.1"
FT                   /translation="MARKRIEVVISELEREQLLSMSRSRSLPYSLVRRAEIVLMAADGR
FT                   TNREIAVECEVTSPAITPWKKRFVTQGLAGLHDEARPGRPRAHDDEVMAELLAKVLHEK
FT                   PDGATHWSVRSAAAQTGISKSSVARYLSLFGVQPHRSKSFKLSTDPYFVEKVRDIVGLY
FT                   LSPPTNALVLCVDEKSQCQALERTQPVLPMGLGYLEGVTHDYIRHGTTTLFAALNAATG
FT                   EVIAHCKSRHRHQEFLAFLNHIDQAVPEDLDVHLIVDNYATHKHPKVKAWLAKHPRYHM
FT                   HFTPTYSSWLNQVERWFGLITQQAIRRGSFKNVRQLIASIERYVEQYNQHKRPFVWTAT
FT                   ADSILQKVALLCKVISGTEH"
FT   gene            267680..268549
FT                   /locus_tag="BURPS1710b_A0179"
FT   CDS_pept        267680..268549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0179"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM65"
FT                   /protein_id="ABA52094.1"
FT                   /translation="MAVVLAVSVAPCASATVDRQDVQPSATDSTISAGTQPHIVYSERA
FT                   SAPGPLLVFIPGTGGKTPKTAETEQAFIGTALAHGYRVIILSYIDTRAIAQVCTKRVLA
FT                   NDPACAEQVRQKRAFGDDTTARIDDAPQDAIVHRLNALIRYLAAHNAGDHWEQYLAGER
FT                   LNWRAIVLSGQSQGGGMAAYIAKRIAIRGVIDFSGGWDMRSDNDIASWYSAPSATPPER
FT                   WYGTYHADERFASAIAASYRAMNIPVSHQFSLSEPVRHPEGKNPGHGEGASNPVYRGIW
FT                   ETMLTGLE"
FT   gene            complement(269358..269630)
FT                   /gene="epoD"
FT                   /locus_tag="BURPS1710b_A0180"
FT   CDS_pept        complement(269358..269630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epoD"
FT                   /locus_tag="BURPS1710b_A0180"
FT                   /product="epoD"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52430"
FT                   /db_xref="GOA:Q3JM64"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM64"
FT                   /protein_id="ABA52430.1"
FT                   /translation="MNTTNTACAPTAEAIERWLIGRIAAATGGEAAAIDPDKVMEAYGL
FT                   TSVIAVGLSAELEDWLGIDVDATIVWEYPTIAGLAAHLADAVRAR"
FT   gene            complement(269627..272644)
FT                   /gene="blmVI"
FT                   /locus_tag="BURPS1710b_A0181"
FT   CDS_pept        complement(269627..272644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blmVI"
FT                   /locus_tag="BURPS1710b_A0181"
FT                   /product="peptide synthetase NRPS5-4-3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52624"
FT                   /db_xref="GOA:Q3JM63"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM63"
FT                   /protein_id="ABA52624.1"
FT                   /translation="MGAPASSPSAHAPTSRNSARSAPRPPTPRRRSRCSRAAACSGGGC
FT                   CSGTPTARSIPTRRAMPAAHARGPTASPLPIPQPHRRRCRSDEVDDRSFAAGAVGPGFR
FT                   NRGARPRRPRRARGQPRARRPARPARLSPALAVRTSRIPFLLGGAGSDGRGARAAHARA
FT                   AHRHGGRAAAGAQSVAARGELSRARGAHARAHRSRRVRGGAARPRRAGRARRAAGAGRR
FT                   RADGELRRAARRAARLSARALSRRAPLRVRRDAAVRRRAARMGDGLGPGQRGDGRGTRR
FT                   ALRVLAVPQGQPAGPGGAGRLSRAAPGRPRRAGRELHQRGHGRRRGRAAPARRRLAARR
FT                   HARRAQRHPPRLPRTGARARAAVPRGRSHPAAFVARPRAPCRRDRGDGVADSSVSRTGA
FT                   RMTAIVPAAAAAATMVDIVRARADRQPDRPAYTYLPEQEGAPAELLDYASLVQRAHAIA
FT                   AALDRRLAGAPDAPRMAMLLFAPGPDFLAAFWGCLSARVIAIPAQLPRPGRCAATLEAI
FT                   VRNAGVRLVLASRPQADAIGRTLARSPALAGLDTLFVDDALADGAGRPAPARPAADDIA
FT                   FLQYTSGSTSRPKGVVVRHRNLVANERMIAQAMSLDHASTSVVWMPHYHDMGLIGGMLQ
FT                   PLYSGAHCVAMAPTTFLKRPLRWLRAIAQWRAVSSGGPDFAYRLCVERIAPEQAAGLDL
FT                   SSWRVAFNGAEPVRAATIAAFAERFGPAGFRAHASYPCYGMAEATLLAAGGRAGDGAHV
FT                   RWISAAALAAGRAEPPAPGDAGTAAVCCGAPPAGARLAVVDPATRQRRADGLVGELWIA
FT                   GPHVADGYHRAPEASAAAFGAAIAGPEPDAGPWLRTGDLGFVLDGGVYVTGRLKEMMIV
FT                   NGRNLYPHDVEDTLREGLAEIRDAAVFALIEPGGRERTVAILELAAAQRRLILQPDAHA
FT                   DAGLQAIAMDARALAARACELPLDHVRLSLPGAIVKTTSGKTRYGELRARMLALPESLR
FT                   QAPVSIEAGRARREEA"
FT   gene            complement(271441..272451)
FT                   /locus_tag="BURPS1710b_A0182"
FT   CDS_pept        complement(271441..272451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0182"
FT                   /product="bacterial luciferase-like monooxygenase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52820"
FT                   /db_xref="GOA:Q3JM62"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM62"
FT                   /protein_id="ABA52820.1"
FT                   /translation="MRVARRRVLCPFRNRTVGDAEVTKSTIVRSRPAQSVLDFGIVAPG
FT                   RAGPAVLADSLELAGRLDRLGYHRLWLSEHHESHFCWAVPEVMVAALAQRTRALRIGTA
FT                   AVLLPVRNPLLLAESFRVLEALTPGRIDLGVCAAVPLDPVALAALAEQPGPDVAALMAS
FT                   FDGRLGVLLDYLRGRFPDGHRFACGATPPFVDAPPVWVMGSGPGSAATAAARGAHYAYS
FT                   LFHKGSRQDPAVPAAYRERRPDGRVALAVSCISADTAAAAAAQRRLVEGWLRDDMRVVL
FT                   SGTHHDCREQVLALAQRFRADEVILLHLWHDPARRVDAIEAMASLIHPLAEPVRA"
FT   gene            complement(272400..274874)
FT                   /locus_tag="BURPS1710b_A0183"
FT   CDS_pept        complement(272400..274874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0183"
FT                   /product="putative 1-aminocyclopropane-1-carboxylate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53711"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM61"
FT                   /protein_id="ABA53711.1"
FT                   /translation="MRGTRSVRSSAVRACVARGSNGCAGSRARKEGRDERRLRRTRERC
FT                   RERHEGRHEGRHPEGRCQEGRYQGRHRHRRRRGARRLRDRHVPRAGRDPLGCRRRRARA
FT                   RRRAPRARRCARRAARGHAGGRPDRAVRRAGRRAPVPAPARVLPAARGRRARDQGQRDL
FT                   RGRRRAASADAGRAPGRVSRPRPLAVFRARTFPAERTEDSARDVDRRGARRRAGRRRRA
FT                   ARASRALRLHRARAVAARRDPLARRGGARASRAARAAAHAPRAARRRARRGRWPGRARL
FT                   SLSGRRASRRAPAATARRAAGKRLARAAVRVDRSGRDDRRLARAARAPARAGLSARERR
FT                   EHGRRPLHRHEERGHRRRLRRSGLGVPRGRRDRRSALARNAVVGDRRSRADLPAVPARR
FT                   YAGRRGRIPQSVACDGDGAQPAAAGSRRARAAARRGRSARRGHARHAARGRRARGRIDT
FT                   ARPRRRAARRTSMSRTRLLSELVPGLDTLVRPLDLLARPTPVTEEPELARRWGQAGLWI
FT                   KRDDLANPLYGGSKVRTLEFFLGRARAQRADGIVTMGPYGSHQLLATAVFGRRTGFLTR
FT                   GVATPQPDVPEIALNRRLLPAYGMEVMRCASFAAVPAALLRARLKPLGAGRPFWIPPGA
FT                   NHPLGVMGVVEGALEVAQAIRAGSLPVPDDVVVPTGTCATAAGVYLGFALAGLDVRVVA
FT                   VRMVPMIVTGPAKLLRMARQTERLLRRYGLTAPARWGELLWTNDHAGPSYGRAGLVAER
FT                   ARADVAQFGAFRTETTYTAKTLALLAGGGLQRRRVLFWNTYSAIDPDPSRDAGGACAWP
FT                   DGESSAHSATAP"
FT   gene            complement(273461..274774)
FT                   /locus_tag="BURPS1710b_A0184"
FT   CDS_pept        complement(273461..274774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52043"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM60"
FT                   /protein_id="ABA52043.1"
FT                   /translation="MNDVFGERASDVASGMKGGTKDGIRKGDVKKGDIKGDIDIDGGAA
FT                   RDDCAIVTCHAPAAILWDAADAAPELVAARPALADALAALRAGMPAAGRIAPFDEPAAV
FT                   RPYRHLRAFYLRRADGVLAIKGSEIFAADVEPHLRMLGAHRVEFPGRGRSLFSALEHFP
FT                   LNEQKIPLAMSIDEALDDVQAAAAVQRAHLARFGCIARVPLPLVAIRWPDAAAHAHLAR
FT                   LAPLLTRRARRAVERVAADGLGALAYHYPGVAHRVAHLPQLLAARPENGWLARLSALTD
FT                   PAATIDGWLELLARLLALGFLPASVESMGVGHCIDTKNAVIDGGFVDLGSVCRAADVTD
FT                   DRRLLETLLSAIADLAQTCRQFLLGDTPDVEAEYRNPSLAMVMVLNRLLPDLAARVQRL
FT                   GGADPRVADMLGTRPAAGALAAELTRLGLGAAPPGGHR"
FT   gene            273467..274840
FT                   /locus_tag="BURPS1710b_A0185"
FT   CDS_pept        273467..274840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM59"
FT                   /protein_id="ABA52787.1"
FT                   /translation="MSSWRRGAEAEPCQFGRERAGRGPRAEHVRDARIGPAEPLHARGE
FT                   IRQQPVEHHHHRKRRIAVFGLDVRRIAEQELPAGLREIGDRRQQRFEQAPIVGHVGRAA
FT                   HRAQIDEAAVDDRVLRVDAMADAHALDARGQKAQREQAREQLEPAVDRRGRIGQRGQPR
FT                   EPAVFRPRGEQLRQVRDAMRDARIVIGERAQAIGRDALDGAPRAAREQRREPREMRVRR
FT                   RVGPTDRDERQRHARDAAEAREMRALHGGGGLHVVERLVDRHRERNLLFVQREMFERGK
FT                   QRAAAAGKLDPVRAQHPQMRLDVGREDLAALDREHAVRAPQVERAQVPVRAHGGRLVER
FT                   RDPAGRRHARAQRGERIGERGARGDELGRGVGGIPEDRGRRVARDDRAVVARRAAVDVD
FT                   VALDIALLDIALPDAVLRAALHAARDIARAFAEDVVHRVPPCALASRRNRSSPARRRL"
FT   gene            complement(274771..279474)
FT                   /gene="lgrB"
FT                   /locus_tag="BURPS1710b_A0186"
FT   CDS_pept        complement(274771..279474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgrB"
FT                   /locus_tag="BURPS1710b_A0186"
FT                   /product="nonribosomal peptide synthetase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52259"
FT                   /db_xref="GOA:Q3JM58"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM58"
FT                   /protein_id="ABA52259.1"
FT                   /translation="MTTSASSPNLAFAAGERPAAPAIEAVLPLTPMQHGMLFHSLLDPA
FT                   SAVFFQQLVAEFDGALDAQAFAAAWADLVDRHQSLRTAFLWERRDEPRQVVLRRARVPL
FT                   EWLDWSDLGGDDARDAFDARLDAHLRADRERRFDPARAPLLRVAMVRRAAARHLMIVSH
FT                   HHLILDGWSTGVLLGELQALHAARLRRRAAALPPAPRYAAFVEHLGRAGRPCDDAFWRA
FT                   TLAGFAQPTPLVGDIRRDAATSGDYVPCDLRLESAARRALEDAARRHRVSAAVAVFAAW
FT                   AWLLARRADVPEVVYGVTVAGRPAELPGAQRLVGLCINTIPLRASAPTRGDVGGWLRDV
FT                   QERLARAQPHEHASLSAIQRASAVPPGVPLFDSLVVYENYPIAPPPADAPLRLVHARVE
FT                   ERANYALTLIAEPQADGLALRLIVDRTRIAPHEGRRMLEQLRVVLDGIARAGEHADLAG
FT                   LALLTPDAQRRMLQDWNATHAPYDRTATLHGLFARRAAQAPDAPALIDGAGTLGYGELD
FT                   RLSRAVAAALDAAGVPAGAPVAVRMLRDRHLVAALLGILRSGRAYVPLPRDLPPARVGD
FT                   IVDAMSIGCVVTSAALRDETAAHLGGRPAARLVAEEIVRGAPARESGRGGADDLAYVIF
FT                   TSGSTGKPKGVMVRHRPAVNLIDWVNRRFGVGPSDRLLFVTSPAFDLSVYDIFGVLAAG
FT                   GSIRIASDDEVADPERLARMLADEPVTFWDSAPAALWQLHPLLPERVDGSRLRLVFCSG
FT                   DWIPLSLPERMRGCFPGATVVALGGATEATIWSNYHVVERVEPGWRSIPYGRPIQNARY
FT                   YILDRALRPVPPGIPGDLYIGGECLCDGYAGQPALTAERFVPDPHADRPGARMYRTGDR
FT                   ARFWDDATIEFLGRDDHQVKIRGFRVELGEVEAALARHPDVRDAVAVVRAGGEGGPADG
FT                   RDDRALVAYAVPKPGGRASAADLLAHLRGLLPPPMVPAHLVMLDALPVSANGKVDRRAL
FT                   PAPLADRAQAGGATHLVEELVAAIWADVLGLASVPVDQDFFALGGHSLRATSAIARLRV
FT                   ALRKELPLALLYRHPSVRELSAAIVAGGACAPDAGGVQDGVPPRLSRDGPLPLSPAQER
FT                   LWFLHRLEPDSPFYTIVLAAWLDGRVERAALERAVAVVVERHEILRSHIVDIDGRPAQT
FT                   PARADLPLPIRVVDLTGAADPQAEALALARAEALRPFDLARALPFRVLLAPTRADRALA
FT                   LILMDHAAADGWSIGIFAQELLGAYDALVDGAAPALPPLDAQYADLSAWQAARLGRGEL
FT                   ERQLDYWRATLAGLPALNLPTDRPRAPTPRFAGAVVRFHVPAASARALAALARRESCTL
FT                   FMVGLAAFAMVLRHRSGQDDLAIGTDLAGRTHPAAERLIGFFVNQLVLRIDLSGCDSFR
FT                   DALRAVRERALDGFFHQDVPFDTLVRALNPPREPGRMPLFQVKFVLQNTPFVTLSSRHL
FT                   RVEPLDIDTGTAKYDLLATLAERPDGLAGTLEYSTDLFDAATAEGIAADLQAVLDLVAQ
FT                   NAAVGVADIARLLDAGHAQRAELGRQSLRRAGLERLRRLASAQGGTR"
FT   gene            complement(279492..283529)
FT                   /gene="sypC"
FT                   /locus_tag="BURPS1710b_A0187"
FT   CDS_pept        complement(279492..283529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sypC"
FT                   /locus_tag="BURPS1710b_A0187"
FT                   /product="syringopeptin synthetase C"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM PF00975;
FT                   match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53336"
FT                   /db_xref="GOA:Q3JM57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM57"
FT                   /protein_id="ABA53336.1"
FT                   /translation="MSATSETALHGFRLSPVQQRVWTLTDAGRLPAAQRVVARFAWTAA
FT                   PPSRAALEAALNALIGRHEILRARFARLPEMRLPLQTAPDGARLRLDGACAPDVPGTPD
FT                   TPDMPDMPDAGAPALHAAMDATGLVLSLPALCADGPTMLHLGAALAARLAGDDADGQAP
FT                   LQFFDLAQWQHDLLAEEGAWRWPDGALQSAHGPWPALPALRSARAAAYRPARHACALPA
FT                   DTGARVGALCARLGVTPADLLCAVWAVLLHRLSGGDTLPVAIVADGRPFDELATALGPL
FT                   AAPVPLSLSAALGAPDGTFAGLAKAAADARATAADLRHHLVPPDEARFAPFQIEVLDAG
FT                   RADDALLRVVDVATAGEPALLKLSVLVGPGGALRADIDHDAGAVRDGGAIARLAEQFAT
FT                   LLDAVLANPDATFDEPDLLGAAERRLVTEDFQGPQVNHGRWTPVHLAVAAAAAAAPDRL
FT                   AVQDGAARLTAAALERAVRALAARLTAAGVAAQTLVALHLPRGAALVTAILAVMRAGGV
FT                   FLPMPPELPAARRRYMLEDSGARIVLTLPDAADDLPRDLALVCVYPGEADVDVEAEADV
FT                   DIDARTAASGPTARVTADAPADAGADATTGACPDAWPAPDPTQAAYVLYTSGSTGRPKG
FT                   VVVTHGSLANHMAWMTRAFPLDAHDAVLQKTSAAFDASIWEFFLPLLAGARLVMAPPGL
FT                   ERDVPALVATLARERITVLQLVPSLLRVLVDAPGFGACDALRCVFCGGEALTADLARRF
FT                   AAAHRAALVNLYGPTETTIQVCAERVDAADDPVPVGRPIDNVRLYVVDSRNRLSPVGVR
FT                   GEILIGGAAPARGYLDRPALTAARFVADPIDPRAPRVYRSGDVGAWRADGRLDFFGRAD
FT                   DQVKLRGYRIELGEVEATLARHPDVANAAASVDLDANGIARLVCAYDCRAGRGVEPAPL
FT                   RAWLATQLPDYMVPGRCRRLDALPRNASGKIDRAALARGVDAPRDGAAPRDPVELRLER
FT                   VWEAVLDVQPVGVDRTFFDLGGHSLLAVRLMAEVKREFGCDLPLASLFEAPTVAAQAAL
FT                   IRQRERAHPVVVRVNRGIDGERPVFLVHPTGGNVLCYRDLARRLGPARPIYALQDPGLE
FT                   GDAGYDSVEELAARHIAHIRPLAGDGPYYLAGWSSGGVVAFEIARQLLAQRCEVGLLAL
FT                   IDSVASDGAQPAPRTDAELIGSIGRLLAFAAGVDAPDLAALEPSAAMARLRELAVAAGS
FT                   LPPDAPPERMRRLFDVFRRNAAAVRRYRPGPYPRRVLLLRATQPLPEPVRDAAARQRGD
FT                   SPELGWERVAVVSRCDIPAHHLSIVHEPAAALVGARIRDALHAADRIEAIGERVFFTLL
FT                   GH"
FT   gene            complement(283526..284650)
FT                   /locus_tag="BURPS1710b_A0188"
FT   CDS_pept        complement(283526..284650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0188"
FT                   /product="SyrP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51273"
FT                   /db_xref="GOA:Q3JM56"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM56"
FT                   /protein_id="ABA51273.1"
FT                   /translation="MRTTWPHWPQAVEHTPPRTIDMHAPSTPLKLARRQTINVTADSMV
FT                   RARPLFEDGALPLVVEPELAGVDAPAWIERHGDALAGWLPRHGAILFRGFGIADEAAFH
FT                   RAVAATGVRLMSYIEKATPREHLGRHIYTSTYFPQEYAIALHNELSYVKAWPGRIFFCC
FT                   TAPAATGGATPLADVRRVLDRIDPAVRDEFHRRGWQLARCFGSGMGPSWRHAYAVESVD
FT                   ELERYLRAMDVSWQWLPNGWLRTRQVRPAIHTHPRTGDALWFNHVAFWHASSLHEPVRR
FT                   RFEADFGVESLPYNTYYGDGGTIPDDVAAHLRDAYACETVAFPWRKGDFLIADNMLIAH
FT                   GRAPFTGERRVLAAMGDAVELDAREMAALRERLA"
FT   gene            complement(284613..294014)
FT                   /gene="mcyE"
FT                   /locus_tag="BURPS1710b_A0189"
FT   CDS_pept        complement(284613..294014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcyE"
FT                   /locus_tag="BURPS1710b_A0189"
FT                   /product="polyketide synthase peptide synthetase fusion
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF00202; match to protein
FT                   family HMM PF00501; match to protein family HMM PF00550;
FT                   match to protein family HMM PF00668; match to protein
FT                   family HMM PF00698; match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51905"
FT                   /db_xref="GOA:Q3JM55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM55"
FT                   /protein_id="ABA51905.1"
FT                   /translation="MGCVFPGAAGPAAFLELLRAGRVAVRDVPPERWDAAALHDPDPDA
FT                   PGRILTRRAATIDGAHGFDPEFFGLSRRDAREMDPRQRLMLKTAWWALEDAGMPGWGLA
FT                   GRSVGVFLGASNGEFGGAHARLSAIGASTAAGHATSVLANRVSYLLGLTGPSLVVDTAC
FT                   SSSLVAVHLACAALRARECELAIAGGVSLMLRPDASVAFSRARMLAADGRSKPFSASAD
FT                   GYGRGEGAGAVVLKRLSDARRDGDRIVAIVLGSAVNHNGQSNGITAPSAPAQEALIRQA
FT                   IEAAGVAPEQIDLVEAHGTGTLLGDPLEAKALGRVLGAIDGRAGALPIGSVKGNIGHLE
FT                   AAAGIAGLIKLALALRHREILASAGFDAPNPHIDFRALNLTVPTARTPLPERARPAIGA
FT                   LSSFGFGGANAHLIAAAPPADQPDQPDRHDQHDSPVRHAGAQTGAPWPALLVLSAASDS
FT                   ALNRLAAATAACARGDRPGAWRLARASHVARSPLRQRLAVVAADADTLAAALDRAASGG
FT                   RDGVVARGAAPRRRPALAFLYAGQGAQFPGMAAGLLDGDTELRRTLEHASAITGLPIVD
FT                   WLAAGGAALDRTDVTQPLMVALQVGLTRQWAAWGVAPDIVIGHSLGDYAAAVAAGALSF
FT                   DAAMRVAALRGRLAATSARPGGMVAVAAGCDAVAPHLARGAAIAVDNGPAQLSVAGDAA
FT                   ALAETVRRLEAAGIAARPLPVSAAFHSPAMEPMLDAFRAALADVAMQPLRVPMVCNRTG
FT                   AVLPAGTMLDAEFWVRHLREPVRFADGVRALAREGVALGLEIGPSAMLSRLAPLSAPTL
FT                   SVVPSLARGTRDRDALLAAVGALWVAGVTPDWRAIDGPDRVHAELPLYPFDDAPFPLLA
FT                   DGTVAAGAIASSGAFGAREAGPAPSPPQASPSLPATPAVAAASASNAAARERALDIGAK
FT                   LRDAIAEALETSPDRVDPTVPFIEMGADSLVLMAAARKIEAAFGVRIPMRAFFDELSTM
FT                   EALATYLAAESPRPAAASDRAPAAPSSPGFVAQVVREQLALMRRQLDLLEGRRAAGEPE
FT                   MPDDAARALRAEIARAERMGDRGEDGRREEGGSEEGRGEWHGGGKDGHGGGDGSGKGGD
FT                   GSDTGRAVPAVRATRRANTVRDALSPRRQAHLDKLIGDYTRRTAGSRALAARYRDVMAD
FT                   SRASAGFRPSIKEMLYPIVCRSAAGATFEDVDGNRYLDLSMGFGVHLFGHAPDFVTAAL
FT                   RESLSRGLRLGPQADRAGEAAAVIARLSGQDRVAFVNSGSEAVMVALRLARTVTGRERV
FT                   VIFRGAYHGHFDGVLADAADPADPAAGGAPLVPGVARGAVADTLVFDYGDPASVDTLAA
FT                   QLGHVAAVLVEPVQSRRPDLQPAAFLRRLRALTEQAGALLIFDELITGFRIAAGGAQAH
FT                   FGVKADLVAYGKILGGGLPIGALAGRADVMAAVDGGAWRYGDDSAPTAETTLFAGTFNK
FT                   NPLSIDACVAVLTEIERRGDALYAQLNERSARLHARLEQALAGTPIGIARFGSVFRFVF
FT                   GRNLDLFFYHLLLRGIYVWEGRTCFLSAAHTDADCDRLVVAVADAVAALRDGGMLDEGE
FT                   GDHEGEVEGEGEGGPTADPAARDYAAPHADTDTHTDTLPMIRAQRQLAALAEMDPAGAV
FT                   AYALPLLLALDGPLDAARLRDAVERAAARHDGLWVAMDPLSGTLRMMPPGRLTLGVQAL
FT                   DAAALDAQVRRQMAAPFDLKAPPLLRATLFAFADGTHALLLVGHHAALDGFSLQVLAAD
FT                   IAACYRGAPLPRAASLRRVLAAHRDAERDGRWAAARDGWRARLRDAPAGFDLDVAAPRP
FT                   PMRALRGAREVRRIEAASARALRARAAAERTSLLAVMLAGFAWLLARHGAADVVIGVPY
FT                   AGRALAGDGAQRVVGYCAHLLPIRLRAGAVDSVAALLAHTRAALIEALDHADYPFAHIV
FT                   DDLALKRDPARPLLVPATFNVDRVPPALDFGEGVAARLRSPAVGAGRFDLACNVIDDGD
FT                   ALTVEFDHDEALYGGGRAQRLADEYLQLLEALAQGGERPLHDGAGHVARWATVVAAGRA
FT                   EPLAVRWRRHLERAPQQVAVAVDGDARLSRAALDRWSDAVADAIEGAISGVRAGVIEGV
FT                   IDGAVEDKIEGAAEAARASATAGPVALLLPRTEALPVAMLACWKAARAWLPIDPATPAE
FT                   RIAEMIRRAGCALVVRDAATAAAADGAIAPRCATLDLPPRAAAGRRAARRPWPAPNPED
FT                   VAYVLFTSGSTGRPKPVAVPHRALEWYVQGLLARLGLPSGLSCGLVSTFAADLGLTATL
FT                   PALFDGGCLCIQSDAAARDPLLLAAVHRKRPVDLLKIVPSHLEALLAGAPDPLLLPRRV
FT                   LVLGGERAGPGLLRRLAECAPPALRVMNHYGPTETTVGVAMGEWTRGADALRLDAPLAG
FT                   AALVLLDDAGRRAPAGVRAQLYVGGPQVALGYPGCPDETAARFGARPASGVAGPLYATG
FT                   DLGRLDADGTLTIVGRTDDQAKIRGYRVEPGEVAAALEGLPGVASAAVVAAEHPARGTV
FT                   LVAYVAGDGAQADPASLALALHARLPDYMMPARIIPCRSLPLTANGKLDRGALPAPDWA
FT                   THAPGEPASATVSSEAERVQATLVAVWRELFGRPDIGVHDEFFALGGDSILGIRMVARL
FT                   HRDGLRLLASDLYRHPTIAALAPLIRPVDAQAEQGMLSGPVPLLPAQRRWLEIGAGLRP
FT                   HANLSLLLELDAEVTPARVADAFARLLHQHDGLRMRARTDGGELVQTYGPPAPVPLHRV
FT                   AAGHATPAALTRLQALADPAASPLVLGWLDGAPSRLLIVMHHWITDAVSCAILLDDLAR
FT                   LLRDPDAPLGPKTPSLRQWAQTLTERAASPDALAQLEYWTLSTSLPPPALPARSGGARG
FT                   DAADGEWPGAPGAVGLTLSADETRDVTAGPAAQAGAETEDLLLAALALALGGRTGEPLL
FT                   YVELEGHGRTPPDGLPEPARTIGWFTARHPAWFDLTGVPEAAAVAAVRAQRLTIPNRGA
FT                   DYGALRHLGPDHARDALAAGRRPAVSLNWLGQLAGIEHAPFRLVSWRPGCPLRGAERAA
FT                   DLPQPHALAVETMLIDGCLRIEFIYDAARFDAATIDTLAADYAAALLRLARERAAPPAP
FT                   PPDSPGELDADDLAALAASR"
FT   gene            complement(294078..294836)
FT                   /locus_tag="BURPS1710b_A0190"
FT   CDS_pept        complement(294078..294836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0190"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52495"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM54"
FT                   /protein_id="ABA52495.1"
FT                   /translation="MRRRCGAPFVFLSRAHASPPLIWTFPAPLCLFVRATIRREKYAAF
FT                   KELARQVAFAYRQHPARLEWSAYATVAGPSLGVYIIVPLDSLGAMDDIASLDKVMADVY
FT                   GDEGAIRLGEFQDCVLDMNTSVLNRIDLGLAPTPPRDAPAEYLYYLNVKVDPAAAGRFL
FT                   DRAREAAAAMTSGPFALYGTFAGATRVHGFALGERIADLELVGRLQSRIVSGSRADDGE
FT                   RIWAGIHDTLQETETSILRHIGHDARDDKR"
FT   gene            complement(294873..295184)
FT                   /locus_tag="BURPS1710b_A0191"
FT   CDS_pept        complement(294873..295184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52113"
FT                   /db_xref="GOA:Q3JM53"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM53"
FT                   /protein_id="ABA52113.1"
FT                   /translation="MFCNCRSILAGTISKSMVSSHSHCEVIDMLYDDIVSALGKAVKDP
FT                   GYRDKLLKDPNGTLKAEGADLGNSVTTLEWVESTNCLNVHVANGGANWSGAVLLKIEK"
FT   gene            complement(295449..297275)
FT                   /locus_tag="BURPS1710b_A0193"
FT   CDS_pept        complement(295449..297275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM52"
FT                   /protein_id="ABA51732.1"
FT                   /translation="MTFRSHGRLSVFDWRAERREPRVASRASLQHARQPCERDVDRRRV
FT                   DAAIPEQDARLGRAVRVERRDAVQVDVGVAGGVERRALVDTRGEARGQMNAGRGNHGPQ
FT                   PVRQRAVQVRGEQPAARVVVAMDAPQMAGERAVGDEPRERRLRERARVPVDDLLGLAQR
FT                   EVQRARRHRVADAQFRKQRLRERADVRDEPRAIEAFQRLQRPALEAEFAVVIVFDDHRA
FT                   PPLRPFEQRDAPLEAHRHAERELVRRRHVDEARVVRQLRDAEPVRVDRHADHARAERRE
FT                   RRAGGWVAGLFDGDDVARAHEHACEQIERLLRALRDDHVPPVARHRAAEADVARDRVAQ
FT                   LGLARGVAIVAAAARLRAQRVLDAAPPVVPWKMHLVGDAAAEVERERRVRRRHRQPGRH
FT                   VGPARVRTGERGVAAIGARRLRPRAGAVRRGLARAGHARQAARDERAVAGAREQKAFTR
FT                   KALERVERRLARYAELARELARRRQPRAGGEASVDDGRAQLPIDLAGEVAAIAEADLKI
FT                   HGMVTRASDEFAILARRRRPMRHARRTPPSEAGAPARTQDAARPATCSAAGAKRFAAPA
FT                   EWNLVNRNVSQNPTISQWQAIFVIDLKIKLMK"
FT   gene            295491..297203
FT                   /locus_tag="BURPS1710b_A0192"
FT   CDS_pept        295491..297203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0192"
FT                   /product="GntR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53298"
FT                   /db_xref="GOA:Q3JM51"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM51"
FT                   /protein_id="ABA53298.1"
FT                   /translation="MPLRNRRILRDISIDQIPFGGRRESFCAGRRTGGRPRRILRSRRR
FT                   ARLARRRAPRVPHRSTAACQNGKFIACSGNHSVDLQISLRDRRDLAGQIYRQLRAAIVD
FT                   GRLAAGARLPSTRELARQLGVSRKTTLDAFERLASEGFLLARTGNGTFVAGGLTRVPGA
FT                   REPAANGSGTRAQAPRADGRDAALARAHAGWSDVPAGLSMPPPHAPLAFDFRGGVTDKV
FT                   HFPWDDWRRSIQHALRAQARSSGDYRDPAGEPELRDAIARYVGFSRAVACDWRDVIVTQ
FT                   GAQQALDLLARVLVRPGDIVAVEEPGYPPARAAFAALGACVVGVPVDAHGLGVAQLPDD
FT                   ARFVYVTPSHQFPLGMPMSLERRVALLEWAQRRRAVIVEDDYDCEFRFEGRPLEPLKSL
FT                   DRAGLVAYVGTFSKTLFPELRIGYAVPPRSLNLALRKAKQIVDWHACTLTQTALARFIA
FT                   DGAFARHLRRIHRHYDARRRLLAAHLHGALSHWLRPVIPAAGIHLTARFATGIDERAAL
FT                   DAARDADIDLHGISAFYADSPAESGILFGYGGIDAPAIDVALTRLAGVLKRCA"
FT   gene            297380..298336
FT                   /locus_tag="BURPS1710b_A0195"
FT   CDS_pept        297380..298336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0195"
FT                   /product="Cupin domain protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52180"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM50"
FT                   /protein_id="ABA52180.1"
FT                   /translation="MRCAARAHSTITRYRGTHHANPSRLPQGESARAQRDARARGADRA
FT                   KRAGADADRARAAARLADQRLRVLRRHAHARRAQARRNRAPPRDGRRLARSAVLHRPRM
FT                   RGARMDRGGDARRARSRARRGLGGGASAFHRCRARRPDARHRDDQRLEPLCGVVSQAAG
FT                   MSSNMTPDGTGGAAPAARAPARIARIGAAALAAALFCVPGSAHRDDVGQVRPVLAQPLA
FT                   EAPGNDAQVVTVSYAPGAASDPHAHAGSIFAYVTQGRVVSQLEGEPPRTYATGEAWYEP
FT                   PGSHHVVSRNASDTEPARIVVFAVLGAHRALKTPLPR"
FT   gene            297435..297872
FT                   /locus_tag="BURPS1710b_A0194"
FT   CDS_pept        297435..297872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0194"
FT                   /product="YdfG"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52861"
FT                   /db_xref="GOA:Q3JM49"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM49"
FT                   /protein_id="ABA52861.1"
FT                   /translation="MQTRLDYRKANPHALNAMLALEERIAQSGLEPTLIELVRLRASQI
FT                   NGCAYCVDMHTRDARKHGETERRLATVVVWREAPFFTDRECAALEWTEAVTLVAHDHVP
FT                   DAVWEAVRPHFTDAELVDLTLAIVTINGWNRFAVSFRKLPA"
FT   gene            complement(298458..298592)
FT                   /locus_tag="BURPS1710b_A0196"
FT   CDS_pept        complement(298458..298592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0196"
FT                   /product="bacteriolytic lipoprotein entericidin B.-related
FT                   protein"
FT                   /note="identified by match to protein family HMM PF08085"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52133"
FT                   /db_xref="GOA:Q3JM48"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM48"
FT                   /protein_id="ABA52133.1"
FT                   /translation="MNRAIAAALLILTAALAGCNTIAGVGQDISKGGQAISNTAEKAK"
FT   gene            298907..300166
FT                   /gene="pyrB"
FT                   /locus_tag="BURPS1710b_A0197"
FT   CDS_pept        298907..300166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="BURPS1710b_A0197"
FT                   /product="aspartate carbomyltransferase"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51418"
FT                   /db_xref="GOA:Q3JM47"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM47"
FT                   /protein_id="ABA51418.1"
FT                   /translation="MRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFV
FT                   SEIVERAPAADGYAQSVDSRQPLAQQFLFEGRPQLLSVDQFSRDSVEALFRVADVMQPI
FT                   ARRRKISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIY
FT                   DTSRVMAGYVDALVIRHPEQGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREF
FT                   SRLGKIVDGACIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIVDQISK
FT                   NGHVVEETHDLAAGLKGADVVYATRIQKERFTDESFEGYTPDFQINQARVDAACGPDTL
FT                   IMHPLPRDSRPGANDLSTDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVEHLVQHSMRD
FT                   ATWRPPTYLGPEDAVFHGID"
FT   gene            300566..302812
FT                   /gene="piuA"
FT                   /locus_tag="BURPS1710b_A0198"
FT   CDS_pept        300566..302812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="piuA"
FT                   /locus_tag="BURPS1710b_A0198"
FT                   /product="outer membrane ferric siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51391"
FT                   /db_xref="GOA:Q3JM46"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM46"
FT                   /protein_id="ABA51391.1"
FT                   /translation="MKSRSDELKLGKFTTLCSVLAASPAFAQDAAPPAASADHDKELAP
FT                   IQIKGAAEHSYKADFSSSVKFTAPLVDTPKSVTVIPQELIHNSGAATLTEALRTVPGIT
FT                   FGAGEGGNPLGDRPFIRGYDTQGSMFVDGMRDTGATTREIFNTERIEITKGSDGAYGGR
FT                   GGAGGSINLVTKAPHLGTTAEASAGLGTDRYRRFTADGNWQFADHAAFRLNLMSHNNDV
FT                   AGRDAVNNERWGVAPSIAFGLGTPTRVSASYYHLSTDDLPDGGIPYFYTTANKPANVDT
FT                   IYPANVDRHNFYGLVNRDFRKTTTDIGTLRIEHDITPSLTVRNTTRYTESTQDYIWTQP
FT                   DDSQGNVVNGRVWRRNNNRNSAINSIANQTELFGEFRTGPFKHSFTTGIELSREWGKRD
FT                   SYSVATGTGKICQQGIGAASGYNCTSLGSPNPNDPWAGSITRNNDYAHARTVTKSLYGF
FT                   DTVELSKHWQVNAGVRVDDYSTRFTDTRANGGKTYTRDDTLVNWQLGLVFKPARNGSVY
FT                   ASYATSSTPAGALLGEGSETQSLTPGRGGVGANADQLAPEKNRSIELGTKWNVLDDKLS
FT                   LTAALFQIDTTNARVTLPNNQYAMVGNKRVQGLELGFAGQLTRAWQVFGGYTYMKSELR
FT                   DNGRNTADNGHQFPNTPKHSFTLWTNYDVTPKFTVGGGAFYMSKVFGDTANLRAVPSYW
FT                   RFDAMAQYRINKKLDLQLNVNNLFNRTYFDQAYPAHYASIAPGRSAFVTLNARY"
FT   gene            302814..303560
FT                   /locus_tag="BURPS1710b_A0199"
FT   CDS_pept        302814..303560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52865"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM45"
FT                   /protein_id="ABA52865.1"
FT                   /translation="MARAVSLKALAAASREDLAGILAGAPERAAAWVAAAAQNGIVEAQ
FT                   AVYGQYLLDGHGVARDAAAALEWFKHAARADHPMAMNMVGRCYEFGWGTAASAAVAVYW
FT                   YREAARAGLDWGMYNYATMLALGNGVDEDRAAALAWFEKAAALGHAKSINLIGGFHEDG
FT                   WVVAADRDAAFDCYRRAAAAGDFRGQFNYARLLAERGRVAEALEWLARVPRTATPAFVA
FT                   KMRAYLAASPIDAFRALAARQEKSAT"
FT   gene            303557..304240
FT                   /locus_tag="BURPS1710b_A0200"
FT   CDS_pept        303557..304240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0200"
FT                   /product="2OG-Fe(II) oxygenase superfamily:Prolyl
FT                   4-hydroxylase, alpha subunit"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53149"
FT                   /db_xref="GOA:Q3JM44"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JM44"
FT                   /protein_id="ABA53149.1"
FT                   /translation="MMLHIPGVLTKEQVAQCRDILDAADWTDGNATSGAQSALAKRNRQ
FT                   LPEGSPAARAAGDAIQDALACNALFFSAALPLKVFPPLFNRYAGGDAFGTHVDNAIRLL
FT                   RGTDFRVRSDLSATLFLEEPEHYDGGELCVEDTYGVHRAKLPAGDMVLYPASSLHHVTP
FT                   VTRGARVASFFWIQSMVRDDADRTLLYQLDTQIQRLTAEKGGRDASVIALTGIYHNLLR
FT                   RWADA"
FT   gene            complement(304667..304909)
FT                   /gene="tnp"
FT                   /locus_tag="BURPS1710b_A0201"
FT   CDS_pept        complement(304667..304909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="BURPS1710b_A0201"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53166"
FT                   /db_xref="GOA:Q3JM43"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM43"
FT                   /protein_id="ABA53166.1"
FT                   /translation="MGTRGTGYIMPVTNAIESLHMQLRKIIKARGHFPSDEAALKLIWP
FT                   ALRNVVAKWTGSRHDWKSAMMQFALLYPERFNMGV"
FT   gene            complement(305389..305754)
FT                   /locus_tag="BURPS1710b_A0202"
FT   CDS_pept        complement(305389..305754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0202"
FT                   /product="putative transposase"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52595"
FT                   /db_xref="GOA:Q3JM42"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM42"
FT                   /protein_id="ABA52595.1"
FT                   /translation="MTKGTRQTHSAAFKAKVALTAVKGERTLAELAQQFDVHPNQITEW
FT                   KRQLQERAADMFGAGAAPSSNEPPVDLKSLHAKTGQLTLENDFLSGALDKAGLLSAKKC
FT                   STVSTRCRLRSRLVSSA"
FT   gene            complement(305937..306200)
FT                   /locus_tag="BURPS1710b_A0203"
FT   CDS_pept        complement(305937..306200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0203"
FT                   /product="PAAR motif family"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51824"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM41"
FT                   /protein_id="ABA51824.1"
FT                   /translation="MRGVIRIGDSTSHGGRVETGREGSTVMGRAVACVGDRCTCPINGH
FT                   EHCVIVEGDEDVRIEGRAVAFDGHRTSCGATLVSSIPTSGRA"
FT   gene            complement(306210..307748)
FT                   /locus_tag="BURPS1710b_A0204"
FT   CDS_pept        complement(306210..307748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0204"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53501"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM40"
FT                   /protein_id="ABA53501.1"
FT                   /translation="MAASIRNGVLVALGVVAAVFTASYVWLHRAPHESTPATMSSASAA
FT                   VDTHAATNYGNNGVPALLGQTGANYVLEVRGLGLVTGHETNEEIWKAIQAKADNHSTYM
FT                   SQNPADYPANKDERMTDLGLSTRISFKFGARNSVEYWPVPVFIWEPPKDRRFGRPGAAL
FT                   DGIRQEASLGVTLLLWQEDANTDDGASIIEKLFAFFDSHPDVPEAVIYTLDGSMKRWLN
FT                   ETPGYIDTFEQSNIPSMPDSMVAMLVSRSDRVDRLIRPYAVEQTENVNNGTTDYDITRL
FT                   WNFFWKVNQDRGPDSFTAHYEADEKRAGVNTPMSAGFVTSAWWQTKLPAFWKTISNKGP
FT                   GEFKPTPYIPVRWTTWQVRQFDNAPLLGYLHRPIDVKLADAHGKPLKTAQQAQALKAGW
FT                   QQAVDTLPTGETPKRIFYDTTGDRAWVAPINQALAQSGPSAPSLDDVKEGYDIGRRIGN
FT                   TGISSPLVQIGLGLIASYHEGGASATIHRRPNGTATIVMVSPPTHKQPDVNPFR"
FT   gene            complement(307887..310073)
FT                   /locus_tag="BURPS1710b_A0205"
FT   CDS_pept        complement(307887..310073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53503"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM39"
FT                   /protein_id="ABA53503.1"
FT                   /translation="MANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLN
FT                   ERLSRSDLRPGEYGRRYAAASAAKAEGDSVRYAEVLGDPDMYLYQRAEAGGTHSMFLPF
FT                   YWGYRASDNEIAKISHPGEVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANA
FT                   TNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPERRYFVLAAARLANLIKTIRTI
FT                   QPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLRQQGQRCVDCIIMVDTPYSLQF
FT                   TQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRP
FT                   DKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKT
FT                   MPAMTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDG
FT                   TMLGTLVESGKNMALQASFKRNDIRFINGEQLKPAYEPDLYGGEVRKGGQVPGHADVAG
FT                   LMRPDDVTKNVALGNQYAKFKWKDVATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVP
FT                   SRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLSSENHR
FT                   WVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFERLDEHTREFVKA
FT                   CVDYYKTGRFPDEKYVPLTMPPLVTSELKVESKT"
FT   gene            308013..310196
FT                   /locus_tag="BURPS1710b_A0206"
FT   CDS_pept        308013..310196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51723"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM38"
FT                   /protein_id="ABA51723.1"
FT                   /translation="MFVQALKVLAFLDIAIHVRRHLPIRHQKQQLPPVRIIQRHRLTDR
FT                   HIHRRDPAMVLRTEQYARMIVVRFQLIGIGTHALANLVRRLLALDHVRLIPSARGGRRQ
FT                   HRAERPARHDAPVMRLLVDRTAAIERLLVRLDAGARIVRRRDVFPFELRVLVAERDVFR
FT                   HVVRTHQPGDIGVPGHLSALPNLAPVQIGLVRRFQLLAVDEANVVALERCLQRHVLAGF
FT                   DQGAKHRAVRVGARRQSLKRVANRHARGRRADGDLRALPPAVLVALEPRPHALKEALRL
FT                   KHRHRGHRFAPAGRRAIGRHLVGHAERADPPHLVEADHGIFRAKVQIDLAAVVALVERD
FT                   PVLAALVRPLSLRLAPVLSGPAARMGRIDHQFGQLRNRMRLARHRVDDVDQRLELRVPG
FT                   LLAAVLGELQAVRRIDHDDAIDAALPLLPEHRLREQRDDRALAVPHHRDRFVLRVHSMF
FT                   ERERGGLNGPNGLDEIRQASRGQHEVTALGRLAGEDRIAGQRVLHDRALELVRFEARAV
FT                   HLRDVVRRVGEKPAALAEMGVEPVAVDVLILAARHQVAVAVRHAALDLARMADLRDLVV
FT                   GRPIAPVERQEHAVSAAGLRTLIQIHVRIAQHFRIPNAIALGFRRRRSRIPPAILPRPQ
FT                   IASRQALIEPLAQPALHGGISRPGIVDAVDEDHHARQIARNRHGPVARPIRHRHARPAG
FT                   GGETLIVDSVHRSPGFRASASDSRSSRYASRRP"
FT   gene            complement(310141..312906)
FT                   /locus_tag="BURPS1710b_A0207"
FT   CDS_pept        complement(310141..312906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0207"
FT                   /product="Rhs element Vgr protein subfamily, putative"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52929"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM37"
FT                   /protein_id="ABA52929.1"
FT                   /translation="MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASV
FT                   QEGLMTGIHGRLTCVSTRRDLPPGVLLGIPVSIRLITDRGQPHTVNAIISGVQIGQSDG
FT                   ELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDLSGL
FT                   RADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCD
FT                   DPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSV
FT                   ASGLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVR
FT                   DLAVGTWITLTGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAC
FT                   APRALPSALANDADTRYENTFACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVF
FT                   CDEDGRVRVRVHGLDPADHAHAQGAGTNGNAGDSAPIRVASSLAGAHFGASFLPRVGME
FT                   VLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRL
FT                   DDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAAQGMLL
FT                   TTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRW
FT                   APGTGTDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAG
FT                   QGMQLFARGAGVQAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAE
FT                   DGSYLELGGGITLGTNGDIKLLSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDG
FT                   DLQAAANKRFRITLDDGRVIEGKTDASGLTDLVKDDAMRIAKIDYLKPKL"
FT   gene            complement(313227..313532)
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_A0208"
FT   CDS_pept        complement(313227..313532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_A0208"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51319"
FT                   /db_xref="GOA:Q3JM36"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM36"
FT                   /protein_id="ABA51319.1"
FT                   /translation="MATYEELKAQLDALNKEAEAAKAREISTALSQIRETVLRYEIRPD
FT                   QIFPQWTRLRSPDKRRGPLPPKYRNPMTGETWCGRGRAPKWMSGSPREAFLIDRPA"
FT   gene            315069..316349
FT                   /gene="proP7"
FT                   /locus_tag="BURPS1710b_A0209"
FT   CDS_pept        315069..316349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP7"
FT                   /locus_tag="BURPS1710b_A0209"
FT                   /product="putative sugar transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52415"
FT                   /db_xref="GOA:Q3JM35"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM35"
FT                   /protein_id="ABA52415.1"
FT                   /translation="MRSKSGQTLKIALTANLFEWYEFSLTAFMALEIGRLFFPDTNEKT
FT                   ALISSFSVFASSYLARPIGSILFGILGARYGTGASLKISMIGMAVPASLIAVLPTYQTA
FT                   GHFSTFLLLALKITQGFCAGGEMPLSGYFVSLNADRTNRGLYCALTVASGFIGMLLASA
FT                   AVFLLPHIRYALDHLASPENYAYLNEPWRWPFFLCMPLSISIYLLRSAINKSEVKVDSG
FT                   KLRAKPTFPLLQSLAVVAFAEIVIYIIFVWMPNYLHVYLGKQSFDARLSNISSLIIFSI
FT                   SMACAGYAERYFCARNIALFGTIATAISVYPSFIIMQYGGIFALLFSQAILAISAGCVV
FT                   GVIFVVLPDLFKKNWGSLGMVVTYSFATAIFGGTAPVFCAYLIELTHFIAAPAIYIFLM
FT                   GMLAAAAIYKIYPPSKTKFRYRAPNSV"
FT   gene            316346..316984
FT                   /gene="thiE2"
FT                   /locus_tag="BURPS1710b_A0210"
FT   CDS_pept        316346..316984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE2"
FT                   /locus_tag="BURPS1710b_A0210"
FT                   /product="DGTP-pyrophosphohydrolase; thiamine phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52874"
FT                   /db_xref="GOA:Q3JM34"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM34"
FT                   /protein_id="ABA52874.1"
FT                   /translation="MIESIIHRHLKIIVNKSANLPSEYLITPEPPGDEALSDYLATLER
FT                   TLKAGISLVQLRAKAVTAPYYARLTEYALACCRRYNARLLVNAAPEVARGLHTDGVHLT
FT                   STRLMTCSTRPLPAGLLVSAACHDEDQVRHADSIGVDLITISPVMPTATHTTAEPLGWP
FT                   RFRELATLTSVPVYALGGMSVDSLAEARNAGAYGIAAIRAFWGSNVDRS"
FT   gene            317812..318852
FT                   /locus_tag="BURPS1710b_A0211"
FT   CDS_pept        317812..318852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0211"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52455"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM33"
FT                   /protein_id="ABA52455.1"
FT                   /translation="MGANIVPRHPRHELRNSALVQPACPVATTAPALVVLRASRPVVCP
FT                   RNGIFAAPRPASRDSRLPARPDSSPARRILQRPGFSTPNAQRNEAFGRATQPIPRATRR
FT                   PPAARDTTHRSPPTARAKKGLPRTCARPTPHRTIAAPSPPVIAMTHASLATGVLLAAGL
FT                   GTRFDPGGVQSKLLAKLPDGTPVAVAAAQRLTAVLPDVVAVVRPGAERLAHLLNDVGCQ
FT                   VVFAPDAERGMGASLAAGVRARADSPGWIVALADMPWIAPATIESVACALDAGLASTVA
FT                   PVYRGQRGHPVGFASRHYDALAALDGDTGARALLAAAPPALVDVTDPAVLRDIDTRADL
FT                   HAPPRD"
FT   gene            319948..321342
FT                   /locus_tag="BURPS1710b_A0212"
FT   CDS_pept        319948..321342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0212"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51720"
FT                   /db_xref="GOA:Q3JM32"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM32"
FT                   /protein_id="ABA51720.1"
FT                   /translation="MSEHFYKLSQQNAMPEADAKRAALEAIAAMRYGKDGYLSVNDSKP
FT                   VVVMHPIKPELNGKDVSGFTDPGGKHLFVEIVKAGNAEGGLGFVDYMWPKPGADKPIDK
FT                   TSAVRHFAPWDWYLVTGMYMDDLQAAVLASTGRWLAMTAVLGAAATILMVLVLRSVRSS
FT                   LGGDLEAAVATAQRIAQGDLTAHVDIRGGDRKSLLHALHTMQTALIDMVSRVRLGTENI
FT                   NVGASEIAAGNTDLSQRTEQQAAALVETASSMDEMTTNVKQNADSASQAAELADQAAQV
FT                   ATRGSSVVDDVVRTMDEITDASRKIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRG
FT                   FAVVAGEVRTLAQRSATAAKEIKSLIETSNTTVEHGATLVTRAGTTMTEIVQSVRRVNE
FT                   ILEEISHASREQSAGIDQVNRAVGEMDQVTQQNAALVEQAAAAAHSLKDQADALRSAVA
FT                   QFALPG"
FT   gene            321959..323743
FT                   /gene="ftsI"
FT                   /locus_tag="BURPS1710b_A0213"
FT   CDS_pept        321959..323743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="BURPS1710b_A0213"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="2.4.1.129"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51708"
FT                   /db_xref="GOA:Q3JM31"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM31"
FT                   /protein_id="ABA51708.1"
FT                   /translation="MRLNKKPKSSDPYVAVAKNPMLSSSLPMWRSKFVVILVFLAFGAL
FT                   IARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALLAVSLTTYEIWANPKQ
FT                   VDEAAHAPLAKLLDMPLAEVRRRLTGDRSFVLLKRQVDPETAARIEKLDIDGVTQIADS
FT                   KRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQVIRDRLGRIVSDTGPL
FT                   VPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDAQNGEILALANYPTFD
FT                   PNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQTIIDTSPGAYKIGPN
FT                   VIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGIGRAPELTFPGVAS
FT                   GRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVSLLKASADPQSAD
FT                   AHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTARKQVGASYVKGK
FT                   YRALFAGMAPMSNPRLIIAVMIDEPAARSYYGGTVAGPVFSSVMSGSLQLLGVPPDAPI
FT                   AADKPAGAGAKPQAKAKT"
FT   gene            323769..325139
FT                   /locus_tag="BURPS1710b_A0214"
FT   CDS_pept        323769..325139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0214"
FT                   /product="L-arabinose ABC transporter, periplasmic
FT                   L-arabinose-binding protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53300"
FT                   /db_xref="GOA:Q3JM30"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR026266"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM30"
FT                   /protein_id="ABA53300.1"
FT                   /translation="MLFPRRPAAFDLRPSTFDLRPSTFDLRPQTSDLRRPTSDVGPSTP
FT                   TPDIGHRTSDIGHRTSGIQTRHPPHPSPPHRPIPFFRNPSQYLEARRRASYNQPHDMHA
FT                   VARLARPHPYRKRSTKETLMGLRWPQAALVCASLAAGLSAAAPAHAQGAAPVKIGFVVK
FT                   QPDDPWFQDEWRFAEQAAKDKHFTLVKIAAPSGEKVSTALDSLAAQKAQGVIICAPDVK
FT                   LGPGIAAKARRYGMKLMSVDDQLVDGRGAPLADVPHMGISAYRIGRQVGDAIAAEAKRR
FT                   GWNPAEVGVLRLAYDQLPTARERTTGAVDALKAAGFAAANVVDAPEMTADTEGAFNAAN
FT                   IAFTKHRNFKHWVAFGSNDDTTVGAVRAGEGRGIGADDMIAVGINGSQVALNEFAKPKP
FT                   TGFFGSILLNPRLHGYDTSVNMYDWITQNRAPPPVVLTSGTLITRANEKTARAQLGL"
FT   gene            325204..325971
FT                   /locus_tag="BURPS1710b_A0215"
FT   CDS_pept        325204..325971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0215"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52566"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM29"
FT                   /protein_id="ABA52566.1"
FT                   /translation="MTTSRTTLITGAAGGIGQALVRGFLAAGDRVLALDRDRAALAAFV
FT                   DALGDAAVAPIIDDLTDAERLAAALANEPVDVLVANAGTAASATLRTTTSASWRADLDA
FT                   NLTATYASVEAVLAGMRARRRGAITIIGSVNGVAALGHPAYSAAKAGLISYAKSLAIEY
FT                   GRDGVRANVVCPGTVKTPAWEARVRQNPQVFEQLKKWYPLEDFATPDDVANAALFLSSD
FT                   AARAITGAMLPVDGGLLAGNRVMAQELTLESFY"
FT   gene            327192..328469
FT                   /locus_tag="BURPS1710b_A0216"
FT   CDS_pept        327192..328469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0216"
FT                   /product="putative surface layer protein"
FT                   /note="identified by match to protein family HMM TIGR02276"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51867"
FT                   /db_xref="GOA:Q3JM28"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM28"
FT                   /protein_id="ABA51867.1"
FT                   /translation="MASSDSNPPERNAMNSTWMRKYGERIGKPFFPKVSGLILPAAVSA
FT                   GGLPFSVALALFSACRAIIIYALSFLSILAAVPAYGASPPGPDGELYVPEAHHNKISVI
FT                   DTKTSKIIRSIPINDIPVLPLGSRPTVLVATPDGNKIYSDNFGLIPPTITAVDRKTGSV
FT                   KSIQLSSVPLGASISEDGKEIYLPQGTYSVEVVATDSDKVVRRLSFSDVPVAAIKGPDG
FT                   HLYVGFANGAIGSFDVRTGKALRQPIETGGTLPAWFTFTRDGKKLYVDAVNAIGVIDLR
FT                   SWTLVKRIPTGDDASQRSTDPWPFTSTLAPDGKKLYVTLLGESGVLVIDVATDRVVAKI
FT                   KTAGSTTGVAFSADGSRGYITDMGPSLSFLKTPAGGALLGNVWIGFGLLGSGQVVVFDP
FT                   KTDEPVGEPIPTTPGPGIPVWVPPRG"
FT   gene            328507..329937
FT                   /locus_tag="BURPS1710b_A0217"
FT   CDS_pept        328507..329937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0217"
FT                   /product="probable secreted protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53444"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM27"
FT                   /protein_id="ABA53444.1"
FT                   /translation="MAASTRRTRIRIAHRAWRIRYRSTRSLSAMPALKHDHAIVIGGSI
FT                   AGCLTAEVLSRHFTAVTIIEKGDFDDDTGERQSIPQEKHTHVLLLEGQRLMEQIFPGLT
FT                   EDLTRAGAIAADLINDVRWFQYGLWKKQYASELHSAFFSRRLLDNAFRRRIRRNSKIDV
FT                   RSNTAVTDLIMSRANGRPSIAGLRISPPDGSIATLRGALVVDASGRGSRTANWLSAAGF
FT                   DEPQQMVVKTNLGYASRIYRRRPEHRDWPAVVIWPTPPEQTRIGLMLPIEEDRWMVSAG
FT                   GWFGSFPKPDPDEFVEFMRTLPVPDIYERIRDAEPATGLSGFRMPGSRWNRFDRLGDFP
FT                   DGLIVVGDALCSINPFFGQGMTLCAKQAHALARHIPRWLAARCSTREIQSQFVALIRPS
FT                   WNMATSEDMRFPQTEGERTLLTRIMHWYGAGVARVSASNRRARQAQLEVIHMSKSPNHL
FT                   LHPSIFARIIVDSMTAAK"
FT   gene            330136..331104
FT                   /gene="ispA"
FT                   /locus_tag="BURPS1710b_A0218"
FT   CDS_pept        330136..331104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="BURPS1710b_A0218"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52719"
FT                   /db_xref="GOA:Q3JM26"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM26"
FT                   /protein_id="ABA52719.1"
FT                   /translation="MSSDIAERDGHGPAVETSGLSPSARFEEADGWTKTAIRQTEATLD
FT                   RILPCADGRLTALHAAMRYAVFGGGKRLRPLLCHAAGELVDASREALAQVSAVIEMIHV
FT                   FSLIQDDLPAMDNDDLRHGRLTLHKQYDVATALLASDGLISQAFLALSEAPLPLDVRVA
FT                   LMRELASSIGPSGLTGGQYIDLTSIGAHLDRTELEQMHRMKTGALIRAAVRMGVLCGTV
FT                   PGAELGAAWRAVSEYGERLGLAYQVVDDILDSTAATSVLGKTAGKDARANKATYVTVLG
FT                   LDASRAWARQLADEAWAALAPFGGQARFLRKLVERVLHRLS"
FT   gene            331142..332326
FT                   /locus_tag="BURPS1710b_A0219"
FT   CDS_pept        331142..332326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0219"
FT                   /product="Terpene synthase family, metal binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03936"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51647"
FT                   /db_xref="GOA:Q3JM25"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM25"
FT                   /protein_id="ABA51647.1"
FT                   /translation="MTLPRRHRCPFENTPADATQEEHSVTALVNQSVAPILCPFPLREI
FT                   RPADAHIARTSEWLIRSGLVGSDAHARALAGVGAHYAMCCYPDIAADRIPDLADFAAWN
FT                   CLLDDFAENGPLSGELAALTHFLKSVEYICGASNYRCPSDFGFDHGYRIAEALVDVKRR
FT                   ISAWASFAQIRNLMSATGHFMSGLAWEAAYASLRQVPDLNTYCAIRTANSGMYMANALA
FT                   ECANDVELTPAQRACPRTEALTQCILFVLVIDNDLYSHHKEKNGRAAFASMIDVLMHSR
FT                   GSEDAHAALLEALDLRNQCLRCYLALKAKCRLTAGDRLDLYFKGLEDVISGNLVFGSTC
FT                   ARYAAPGSPQFLGTTNARHLRPDSVQIPVVEALDVPASPPRHIPSIAWWWTLAD"
FT   gene            complement(332689..334776)
FT                   /locus_tag="BURPS1710b_A0220"
FT   CDS_pept        complement(332689..334776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0220"
FT                   /product="potassium-efflux system protein"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53454"
FT                   /db_xref="GOA:Q3JM24"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM24"
FT                   /protein_id="ABA53454.1"
FT                   /translation="MRPCRTDRSRRRRAPRGRRAAPVRVARHAPTPCSPPPCRRRSDPR
FT                   ASHPGDASGPASGHRAAARRLVQSARRPRAHAVSRNRRRQILAGSRICRRDPLFFNSYE
FT                   TVTFNGARMPHDVSLIALLAAGFGLAMIFGYLASLLKMPPLVGYLLAGIVMGPGTPGFV
FT                   GDLALAQQLAEIGVMLLMFGVGLHFSLGDLLSVRKIALPGAIVQIAAATALGAGLALWW
FT                   GWSVGGALVFGLSLSVASTVVLLRALEGRGLIESVNGRIAVGWLVVEDLVMVLVLVLLP
FT                   PLAALLGGGGAPAHGDAAVHAGEAGGSLWAALGVTLLKVAAFVALMLVVGKRVFPRILW
FT                   LVARTGSRELFTLCMIAAAVGVAFGAAKLFDVSFALGAFFAGMMMRESEFSRRAADETL
FT                   PLRDAFSVLFFISVGMLFDPRVLIDEPLHVLEVAAIVVLGKTLAAVALVLAFRYPLNTA
FT                   LTVGVSLAQIGEFSFILASLGRGLGLLSAEGQSLILAVALLSIALNTLLFAAVDPVLAW
FT                   IRKRSAFARRLESRDDPLAALPMSTPQAHLTGQVVIVGYGRVGTRIAHALDARGIAYVV
FT                   VEQNRETVEKLRADGVAAVSGDAVEPIVLVQAHIARAGMLVVTLPDVFDVRQIVDISRT
FT                   LNPAIEIALCTNSDEEAALLANEGMGEVFVSETELAHGMTEHVLARMGAGEAHARRSAA
FT                   H"
FT   gene            335268..336572
FT                   /locus_tag="BURPS1710b_A0221"
FT   CDS_pept        335268..336572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53083"
FT                   /db_xref="GOA:Q3JM23"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM23"
FT                   /protein_id="ABA53083.1"
FT                   /translation="MEMIRKNSAVAVSATICRIRPNRFDIEPHRPTRTPGPPGSAADAQ
FT                   TASHVRPASPFRARRYFPRRIRGNPHSNRLVPANQAIIIVTSINVMVCCECRPAASRRR
FT                   AAHAIPLSAATCDTGRLRAVRLTQNHREAHMAVGNHHPIKARHVKFDFGETPLQWIPGD
FT                   PESTHIIDTLNLLFPEGELWFCRVYNKALPLIDDPALHADADGFLRQEAVHSRSHHAVA
FT                   KQCYARHGVDTQPYTRRLTWLFSKVLGEAPLGLKIGHTRFWLRQQLGIIAALEHFFAYL
FT                   GRWVLNARELDEARADPAMLDLLRWHGAEEVEHGTVAFDLHRYMGGGYFGRAFHMLLAI
FT                   ALLVLFVSMGSKFMHTRDPGAGRYPGFVRAWTRGSRRRHLPSFWKTIGAALRYFNPAYT
FT                   PHGEGSTELALDYLARSPAAQAAAHGGNWGAKKTT"
FT   gene            336673..338646
FT                   /locus_tag="BURPS1710b_A0222"
FT   CDS_pept        336673..338646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0222"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52362"
FT                   /db_xref="GOA:Q3JM22"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM22"
FT                   /protein_id="ABA52362.1"
FT                   /translation="MIHIRLKRASFLLLLGAQAVSLGAAAGTLSGTVSSAGTPLAGAMV
FT                   TVFDAAQARRDTVYTDHNGRYRITVDFAGELRVRARTPYFKDAAQDLALAPDASKTLDF
FT                   SLARQTVADELSASLPASAHLATLPWSSQDSRTAFISQCNYCHQVGNALTRTPRDEAAW
FT                   GATVRRMEGYAALLTDRQARDITHTLYQGMNAHAVAAVEKYLYDDRLAPAKIREWAAGD
FT                   GLTFIHDADVGFDDHLYGADEGHDKIWELDRKTGKLTEWKEPDVDLPVGGIFSGVQLPI
FT                   GVFSGKHGPHSLAQAPDGRFWITNALSSTLASFDPATKRFKLYELGHSHLYPHTLRIDR
FT                   AGIVWFTIVASNEVARFDPKTGRFTIIHLPDGGIWRAMSHYLFPLVVKMAAWFPGQNLH
FT                   LALTHHKWAFQGRDAFPFPYGIDVNPVDGSIWYAKLYANKIGRIDPKTLAVTEFDTPLG
FT                   GPRRLRFDPQGNLWIPAFDDGGLMRFDTRTHRFETFKLPLLAHNEYEVPYALNVQPKTG
FT                   DIWITSNMSDRIFRFVPSTQTFITYPLPTRVTWLRDMTFTQDGAVCSSSSNLPAYGIEG
FT                   GRASFICLYPDGERGGTAANAAGNANAAANLARVRAAAARRTPERTAPARAALARAGSN
FT                   RDGAIQTAAIQADGTRTDRSAH"
FT   gene            338660..339016
FT                   /locus_tag="BURPS1710b_A0223"
FT   CDS_pept        338660..339016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51943"
FT                   /db_xref="GOA:Q3JM21"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM21"
FT                   /protein_id="ABA51943.1"
FT                   /translation="MNMQTFLLYLLITVLMAPLLAVYGLPFIAVARGFSRIARARIGDR
FT                   LRRAIACAIAAAGIAPSYDAYRAPLPIYARRLLDGASVDAGFALASFGVTWIVVMLVAR
FT                   LCTRRRAAPQTHGA"
FT   gene            339276..339539
FT                   /locus_tag="BURPS1710b_A0224"
FT   CDS_pept        339276..339539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51221"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM20"
FT                   /protein_id="ABA51221.1"
FT                   /translation="MTEVAPGALVTCGDWARAGSALVDAQRAKDDRPSALDGLSAGGML
FT                   TDHVAAVNEMVKGIVGMTFPDQRMRQVRERDRPQPAWTETPR"
FT   gene            complement(339697..341457)
FT                   /locus_tag="BURPS1710b_A0225"
FT   CDS_pept        complement(339697..341457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0225"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase
FT                   family"
FT                   /note="identified by match to protein family HMM PF06983"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52911"
FT                   /db_xref="GOA:Q3JM19"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM19"
FT                   /protein_id="ABA52911.1"
FT                   /translation="MLWYRKLRIRQARPRRVRPRHAGAGRGRRAGKAETGDETRNDHSN
FT                   LWRGHVRHGVRLSLRARFGGRARRCRRRGRMGGGPRRAAGRIPVAALQSGARRERALDA
FT                   RAPRSAGDVPRIPARGFALDADRAAGRRAARGRQRRDVQPRPGGLRDRDDVGVRRSPDD
FT                   GDRAREAAALDRHVARERAAGRALPLARRAADPSAARSGGFDDAHRAAREHRCRPDRRS
FT                   LPVRAPEREPRATERDAPHAHAAAAHARAGAGFDLPAAREAARVAVVRGRAGAARIDRG
FT                   VLGRARGSGGPHRADQAAAGGDRVAARRAEQPDAVHADARHGDRAADQYRRRLLRDERR
FT                   RHSVLGEQARVLDDGAARRGVHRARRVVDVLAARGPVAIRAAPAATGAAAGNGARHFPR
FT                   DVSIPAGSTVVCVAACDSRMHRSDPDRRFAMAIQKITPFLWYSTQAEEAAAFYAGVFPD
FT                   SRVARVTAVPGTGSTKLVEFVLFGQPFFAMSHPRTESFNHAISFLVSCRDQAELDRYWS
FT                   ALLEGGGSPDDCGWLRDRFGVSWQIVPDDLIAMMADPDPVKAARVAGAMMSMRKFDVAA
FT                   LRAAYAGAAG"
FT   gene            complement(340326..341336)
FT                   /locus_tag="BURPS1710b_A0226"
FT   CDS_pept        complement(340326..341336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0226"
FT                   /product="transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53465"
FT                   /db_xref="GOA:Q3JM18"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM18"
FT                   /protein_id="ABA53465.1"
FT                   /translation="MIIQTYGADTSGMVCGFRFAPDSAGEPVDAGVAAEWAAGRGARPD
FT                   EFLWLHFNLAHGASERWMRAHLDLPETFHEFLREGSHSTRIEQQDGVLRAVVNDVMFSL
FT                   DLEASEIATMWAYVDRRMMVTARAKPLRSIDTLRESVRQGERFRSPAELLIHLLRDQAD
FT                   LMMHIVRRASTDVDRIEDRFLSERLSANRGQLSAMRRTLTRLQRMLAPEPGSIFRLLAK
FT                   PPAWLLSADVQELRESTEEFSVVLADLAGLIERIKLLQEEIASRLDEQNNRTLFTLTLV
FT                   TVIALPINIVAGFFGMNVGGIPFSENKHGFWMMVLLVAGFTALAAWWTFWRRGDR"
FT   gene            341703..342650
FT                   /locus_tag="BURPS1710b_A0227"
FT   CDS_pept        341703..342650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0227"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51790"
FT                   /db_xref="GOA:Q3JM17"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM17"
FT                   /protein_id="ABA51790.1"
FT                   /translation="MRARFPLRPALSRSKPFVVGSGARRSDNGAPFRRPRTKCTFMHVS
FT                   ILVHARYTARMNEAIPLARRDAIAGRLALGQPVQAAALAAEFHVSEDAIRRDLRALAAE
FT                   GRCRRVYGGALPVTPACAPMAARIDAARERKAALARTAASLIERGELLFLDSGSTALAL
FT                   VEYLPEDAELTIATNSIDIAAAVLRRADLSLIMIGGAVDQAVGGCVDASAVQSVARMNI
FT                   DRGFLGACALSPQRGLAAFGLADATFKRAVVAASARCVVLATTDKLAARAPHRVAALDE
FT                   IDCIVVEHDLPREDRAALSSAGASILAANPPAQP"
FT   gene            342684..343820
FT                   /locus_tag="BURPS1710b_A0228"
FT   CDS_pept        342684..343820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0228"
FT                   /product="putative transport protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52383"
FT                   /db_xref="GOA:Q3JM16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM16"
FT                   /protein_id="ABA52383.1"
FT                   /translation="MSSDRPATRLATRLAFLVAGFGVACWAPLVPFAKARLGVDDAVLG
FT                   ALLLCVGLGSVIAMLITGPLGTRYGSRPIIVAGGVALAAILPLLSVANTTPALGFALLA
FT                   FGAALGSLDVAMNVHAIEVEHAAARPLMSGFHALFSVGGIAGSSVMTFLLSMRVGAFAS
FT                   TLLCSAPMFAAILVARPRLLRAARAAARPRFAMPRGVVPLLAMLAAITFLAEGALLDWS
FT                   ALLITDKGLVAAAQGGLGYLLFSIAMTAGRLGGDAIAARVGDRSTMFWGGLLAVAGFVM
FT                   LLAAPIAGVAMAGFLLIGLGASNIVPVLFRRAGAQQAMPSALAVTLITITGYAGHLAGP
FT                   AGMGFVARSVGLESAFWMLAALLGIVPLCARVVTANRT"
FT   gene            complement(344201..344671)
FT                   /locus_tag="BURPS1710b_A0229"
FT   CDS_pept        complement(344201..344671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52586"
FT                   /db_xref="GOA:Q3JM15"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM15"
FT                   /protein_id="ABA52586.1"
FT                   /translation="MKQAGIRIGTHAIALALGFALGIYALPILTAERGARETELRPVAD
FT                   RALYTGRFERSLTRGDPLHWTDGKLSVTRAALAFEGRVAPGPDYKLYLVPGFVASKEAF
FT                   LAAKPHARRVGELKTFGDFVAPLAADVDIDAYTTVVIWCERFSQFIGAAQYR"
FT   gene            345442..346722
FT                   /locus_tag="BURPS1710b_A0230"
FT   CDS_pept        345442..346722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0230"
FT                   /product="putative transporter periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51633"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM14"
FT                   /protein_id="ABA51633.1"
FT                   /translation="MNTIRLLGAAALVGACAPLAAAAATPVCKVPTLKVLAQKSLGLSV
FT                   MEKSLPDYEKTSGTRIEINYFGENDRRAKSRLDASTGAGSYQIYYVDEANVAEFASAGW
FT                   IAPLLKYYPKEYDYDDFLPGRRAVASYKGVAYFAPLIGGGDFLFYRRDLLDAAHLPVPK
FT                   TLDELVAAVRKLNAPPKLYGWVARGQRGSGMNVWRWAPFMLAQGGAWTDPHGQPAFNSP
FT                   AAVQATERYRDLFKYAPPGAATYDWSNALEAFRSGKVAFMIESTPFADWMEDPSKSSVA
FT                   GKVGYARPPAPLPSAAYGHGLAISSVGAKDDCTRQAAGRFIAWATSKEQEQARLRNGVF
FT                   SDYNRTSTIGSDYFRQHVKPQILAGLNDTNPVTKATIWATPQWPDIGDNLGVALEEVFT
FT                   GTQTDVRGALDDAAQYAKDAMAHGARK"
FT   gene            346857..347735
FT                   /locus_tag="BURPS1710b_A0231"
FT   CDS_pept        346857..347735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0231"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53202"
FT                   /db_xref="GOA:Q3JM13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM13"
FT                   /protein_id="ABA53202.1"
FT                   /translation="MFNHGKTSLPWLFLGPPLALMAVLGLVPTIAAINLALKNRVLRYA
FT                   DSDYVGLRNFVRLASDRRFLNAIEVSALWEAVTVAGAVAVGIVLAVFLFERVHGRWRHA
FT                   AALILIMPVLLPRVSAAFIWKFMYAPLTGILGWLLGALGMTNVAWLADPRLALAAVALV
FT                   DVWQWGLFFCVVVLKLLETLPPEPLEAARLDYASTWQVYAYIALPMLKAPIMSLVFIKM
FT                   VESLRSFDLIYVMTKGGPGIATETLDMYAYAQGIGLSGKVSYASSMAVLMMVATTLVFT
FT                   FIWKRVDKWDD"
FT   gene            complement(347552..349561)
FT                   /locus_tag="BURPS1710b_A0233"
FT   CDS_pept        complement(347552..349561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0233"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52633"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM12"
FT                   /protein_id="ABA52633.1"
FT                   /translation="MRLAARRRLECAQAVRERERARDERLHVDRAGGDQRERAREDVRV
FT                   AEHRFDARLLRLQRNDIERHRRERHADQHEAAVRAQQIDDARIRARVAACLEHHVRAPA
FT                   VGRVRDCVGERLRARVDRRHRAVRGEQRELFLDDVGEDHARGAARERGERRHRADRARA
FT                   DDHRDVARLHRRLLRGLQPDRERLDDRALGERHVRRQPVRERRRVHDVGREAPVHGRRR
FT                   PEAHRRIEVVQAVQRRFRIEARHAGLHAHALAHAQVRDVAPDLDDRARRLVAEHHRRVH
FT                   PERADSAVHVVMDIAAAHAHRVDADLDVGGADLERQIDVAQRELARLFEYEGFQRILLG
FT                   GRLSAFEHRVQQAAEHADEDERRQREQHGGRIDHAPRHLLAERRERGRDDGQRRRARRR
FT                   ERERDHQFVPDEHEAEHDAAEQRARADRQRDAPEHRVRPVAVERGRLLDFARQPAEHGD
FT                   RQPCDRRQRDEQVRDDHRQLRVVEPEVDPDRDQRNRDRDGRQEAQRQQEELDVALAAHR
FT                   IADDRVRGGHAQRGAERDGRADDRDAVAEADQHLGARQHLPVVVERRREDEARRRRDDV
FT                   EQALERIEERPRERKHGDERDRAADGDGAAACDQSSHLSTRFQMNVNTSVVATIISTAM
FT                   LDAYDTLPDSPMPCAYAYMSSVSVAMPGPPLVIT"
FT   gene            347723..348535
FT                   /locus_tag="BURPS1710b_A0232"
FT   CDS_pept        347723..348535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0232"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51600"
FT                   /db_xref="GOA:Q3JM11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM11"
FT                   /protein_id="ABA51600.1"
FT                   /translation="MGRLIARGGTVAIGGAIALVAVFPLAWALLNSFKRLLDIVTPTPR
FT                   FIFTPTLDNYRQVLSSPEVLIGLGNSVAIVGAAVALGAALGVPAAYAIVRYPVRGKRDI
FT                   QFFLLSLRFLPPVAVAIPLIAIWVDLGLYDTKLSMIVTYLLVTLSTITWLSIPVFRRLP
FT                   REIEEAAALDGYGPYAVFWRVALPVCASTLLGGIVFSFVLVWNELMIALALTSSRAATL
FT                   PVVASAFTSLGQEVPWGVINASTVLLALPPLVFVGMLSRLLNSMLKGR"
FT   gene            348557..349591
FT                   /locus_tag="BURPS1710b_A0234"
FT   CDS_pept        348557..349591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0234"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52418"
FT                   /db_xref="GOA:Q3JM10"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM10"
FT                   /protein_id="ABA52418.1"
FT                   /translation="MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYY
FT                   MHGGIGPFRVDAPMVLGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLY
FT                   NLDPSVRFWATPPVHGCLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAM
FT                   KPGDIAVVVGAGTIGAMTALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSL
FT                   ADAVAHATDGWGADVVFEASGNASAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAK
FT                   EARIESVFRYANVFPRALALIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQ
FT                   IEMD"
FT   gene            349595..350788
FT                   /locus_tag="BURPS1710b_A0235"
FT   CDS_pept        349595..350788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0235"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.20"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53520"
FT                   /db_xref="GOA:Q3JM09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM09"
FT                   /protein_id="ABA53520.1"
FT                   /translation="MARIVCTGLTKRYDGGAPVLHPLDLEIGDGEFIVLLGPSGCGKST
FT                   MLRMIAGLETITGGTLAIGGAVVNDLAARERNVAMVFQNYALYPHMSVYENIAFGLRRL
FT                   KVPAAEIDRRVREVARVLGLDALLDRKPRAMSGGQQQRAAIARAMIKTPDVFLFDEPLS
FT                   NLDAKLRAQLRGDIKRLHQRLKTTTLYVTHDQLEAMTLADRIVLMRGGRIEQLGTPAEL
FT                   YGCPHTVFAAGFVGTPAMNFADGVIERTAGHVALAAGGARWTLAARRFAGLPDGLRVKL
FT                   AIRPNYLRIAPGAHAPAATLALEGRVELVELLGAEALVTFGCNGAPFAALVPASAAPAL
FT                   GAVVTFTFDERDLHLFDAATGRNVMLPEAGAPADAERPGAAMRPSPGAPHRFTMSRP"
FT   gene            350827..351846
FT                   /locus_tag="BURPS1710b_A0236"
FT   CDS_pept        350827..351846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0236"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51397"
FT                   /db_xref="GOA:Q3JM08"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM08"
FT                   /protein_id="ABA51397.1"
FT                   /translation="MNPDLEIVPTRRDESFRAWSHDYPHTVAKWHFHPEYEIHLIQGSR
FT                   GKFFVGDHIGDFAPGNLVVTGPNLPHNWISELGPGERVPSRDVVLQFSRDAAEKMVAAF
FT                   AELQPVLDLIDEASRGVQFPDEIGLAVAPLMLELASAHGCRRVEVLMALFDRLASCAAR
FT                   RTLAGPGYRIDAQHYMSSTINQVLAYLRQNLPGALREADVAEFAGMSVSTFTRFFRRHT
FT                   GSTFVQYLNRLRINEACELLMCSALSVTDICYRIGFNNLSNFNRQFLAMKGMPPSRFRA
FT                   LHRLNEPHDAPEPHEPHEPHASLAPAAAPAAPGAAARPPERAAPTARAVIHSHRSLHP"
FT   gene            351843..353303
FT                   /gene="xylB"
FT                   /locus_tag="BURPS1710b_A0237"
FT   CDS_pept        351843..353303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="BURPS1710b_A0237"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01312"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52132"
FT                   /db_xref="GOA:Q3JM07"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM07"
FT                   /protein_id="ABA52132.1"
FT                   /translation="MTYLGIDLGTSEVKAILTDADSAPLAAGGAPLAVERPHPHWSEQS
FT                   PQAWWHATLDAIAAVRAMHPRGFAALRGIGLSGQMHGATLVDRAGQVLRPAILWNDTRA
FT                   AAECVELEALVPESRAITGNMAMPGFTAPKLLWLAKYEPAVFRAAHKVLLPKDYVAWRL
FT                   SGEFVSDMSDASGTLWLDVGRRDWSERMLAATELSREQMPRLVEGSAAAAQLRDALRRE
FT                   WGVAGPVTIAGGAGDNAASAIGMGVANAGSGFLSLGTSGVLFAGNDRFAPNPGDAVHAF
FT                   CHCLPERWHQMSVILSAAASLDWFAKTHDVPVDTLPALAERADASRAPLFLPYLSGERT
FT                   PHNDARARGVFFGLASEHRAGELAYAVMEGVAFAMADGYAALRRAGTTLDDASFIGGGS
FT                   KSAFWAQLCANATGLAMHRHASGAVGAALGAARLARLAATRDALDDVCVAPAIAETYRP
FT                   DPAATGLLGERLERYRRLYRALKAEFAG"
FT   gene            353920..354921
FT                   /gene="dac"
FT                   /locus_tag="BURPS1710b_A0238"
FT   CDS_pept        353920..354921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dac"
FT                   /locus_tag="BURPS1710b_A0238"
FT                   /product="family S11 unassigned peptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00144;
FT                   match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52518"
FT                   /db_xref="GOA:Q3JM06"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM06"
FT                   /protein_id="ABA52518.1"
FT                   /translation="MTTEPLSTTVARGSRRAACALLRTPSRLFASLFVSAACAAPNGAR
FT                   AAPAPAPAIQAASWLVVDADSGKTLGAHNVDARREPASLTKLMTAYVAFDALERDALRW
FT                   DDTVTVAADDIASVGRDEARMYLTPGQRVRVRDLMRGLIVASANDAALVLAKRIGGSPA
FT                   GFATMMNDTARRLGMRDSHFVSPSGITTPDHYSTAHDLSILAQRLNRDFPAFYTFSSQR
FT                   HFAYGAFAKTNKNRLLGADPSVDGMKTGHTNAAGWCMVVTAKRPVGGARARHRVIAVLL
FT                   GEPTEKQRLADARALLDQGFASLGADAPAANAVRRANARPGEHRAQARARML"
FT   gene            355141..356988
FT                   /gene="ftsI"
FT                   /locus_tag="BURPS1710b_A0239"
FT   CDS_pept        355141..356988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="BURPS1710b_A0239"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52576"
FT                   /db_xref="GOA:Q3JM05"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM05"
FT                   /protein_id="ABA52576.1"
FT                   /translation="MRVPRRDARTGHGAGTAIRSRRPASRSPAAVPIRSPSRHLAAQPT
FT                   MPKPAEPLHRRPPLTPAALPRWRSRCVLALLCAGFGALAARALWVQVVRSDFYITQGIK
FT                   RYGHTFEAAPARGRIVDRNGAELAIDEPVADVWIAPDAFRRATHAQMRALASLLGVPID
FT                   TLAAKALGTRQFLYLKRWIAPELAARIERLAVPGVHVAAATRRYYPSGGDAAQLVGFVG
FT                   ADGHGLEGVERTADVALAGVGAKRDMIVDRMGRPVQAGDAASAGVPGADVRLSIDRRIQ
FT                   HLAQRAVERAVARTAAAAGCAIVVDAKTGEILALVNAPTFDPNERTAADDDGRLRERVL
FT                   TDVFEPASTLKPVTVALALSEGVVAPDTRIDTSPGVLDIEGATIHDTGDFGELTVTQII
FT                   AKSSNIGMAKIAERLRAQDMWRTFARAGIGARPLAGLPAVARGTLRPARSWKPIERLTM
FT                   SYGYGLSVSLAQLADVYTAFAGDGSRIPLSLAHAGALAARVRVVPPAVARQIRAMLETD
FT                   GEEGTARIARLPDYRIGAKTGTARKLCGKRYARGKYRALFVGLAPMSDPRLIVAVMIDE
FT                   PSRGSYYGGPAAGPAWAEIMDNALHLLGVPPDRPAARHA"
FT   gene            complement(357374..357592)
FT                   /locus_tag="BURPS1710b_A0240"
FT   CDS_pept        complement(357374..357592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52001"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM04"
FT                   /protein_id="ABA52001.1"
FT                   /translation="MQEMSIEAGAPRDGGAALPRNTAYAGPAQMYGRRRRVRSRAAREG
FT                   ARLRVARAREPAHAAERCGGARRARAG"
FT   gene            complement(357573..361769)
FT                   /gene="fdhF"
FT                   /locus_tag="BURPS1710b_A0241"
FT   CDS_pept        complement(357573..361769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /locus_tag="BURPS1710b_A0241"
FT                   /product="FdhF"
FT                   /EC_number="1.7.99.4"
FT                   /EC_number="1.8.1.2"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00258; match to protein
FT                   family HMM PF00384; match to protein family HMM PF00667;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52871"
FT                   /db_xref="GOA:Q3JM03"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM03"
FT                   /protein_id="ABA52871.1"
FT                   /translation="MTSASVKTVCPYCGVGCGMVLHVEDGEVVKVSGDAEHPTNLGRLC
FT                   TKGSSAHVALRNAGRLERAFVRDARELDPAPVPIADAIAETARRLRATLDAHGPDALAF
FT                   YVSGQMSLEAQYLVNKLAKGYVRTPHIESNSRLCMASAGSGYKLSLGADGPPGSYQDFE
FT                   RADLFFVIGSNMADCHPILFLRMMERVKAGAKLVVVDPRRTATAQKADLFLKIRPGTDL
FT                   ALLNGLLHLLHANGRTDADFIAAHTEGWDAMPGFLADYTPQRVAALTGLAEADIRLAAQ
FT                   WIGDAREWTSCWTMGLNQSTHGTWNTNAICNLHLATGKICRPGSGPFSLTGQPNAMGGR
FT                   EMGYMGPGLPGQRSALDGDDRRFVEEIWGLPAGTIRPDAGGGTVDLFARMAAGDVKACW
FT                   IICTNPVATVANRKNVIAGLQAADVVIVQDAFLDTETNRYADILLPGALWAEAEGVMIN
FT                   SERNLTLMRQALEPPGDAWPDWRIVAAVARGMGYGDAFDYGSAAEVFDEIRRFANPNTG
FT                   YDLRGASHAALRATPLQWPCPPEDGRDRHPIRYLNDGASRPRVTLPDGRVPPLAFPTPS
FT                   GKARFFARPHVAPAEMPTPEFPIVLNTGRLQHQWHTMTKTGKVAMLNKLDARPFVEIHP
FT                   DDAAALSIAANDAVEIRSARGRAVLPAVVTDRVQPGACFAPMHWNDVYGDDLCVNAVTN
FT                   DAVDPVSLQPELKFCAVVLARVDAPDSADAGAHAGAHAAPLHETGSREAQAQAAPRAHE
FT                   AACADAAPEEHDMSDIDTFAALLGVPAATSAPQLTDAQRVYVAGFVSGLRSAEGRRAGG
FT                   VPMLPASAPFDAKARLWLDGLLAGLFSRAPLGAADAVSAPSGVRIVRTRPKVVLLWASQ
FT                   TGNVESLTERYATQLMDSGFEIRVACMSDYPAASLAKAQYALLMTSTFGDGDAPDNGQA
FT                   FWTALAAAGAPRADGLRYAVLAFGDRNYDPFCGHGRRLDARLAELGATRLVERVDCDAE
FT                   FQPAADAWLERAIARIKEEDAALHAVPADGMIPSGAIPTKTRPAASRLVANLRLNEPGA
FT                   AKDTRCVSLSADGAAIEYETGDALGVWPTNCPELVDELLALTRLKPDAPVTVAGMGELR
FT                   LADALAKHLDITRPHPDALAFVASRSRAGDALARLLGDDRKTDLKHWLWGQQLADVLHE
FT                   FPLELSAAELVGMLKRLQPRLYSIASSPSAHRGEIHLTVSAVRYGNGRRQRKGVASTFL
FT                   ADRAADAPVPVFVQKSAHFRPPASGDAPIVMVGPGTGIAPFRGFLHERRARGAKGRNWL
FT                   FFGEQHADTDFYYRDELAQMRADGFLTRLDVAFSRDQTEKVYVQDRMLEQGAALWAWLE
FT                   EGAHFYVCGDASRMAKDVDAALKTIVARHGGMTDEQAADYVARLAKDKRYARDVY"
FT   gene            complement(361813..362163)
FT                   /gene="nirD"
FT                   /locus_tag="BURPS1710b_A0242"
FT   CDS_pept        complement(361813..362163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="BURPS1710b_A0242"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR02378"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53750"
FT                   /db_xref="GOA:Q3JM02"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM02"
FT                   /protein_id="ABA53750.1"
FT                   /translation="MNRQPQASAWTPVCALDEIVPNTGVCALVNGEQIAVFHVDDGGGG
FT                   RAFAIGNVDPHSQAAVLSRGLIGSLGERIVVASPLYKHHFDLRTGECVEAPEKSVSAYP
FT                   SRVEDGYVWVAA"
FT   gene            complement(362201..364756)
FT                   /gene="nirB"
FT                   /locus_tag="BURPS1710b_A0243"
FT   CDS_pept        complement(362201..364756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="BURPS1710b_A0243"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01077; match to protein
FT                   family HMM PF03460; match to protein family HMM PF04324;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51555"
FT                   /db_xref="GOA:Q3JM01"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM01"
FT                   /protein_id="ABA51555.1"
FT                   /translation="MKIVVIGHGMVGHKLLECIAAGAPGALAAPRVAVICEEPRPAYDR
FT                   VHLSEFFAGKSADDLSLVEPGFFERHPNFRLLLNTKAVAIDRAARTVALSTGETLAYDK
FT                   LVLATGSTPFVPNVPGRERAGCFVYRTIEDLEAMRACGARANSGVVVGGGLLGLECAKA
FT                   LRDMGLAAHVVEFAPRLMAVQVDEGGGRMLREKIEALGVQVHTGKNTLEIVDGETGAHR
FT                   MAFADGTHLDADMIVFSAGIRPRDEIARACGLEIGPRGGVAIDERCRTSDEDIYAIGEC
FT                   AAWNGQTFGLVAPGYDMARVVARQLAGGEGAFAGADLSTKLKLMGVDVASIGDAHGRTP
FT                   GSRAYQFADERRGVYKKLVVSECGKALLGAVMVGDAADYGTLLQMMLNRIELPRSPEFL
FT                   ILPQADGAAKPALGVDALPDAAQICSCNNVTKAQLREAVAGGATSLGALKGCTGAGTSC
FT                   GGCVPLVTQVLKAEMKKQGLAVNNHLCEHFPYSRQELYHMVRVERFKTFGALLKKHGRG
FT                   LGCDVCKPAVAGILASCWNEFVLKKEHAALQDSNDYYLANIQRDGTYSVVPRMPGGEVT
FT                   PEGLIAVGEVARKYGLYTKITGGQRVDLFGARVEQLPLIWEELIAAGFESGHAYGKSVR
FT                   TVKSCVGSTWCRYGVGDSVGLAIELENRYKGLRAPHKLKFGVSGCTRECAEAQGKDIGV
FT                   IATEKGWNLYVCGNGGMKPRHAELLAADLDRATLVRYVDRFLMFYIRTADRLQRTSVWR
FT                   DNLEGGLDYLIDVVVHDKLGLAAELEAEMQHVVDTYECEWKRAVTDPATRRRFRHFVNS
FT                   DAPDSTIAFVEARGQIRPVTPDERDAEGQADRQPETETA"
FT   gene            complement(364800..366125)
FT                   /locus_tag="BURPS1710b_A0244"
FT   CDS_pept        complement(364800..366125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0244"
FT                   /product="nitrate transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52304"
FT                   /db_xref="GOA:Q3JM00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JM00"
FT                   /protein_id="ABA52304.1"
FT                   /translation="MSDKATRIELLDWRTVPMRAFHLTWIAFFVCFFAWFACAPLMPLI
FT                   AREFRLSADQVANVNIAAVAATIAVRLVVGPLCDRFGPRRVYAGLLACGAIPVFAVTLS
FT                   HDYLTFLLCRLGIGAIGASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGAGAAQAAMP
FT                   LVVAAALLLGLPDACAWRAALAVPGAAMLVMAIVYWRGTQDCPQGDFVALRARGVTIDS
FT                   GKKGGFASFAAACGNYRVWMLFVTYGACFGVEVFMHNIAALYYVNHFALSLKDAGLAAG
FT                   IFGLLALFARALGGWLSDRVAARRGLDVRATLLFALILGEGLGLLWFAHAGSVPVALVA
FT                   MVAFGLFTHMACGATYALVPFIDRRALGGVAGIIGAGGNAGAVAAGFLMKGVGDIQQTL
FT                   TLLGLFVTVSAFCALAVRFSAEHKAREAALRERALAASGFTH"
FT   gene            366907..367929
FT                   /gene="cobA-2"
FT                   /locus_tag="BURPS1710b_A0245"
FT   CDS_pept        366907..367929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA-2"
FT                   /locus_tag="BURPS1710b_A0245"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52061"
FT                   /db_xref="GOA:Q3JLZ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ9"
FT                   /protein_id="ABA52061.1"
FT                   /translation="MCSVIGNGAGAASQDSFRAVRRRAAPLDNGVPRVRPPRRPGAPDA
FT                   VLFWRGAFVANAPHARHGNTKMNTMGKVTLLGAGPGDLDLLTMKAAKALAAADVLLLDD
FT                   LVDPGIVALAPRARVIRVGKRGGCRSTPQAFIERLMCRYALRGAHVVRVKGGDVLLFGR
FT                   AGEELAALRAARVPVEIVNGISSGFAAAASLGVSLTHRDHCQGVTFVTAHLQDHGEPDW
FT                   ASLAATGTTLAIYMGMSRIERIAAGLLSTLDDKTPAAVVQWAGAPAERRWTGTLGHLAS
FT                   GAAEAGLGSPAVIFVGRAIGEALAIGDAHAAPHANAHALADDAHAALHAAERRRISHAA
FT                   "
FT   gene            368031..368627
FT                   /gene="nasT"
FT                   /locus_tag="BURPS1710b_A0246"
FT   CDS_pept        368031..368627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasT"
FT                   /locus_tag="BURPS1710b_A0246"
FT                   /product="response regulator NasT"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52494"
FT                   /db_xref="GOA:Q3JLZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ8"
FT                   /protein_id="ABA52494.1"
FT                   /translation="MGTTDQPSKLRVLLVTDTDKPIGELRDTLARLGYEMLDEVATPAR
FT                   LPAAVEEQRPDVVIIDTESPSRDTLEQLAVMNATAPRPVLMFSHDADQQLIRAAVGAGV
FT                   SAYLIEGLSAERLAPILEVALARFSHDEQLRQRLAEVESELAERKLIDRAKRMLMDRRK
FT                   LSEQDAYATLRRSAMDQGIRIVEAARRLLAAHSQS"
FT   gene            368645..369706
FT                   /locus_tag="BURPS1710b_A0247"
FT   CDS_pept        368645..369706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0247"
FT                   /product="nitrate transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53233"
FT                   /db_xref="GOA:Q3JLZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ7"
FT                   /protein_id="ABA53233.1"
FT                   /translation="MNTARIKAAAADMPERARLRIGFVALSDAAPLVAAQRLELGARYG
FT                   LTLELCRQPSWASIRDKLLSGELDAAHALYGLVYGVQLGIGGPRADLAVPMVLNRNGQA
FT                   ITFSNRLADAYRASGELKAALATLGRRPVFAQTFPTGTHAMWLYHWLASHGVDPLHDVR
FT                   SVVIPPPEMVGALAAGELDGLCVGEPWNAVAEARGAGRTVAATSEVWPDHPEKALACRR
FT                   EFVALYPNTARLLVRTLLDACEWLDDADHRMKAAAWLAEPDAIGVPIGQIAPRLLGDYG
FT                   AGPFAQPPAPIKFYEHGTVNRPAASDGMWFLSQYRRWGMLSGDVDDAAIANGVAHTALY
FT                   DEAVALGGARRGE"
FT   gene            complement(369990..370622)
FT                   /gene="folE"
FT                   /locus_tag="BURPS1710b_A0248"
FT   CDS_pept        complement(369990..370622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BURPS1710b_A0248"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52498"
FT                   /db_xref="GOA:Q3JLZ6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ6"
FT                   /protein_id="ABA52498.1"
FT                   /translation="MHQTGNERACGAHDQPHAEIRRTGRFDPIAFEAAVRALLEASGIE
FT                   IDSAHTGRTAQRVRELWQRRLLDGYEVDPAQALGAGFDDPREDMVIVRSIAVHGVCPHH
FT                   LLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRYTYQEWITHRIATALVTHGQARGAA
FT                   CLIEAEQLCLLMGENRRGDERVITQCYAGEFERDVQARNEFLRGIHR"
FT   gene            371896..374427
FT                   /locus_tag="BURPS1710b_A0249"
FT   CDS_pept        371896..374427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0249"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52338"
FT                   /db_xref="GOA:Q3JLZ5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ5"
FT                   /protein_id="ABA52338.1"
FT                   /translation="MRRRATGSRRTRQARCASARRASSAFHPARIRPQRQRLNRPGRRR
FT                   LRARRAHGNHRALPHRHAPAHRDPASIRPSRTEHPDSSVIAQCFRRPATPVHRAHRHNF
FT                   PCPRANGGDMQTRLDTRKVFTYLFAFFIAFLASCSDHDDISGGGEPPASALAFRLDRGG
FT                   QINAFYRQDKIAAHLLMRASTKPRLLVVFPAGNSGTGLWFGDTPQPVNWSQDTPIAPVT
FT                   TQDAAGRPLYGIGVDVSADVSNLSIRQALLSSVRFLRDYNGGATVPSDIVVQPSVSDNV
FT                   ATWQRNRVDGAPGYALRVTVLDGGAVAADGTGRLMLQSPSGAPTLRLRVEAFSGETPLQ
FT                   PITHANLFTSAVNPDPQSQNVFEFLSFSDKLLAGSWQYDTYFGRDTLISVRMLMPVLQP
FT                   DVIEAGLGSVLDRLSPDGKVAHEEGIGEFALIDNLKHGRPNDPTPTYDYKMIDGDYLLA
FT                   PIMEDWLIEDPRGQARAAAYLAQKGDDGVTNGSRFVANLLRVARTAQPFAQQALAANLI
FT                   RLRPGEIVGNWRDSTDGIGGGVYPYDVNVALVPAALRATSNFLARGLLDPYLSADQRAV
FT                   LASAGAAADVWERAAPPYFQVAVTPNDARAKLAAYAPQAGVPAGMVPNTALQFDAIALD
FT                   ANGNPIPIMHSDGGFVLLFGNPSPALLARIVTDVMRPFPVGLVTDVGMLIANPAYADPT
FT                   LWPRFTSSAYHGTVIWSWQQAMWVAGLDRQLARTDLPGDVRTLLTQARQQIWQVIANAK
FT                   DMRLTEMWSWSYANGQYRTEAFGTRSTDVTEANAAQLWSTTYLAVRDPQLRAGKYWWEA
FT                   RAAGGDAPRRGSTAAAENAANGLNAVKGAAS"
FT   gene            complement(374971..375993)
FT                   /gene="aphA"
FT                   /locus_tag="BURPS1710b_A0250"
FT   CDS_pept        complement(374971..375993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="BURPS1710b_A0250"
FT                   /product="acetylpolyamine aminohydrolase"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51559"
FT                   /db_xref="GOA:Q3JLZ4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ4"
FT                   /protein_id="ABA51559.1"
FT                   /translation="MLTYFHPDQLKHSPLTYLSRGKMRAPHEVPERAVRLLGAVTSLGF
FT                   DVRAPEDFGAAPLAAVHSEPYLRFLADAHREWRRIPEDWGPEVMSNIYVREPNPLRGVL
FT                   AQAGYYLADGSCPIGEHTYRAAYWSAQSALAGAAALGRGARDAYALCRPPGHHACRDAA
FT                   GGFCYLNNAAIAAQALRARHARVAILDTDMHHGQGIQTLFYDRDDVLYVSIHGDPTNFY
FT                   PAVTGYETERGAGRGEGFNVNLPMPHGSPEAVFFAQLERARSRVERFAPDVLVFALGFD
FT                   VYREDPQSKVAVTTEGFGRLGALVGGLRVPTLIVQEGGYHLETLERNAAALFRGYEAAR
FT                   "
FT   gene            375976..378858
FT                   /gene="rne"
FT                   /locus_tag="BURPS1710b_A0252"
FT   CDS_pept        375976..378858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="BURPS1710b_A0252"
FT                   /product="ribonuclease E"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52542"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ3"
FT                   /protein_id="ABA52542.1"
FT                   /translation="MKISQHAGSLRSTIDRSMRLREGARVRARMRGLHRRRRARRARRS
FT                   RRPLAHAGAREHRAEQHVRARLDVLGQRTLGCVVRQPADARNEHHRARHAAREMNRIVP
FT                   GAAHDPLVRIAAAARGRLDERDARRIERRRRARPVLADVDRDAASPGDLRAHAAQLALD
FT                   RVEPRIVGMAKIDAERDALGDRVARRVVDRALPDRRERVGRMARDERLDRERELGAREQ
FT                   RVLAVRHRRRAGMRGRTRDRRVEPADRLPARDDADRRAVPLQHRALLDMRLEVRIDALV
FT                   QRRERRLQAARPVRAAHPRRAQRIAIAARFERFGKRDAVRIARGERRVERQCAGKHRRA
FT                   EHRRREAHALLVGPRYDLDRLAGDDPAIVQRAHELEPGEHAVRAVEAPPFGLRVEMTAD
FT                   EHGRLRVVRAGAPGEQVADRIDAHRHPRVATPLREAFAAAPVGLGQREPAHAAARGAAD
FT                   SREFRQAVPEPPTVNFPHRDLPPFPESAREHGVGDVGPPMAARVERDHAAERERREARI
FT                   EHRERPPLPGEPVREPRADERRQPARDRAAHLVRDRDRRIAHARRERAAHEARDHRVET
FT                   GEKHGRDRDADHHRREPPRLHEREHRIGRGHREQRGELEKACVAELAAEPRGDRLRHEL
FT                   DDRDDEQAIEDQRFRHAHMLRRERDHERVREIQPRDTDRVRAQAEQQHRARRAQHLGER
FT                   PRDGARHRLLMRELGRFVDLQPHEHADREQRDAREKRQPPAPGHERAVLHRRDRAKRDE
FT                   RQDQPGRAAQLRERSEERAPPIRRMLARHQHRAAPLAAHRDALHDAQQHEQHGREQADA
FT                   FVGRQQTDADRRRAHQRERRHQRLLAADPVAEMAEEEPAERAREEADRERRERRHRARE
FT                   RIVRREEQLAEDERGRVRVDVEVVPLDHRADERGAGRTARLARRRARWDAPGQCVSPHS
FT                   NVRPGRIVRIRQMGVLSRTGINRSNSKLLS"
FT   gene            complement(376024..377403)
FT                   /gene="amaB-2"
FT                   /locus_tag="BURPS1710b_A0251"
FT   CDS_pept        complement(376024..377403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB-2"
FT                   /locus_tag="BURPS1710b_A0251"
FT                   /product="N-carbamyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53675"
FT                   /db_xref="GOA:Q3JLZ2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ2"
FT                   /protein_id="ABA53675.1"
FT                   /translation="MWEIDGRRLWNSLTELARIGGTARGGVRRLALTEADRRGRERFAQ
FT                   WCRDAGMAVRVDAIGNLFARRAGADDTQPAVLVGSHLDTQPEGGRFDGAYGVLAGLELV
FT                   RTLNDRGIVTGKPIEIVSWTNEEGVRFTPAMLGSAVFTGALPLDAALAARDADGIALAE
FT                   ALEACGYRDALRSAWMRGAHGARGLEPALAPLHERVDAYFEAHIEQGPVLERHGATIGV
FT                   VTGGQAIRWLDATVTGAAAHAGTTPMPYRKDALFASAELALAIEALVARHAPDALATIG
FT                   QSAIDNASRNTIAERVTFSIDLRHPDDARLDAIERELRRVCAQIAGRRGVAVDISQHWS
FT                   SPATPFDPACIALVEAAARGGGYAHERIVSGAGHDAVHLARCVPSAMVFIPCVGGLSHN
FT                   AAERALPEHVEAGANVLLGAVLARAGVRERAARSARSPRPAPAMQAAHSGTDAGTFAQP
FT                   H"
FT   gene            complement(377428..378762)
FT                   /locus_tag="BURPS1710b_A0253"
FT   CDS_pept        complement(377428..378762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0253"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53244"
FT                   /db_xref="GOA:Q3JLZ1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ1"
FT                   /protein_id="ABA53244.1"
FT                   /translation="MRRNALTRGIPPSPPARQPRRAAGAAFVGTMIEWYDFYIYANAAA
FT                   LVFGELFFPSHDPFTSTMASFATFAVGFFARPLGGLFFGHLGDRIGRKKALMATLALMG
FT                   AATVCVGLLPTYERVGLLAPVLLVLLRIVQGIAVGGEWGGAVLMAGEHAPYGRRTFFAS
FT                   FAQLGSPAGLILSLVAFRAVASMEHGAFMSWGWRLPFLASIALLAVGVFVRLKVDESPE
FT                   FAHEKAMSRTVARPLAEVLRTSRAMLLFCLCANTIGIAGLYFTNTFMIAFTTQHVGVTK
FT                   SLILDCLFIVAIIQFVTQPIAAWLGGKLGDARFLKLAALFAMASPYPMFALVQTGRLAP
FT                   MVIGIAIATVFLAGFYSVIAGFVSGAFPTRVRYSAISISYQMCGAIAGGLTPLVGTWLA
FT                   HRFAGQWWPLAVFYTCLAALSLGGVIALDARRHRRADVADAVLTR"
FT   gene            378918..379889
FT                   /locus_tag="BURPS1710b_A0254"
FT   CDS_pept        378918..379889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0254"
FT                   /product="transcriptional regulator, LysR family,
FT                   frameshift"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52110"
FT                   /db_xref="GOA:Q3JLZ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLZ0"
FT                   /protein_id="ABA52110.1"
FT                   /translation="MSNIRSHVSRVLMDRLDWNLLRTYLTIMQERSISRAAARLHLTQP
FT                   AVSQALKRLEDSLGRTLIQRRGAQFQPTRAGEEVYRIATDIYGHMSRLDNELDDRGGEL
FT                   IGSVRLLCVSRVESPVYDEFLAEFRRTYPRVDLHVEVMRSADILSSLLQKTATCGLALC
FT                   RTPVDKIELRSFLRQRYAMFCGRHHRLFGRQALKIEDLLAENFVSFTSDQIGDALAPLT
FT                   VFRDQRGFTGRIVATSPSLDEIRRLVFAGYGIGCLPEHIVRDDLARQRLWRLPPEEGLL
FT                   DVEIFLMWNRERRMNAAENVFIDAFQRYVQRYPMAERLGMLH"
FT   gene            complement(380533..381540)
FT                   /locus_tag="BURPS1710b_A0255"
FT   CDS_pept        complement(380533..381540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0255"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51387"
FT                   /db_xref="GOA:Q3JLY9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY9"
FT                   /protein_id="ABA51387.1"
FT                   /translation="MDRFQEMQVFVRIAERQSFSRASDDLRIPRATVTNLMKRMEARLG
FT                   ARLLERTTRTVRLTQDGEAYYRRCVRLIADLEEAEGAFRAAAPRGLLRVNLQGTLARYF
FT                   VVPALPDFLARYPGIRLHIGEDDRFVDLVREGVDCVLRSGNLQDSSMVGRRVAQLEQVT
FT                   VASPGYLARHGEPAELAALAAHRAVDYVSSATGKPMPLEFTVDGRVTEVRLDAAISVAG
FT                   VELYTGAAVAGLGIVQVPRYRIADELADGRLRIVLGAYPPPPMPVSVLYPHSRQLSSRV
FT                   RAFAQWLRERFDAAQAGAGDGACGAPGSSGSAARAPSPARSEPAKALLSRRPRR"
FT   gene            381664..382407
FT                   /locus_tag="BURPS1710b_A0256"
FT   CDS_pept        381664..382407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0256"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52073"
FT                   /db_xref="GOA:Q3JLY8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY8"
FT                   /protein_id="ABA52073.1"
FT                   /translation="MNATPLTRVALVTGASRGIGAAVARRLARDGFSVAVNYASSGAEA
FT                   DALVAELRAGGAAALAVRADIGRADDVRRMFDAVERQLGRVDVLVNNAGILKTGPLADA
FT                   TDDAFDRIFDINVRGTFNTLREAAKRLADGGRIINFSSTTLALKLPGYGLYNATKGAVE
FT                   ALSHVFAKELRGRRVSVNVVAPGPVATSLFLEGKTDEQIQGYAKMPPLERLGEPEDIAG
FT                   VVSFLAGPDGGWVNAQVLRANGGLA"
FT   gene            complement(382717..384135)
FT                   /gene="caiB"
FT                   /locus_tag="BURPS1710b_A0257"
FT   CDS_pept        complement(382717..384135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="BURPS1710b_A0257"
FT                   /product="CoA transferase, CAIB/BAIF family"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51349"
FT                   /db_xref="GOA:Q3JLY7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY7"
FT                   /protein_id="ABA51349.1"
FT                   /translation="MFDLAASSHTEPSGHARAAAYLRDIWQAANGDPEWLRTLAFGGAG
FT                   VLPSAFPVTDFASAAIGAASVALAEFVHRATGRLPGVRVDRRYASLWFGTSLRPRGWNM
FT                   PPLWDAIAGDYRTADGWIRLHTNAPHHRAAALAVLGAPPERQAVARAVGQWRGDALESA
FT                   VVEHGGCAAVMRTEDEWARHPQGRAVRAEPLMIHDDVSIDGPRPAWPMSAERPLRGVRV
FT                   LDLTRILAGPVATRFLAGFGAQVLRIDPIGWDEPGTVPEVVLGKRCARANLACADGRAL
FT                   LRRLIGEADVMVHGYRPGALDRLGFDADERRRINPGLVDVSLDAYGWSGPWRGRRGFDS
FT                   LVQTSAGIAAAGMREAGADRPVPLPVQALDHGTGYLLAAAAIRGLVRRLATGAGTSTRA
FT                   SLARTAVLLTSGGLQEAGRQPIAPETAGDLDAWIEDTSWGPAQRVRAPVTIECAPVQWP
FT                   HPARALGTSPAEWA"
FT   gene            384762..385169
FT                   /locus_tag="BURPS1710b_A0258"
FT   CDS_pept        384762..385169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53566"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY6"
FT                   /protein_id="ABA53566.1"
FT                   /translation="MSRVACRVSRVACRVSRVAGGASPGCAAREAHASARARRAVSAPP
FT                   GSRSRASRHRPAAPWRAVVPPHHAHERQHVGDLPDVDRISIGCRSSGGVRRAMPKDLDS
FT                   TPAARARSDACRTGRACLRTHGFARTRARRT"
FT   gene            complement(385166..386203)
FT                   /locus_tag="BURPS1710b_A0259"
FT   CDS_pept        complement(385166..386203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0259"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53583"
FT                   /db_xref="GOA:Q3JLY5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY5"
FT                   /protein_id="ABA53583.1"
FT                   /translation="MPQTKTTNRRIVLHSRPKGAPTPENFRTETAAVPVPAPGEVLLRT
FT                   IWLSLDPYMRGRMSDAPSYAAPVELGGVMVGGTVSRVVSSSVPAFRDGDLVLSNAGWQD
FT                   YAVSDGTDLMPLADVAHPSYALGVLGMPGFTAYFGLLHIGEPKAGETVAVAAASGAVGA
FT                   VVGQIAKLKGCRVVGIAGGADKCRYVAGTLGFDACVDHHDPDFAKQLAAACPDGIDVYF
FT                   ENVGGAVFDAVLPLLNDHARVPVCGLIAHYNDSELPGGPNRLPLLTSSVLRKRIRMQGF
FT                   IILDHYADVYPAFLKDMSEWVAQGKVKPREDVVDGLDAAPRALIGLLGGKNFGKVVVRV
FT                   GPDTL"
FT   gene            complement(386268..387833)
FT                   /locus_tag="BURPS1710b_A0260"
FT   CDS_pept        complement(386268..387833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0260"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53242"
FT                   /db_xref="GOA:Q3JLY4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY4"
FT                   /protein_id="ABA53242.1"
FT                   /translation="MRCDACSGASPRPSSSATRGGIEIGLADGSLARTPRSRRASCCCG
FT                   DALRALPRRSERGSGTCSAAATALETARATTLQWRMCRRGAVARPRRREDGGKGSAAYE
FT                   AARSKSRKARRAWVCLICGSILDDWSTFDGANMLNFDFYNPTRIVFGEKTAARLNDLLP
FT                   AAARVLVLYGGESARSNGTLDEVRAALGARDVREFGGIEPNPAYETLMRAVELARRERV
FT                   DFLLAVGGGSVIDGTKFVAAAVPFEGDPWTILETHGANVAAALPFGCVLTLPATGSEMN
FT                   NGAVLTRRATRAKLAFRHPLVFPTFSILDPTKTYTLPPRQVANGVVDAFTHIVEQYLTY
FT                   PADGLAQDRFAEGLLQTLIEIGPKALAEPRDYATRANLMWVATLALNGLIGAGVPQDWA
FT                   THMVGHELTARYDIDHARTLAVVLPSMLDARRDAKRAKLLQYAARVWNIVDGPEDARID
FT                   AAIARTRAFFESLGVKTRLADYGVGADAIDGLIAQLEAHGMTRLGERKDVTLDVSRRVL
FT                   EASL"
FT   gene            complement(387883..388044)
FT                   /locus_tag="BURPS1710b_A0261"
FT   CDS_pept        complement(387883..388044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY3"
FT                   /protein_id="ABA53101.1"
FT                   /translation="MSFEAYFDGYFGDCLAHCDVRLAAPAGPERLMHGGRNGPNAQCVA
FT                   DPPGGVRR"
FT   gene            388934..391123
FT                   /locus_tag="BURPS1710b_A0262"
FT   CDS_pept        388934..391123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52085"
FT                   /db_xref="GOA:Q3JLY2"
FT                   /db_xref="InterPro:IPR019503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLY2"
FT                   /protein_id="ABA52085.1"
FT                   /translation="MRLSCAGSRVPRRRHLESQSNDECASVFPAIVAPARPAARRTMGN
FT                   GERPPARRPDSSGSPPPAADAPAASNHPFSSHDTKHMTSRRLASRTAVAASLSALMLAA
FT                   CGGDDSANAPTAGGAAPLTPAVASPAGPTGSTPGSTPGATTAPAPSSTSAGQLSVDKMA
FT                   FAQTHVVPSGGLSWTLPNASASLRPISRRDALVLVAIGQADAVQPVLEAWKDGAKLGAL
FT                   ALSPPSALPPTESGGRAYANDRWSAVVPAAWMVPGVSFSVSASNYTSSVAQAPVFGTDA
FT                   DVQLTILPFYLFGADDTNSPPLSTTQAPDAATQQEIFAKWPTAELKVRTHPAGRFSLAT
FT                   VVVGPRADRTGAAQPAYPVTALDQQKDGYGVMSAMLTLITNMRTANGDGPLNNQYYAPL
FT                   IALNSNGQFANLGGGLGGVGSGAAVGDHRYTGIFIHEQGHAFGLNHAGDEYAKGAYPYA
FT                   GGSLSGSVWGYDPNHREFLDVLVPTTASSYAKCASSHQLDAQGRCYKQDPMQGGAGDQS
FT                   SGYKFATFSDYNTGRMQAWIASRVLADPASSTGYSKWDSAAQARAPYTPTTDNNGLYGV
FT                   NQNLPVQAGVPVHTIVVSFSKAGSAGASYIYPPFSYTGNLIATFDPTSAADRQAITVDK
FT                   GTYPWYCKGTGCDYTLRVTYADGSRTYRVLQGGFRAWWTPTVDDANATNPLSGSSFRVW
FT                   AINVPGDKRIGKIELLDTPMVWNGMPANPTVLLSR"
FT   gene            complement(391358..391690)
FT                   /locus_tag="BURPS1710b_A0263"
FT   CDS_pept        complement(391358..391690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51224"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY1"
FT                   /protein_id="ABA51224.1"
FT                   /translation="MIQPTEVFKDNLAQLPAIDGIERIDLVDGGGAVVASIENKPGKQG
FT                   SLAVYHYLREAFGTLDAQAAAHGLAVFAEHTADARNRPGAHPNVDRLLAIAAGGEALRI
FT                   DVLARG"
FT   gene            391765..392742
FT                   /locus_tag="BURPS1710b_A0264"
FT   CDS_pept        391765..392742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53399"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLY0"
FT                   /protein_id="ABA53399.1"
FT                   /translation="MLGRAAAAAAPRSLADAPPATPERAPIPSSRIAPKPPVARSTSRT
FT                   PAHASPTCKLLPFFDIDTRRMMQVPQRSALGGPTLIRLLARLAHADVPPSGQSLSDRLS
FT                   QWLAWTDAIALSSALSMSPPAAAAGARPAGDDPHGQGARVRASLAKAIARTGAFAAGRD
FT                   GAARVAARGAPHDTPADFTLFRHDYLSMQQAMEIDIGELRGRLRQTMAAQTPALARLAA
FT                   LDATMERALVARERSLFASVPKLLGAYFERLREAEQQRLAEAEAKAHANAEADAHAEVA
FT                   RKTAAPAPHAWLDAFRQDMQSVLLAELDIRFQPVDGLLAALRAS"
FT   gene            complement(392306..395149)
FT                   /locus_tag="BURPS1710b_A0265"
FT   CDS_pept        complement(392306..395149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX9"
FT                   /protein_id="ABA51357.1"
FT                   /translation="MRDELVVRFAERLDGRAERVTEARDLDRAARDLRGDPAEPVGLRA
FT                   DLVGELRADALQQRRGRRDERVDGRALFARRVIDRIEQGFERREHPVALFEHRGVADHA
FT                   VGELLAQLGDDFGRDPRRFRRGLHEPRDLGDRGARVRLRVRGEVARGVRERIVDRLLAV
FT                   CRLRAGLRPLGAELRGDRAERIGPCGQTLLVARFERCLQSRMRFAHRAQQRSGMLLERR
FT                   GLSGEVARGVRERIVDRLLAVCRLRAGLLPFGAELRGDRAERIGPCGQTLLVARFERCL
FT                   QSRMRFAHRAQQRSGMLLERRGLSGEVARGVRERIADRLLAVCRLRAGLRPLGAELRGD
FT                   RAERIGPCGQTLLVARFERCLQSRMRFADRAQQRRGMPLERRGGRFQRLPVALGVCFVR
FT                   LLLLRERAAPRVGHAACRRVEARAHAVEQIRGAPVERFDDPVDRAVQALRERVARALMI
FT                   GERVTPDVRDVGRRRLESGRQPVELALHGLRERIVQRGRLARESGHRRLHHGLQRRAGH
FT                   PRAFRDAVRQRLADRRSETRVRLLGLAEKCLLAGDLPLGRGGALLLERMHHRLQPLDER
FT                   RHQVGLPLQQPEGFVALMRVRMHAQRRRDLRVERLRGVEPLAPAKRRQQAEHRRRRHPG
FT                   DRRAEREAEPLHGRGERRADRLQIGRAFERGAGAPQRHHHPDERAEHAEQHEQADQIRR
FT                   QRGARQRDALALDAHAHRVAQARMQPFEPRTERSGRLGQRRDRLRERRRGLPVAAQFER
FT                   AGEIAGGDHQRDGERDGIRDGIAGADPADRGEAGEKDDEMNVKSGHGSPVSWREGRRAA
FT                   RRPVENECLARRAARFAYPGGTRRAMRAARGRRFFLRPRRAHRPRRLREPSPRPRQDAA
FT                   ARPRASARSTRRAVSARTRRGCAHARRARAPSSRRARRAGRARAFARPSSAEGGRAARR
FT                   CRSPWPAASIGNRAERA"
FT   gene            392753..395329
FT                   /locus_tag="BURPS1710b_A0266"
FT   CDS_pept        392753..395329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05650"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52164"
FT                   /db_xref="GOA:Q3JLX8"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX8"
FT                   /protein_id="ABA52164.1"
FT                   /translation="MSRFHVHLVVFFAGLAAVCWIGAGYAVSNPVALAVTLVIAAGYLA
FT                   GALELRRYRQATSTLAQAVAALSEPPAALGAWLERLHPSLRHAVRVRVEGERVALPGPA
FT                   LTPYLVGLLVLLGMLGTLIGMVMTLRGTGAALESSTDLQAIRASLAAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALCRRERLDAAQALDAKIATTLRVHSHAHQRDETFRLLQRQADLM
FT                   PTLVERLQAMMHSLEQQSAASAERQIAGQQAFLGKAEETYARLASSVGQSLTDSVAESA
FT                   RVAGSALQPVMETTMAGLARETAALHDALTQAVQRQLDGLSAGFETTAAHVADVWRHAL
FT                   ADHQRSSDALAQRLHGSIDRIVESFDRRSADLLDGVRARLDATASSVSDAWRGALAQQE
FT                   QANEAHAERNRQALETAAATFERHSAALLRTIGESHSALQATLESRDEQRLATWTDSLG
FT                   SIAAKLGAEWAQTSAQAANRQQAICDALAHTARDLSAQATAFEQHTAALLRAMSESHSA
FT                   LQATLESRDEQRLATWTDSLGSIAAKLGTEWEQTSAQAANRQQAIYDALAHTARDLSAQ
FT                   ATAFEQHTAALLRAMSESHSALQATLESRDEQRLATWTDSLGSIAAKLGAEWAQTSAQA
FT                   ANRQQAIYDALAHTARDLSAHTQAHASATIAEISRLVQAASEAPRVAAEVVAELRQKLS
FT                   DSMVRDTAMLEERNRMLATLETLLDAVNHASSEQRAAVDALVATSSALLQRVGTQFTDE
FT                   IGTQTDRLGGVAAQITGSAVEIASLGDALGAAVQSFGESNDKLVAHLQRIEAALDKSLA
FT                   RSDEQLAYYVAQAREVIDLSMMSQKQIIEELQRVGGERASAGAAAA"
FT   gene            395326..395973
FT                   /locus_tag="BURPS1710b_A0267"
FT   CDS_pept        395326..395973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0267"
FT                   /product="ompA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51659"
FT                   /db_xref="GOA:Q3JLX7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX7"
FT                   /protein_id="ABA51659.1"
FT                   /translation="MSDEIDGGIEQTAPIWAAFGDLMSVLLGAFVLILVGVIGVQLELS
FT                   SKLDAEVRQRQLESQRRKTLEQALAAPLAAGRVTLVNGRIGISGSVLFALNSDELQPAG
FT                   RDLLKSLAGPLAAYLNANHEILMVSGFADDLQVRAGNRRFADNWELSAKRALTVTRAFI
FT                   DEGVPASSVFAAAFGSEQPVSPNSNDAGRAKNRRVEIAPVPRPTTGDGERRG"
FT   gene            395957..396814
FT                   /locus_tag="BURPS1710b_A0268"
FT   CDS_pept        395957..396814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51685"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX6"
FT                   /protein_id="ABA51685.1"
FT                   /translation="MSAVDDVAARAQHTLDAWRERGADRLDPVRFRFIDALRRRAAAHG
FT                   GDARRLLDARLAALIDAYAADLRRAESNGDACECAGAPAPAPAPAPAPAPAPAPAPAPA
FT                   SSSSSSSSTSPAPTPAAPSTTTTSPAASSPADPARGPLAALLDYIGSRERPTASAPDET
FT                   RAAPASSTASGRVALRAEPALLDYFRETWSKLSADSQLRASLEQVPKNAGPLNSSSLVH
FT                   RSLSLMRELSPEYLRQFLSYVDALSWLQQMNGDEAATGDEAARGAVGGGGGASAKKNTR
FT                   KRSR"
FT   gene            complement(397100..400348)
FT                   /gene="dhbF"
FT                   /locus_tag="BURPS1710b_A0269"
FT   CDS_pept        complement(397100..400348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhbF"
FT                   /locus_tag="BURPS1710b_A0269"
FT                   /product="nonribosomal peptide synthetase DhbF"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53607"
FT                   /db_xref="GOA:Q3JLX5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX5"
FT                   /protein_id="ABA53607.1"
FT                   /translation="MQHIDTGLRLAMNMRDTSLRPLLPAQREIWLAEQLRPGTGVYNTA
FT                   GYADIVGAVDHGALRDAFGHAMREADAVRATFSVHGDDAWQTPRDAPHADVPLVDVSGQ
FT                   ADPAGVALAWMMRDMRTPPDFAAGPLARSALLRVGAARFFWYVCAHHIVADAYGTALVV
FT                   QRTAQLYGARVRGAAPPPAWFGTLDALIDEDRTYRESAAFADDRDYWRARLAAAPEPRS
FT                   LSPVALPGQFAPAGDFHRQWGELDAATSDGLRAMARAGAQGMPPLVAAMMAAYVHRFTH
FT                   ERDIVLGLPVMARLSRATRKTPGMVANVLPLRFAFDRGTTFAALHAQCAAEMRASLRHQ
FT                   RYRGEAMLRDAQQRRPAERLHAQNVNVMAFERALAFGDCPARSHSLSNGPVDDFSITVY
FT                   DDGARQPIRIAFDANAARYASGDLAAHRERFLRLGVALANAAQRPIADAQWLTPAERRT
FT                   LVGERGTPAPDAGEPFDTIAARFAARAAERPDAIALVDRGRRITYGELNARANRLAHVL
FT                   IEAGVGPEALVGLHMPRSAELVVGMLAILKAGGAYVPLDPAYPASRIEFMVADARPMLS
FT                   ITTGEHAAQLPARTPTIVLDAADAQAALRRAPAHDPVRPAPLDREHAAYVIYTSGSTGK
FT                   PKGAVVSHRNVIRLLDGTRGWFDFGAAQTWTLFHSFAFDFSVWECWGALLTGGRLVVVP
FT                   YDVSRSPAEFLKLLVDERVTVLNQTPSAFRQLMQADEAHADLSARLALRYVVFGGEALD
FT                   ARSLARWYERHADTAPRLVNMYGITETTVHVSYLALSRAIAGMPANSLIGRPLPDLRVY
FT                   VLDAALRPVPAGVPGEMYVAGAGLARGYLRRPSLTAQRFIADPFGPPGTRMYRTGDVAR
FT                   WRADGGLDFIGRADEQVKVRGFRVELGEIAARLACDPSVAQAQAVVRQDGPAHERLVAY
FT                   VVPRAGATIDVCALRASLAAEMPEYMVPAAIVALDAMPLTPNGKLDRAALPAPIVTGTS
FT                   RRAPENRIEQQVCAMFAELLDAQTLGAEDNFFELGGDSLLAMRAINKLRQTFDVELTIR
FT                   DLFSAPTVAALSMRLDAQLAARRAHADGAELPAG"
FT   gene            complement(400395..400601)
FT                   /locus_tag="BURPS1710b_A0270"
FT   CDS_pept        complement(400395..400601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0270"
FT                   /product="mbtH-like protein-related protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52525"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX4"
FT                   /protein_id="ABA52525.1"
FT                   /translation="MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQ
FT                   ACLDHIEAEWTDLRPRSVAARCA"
FT   gene            complement(400620..401909)
FT                   /locus_tag="BURPS1710b_A0271"
FT   CDS_pept        complement(400620..401909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0271"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52098"
FT                   /db_xref="GOA:Q3JLX3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX3"
FT                   /protein_id="ABA52098.1"
FT                   /translation="MDLHERTLDAPGAPAAAAHGAGSRLSREVWIILLTLAVDAVGLGV
FT                   ATPVLPDLLRAVGERPAHVPVMLGSLITCFYFMQFVFGPIVGALSDAWGRRPILLIALG
FT                   GGALSYAIGATARSYGGLLAGHMLAGIAASSAAVATAYLADVTPPALRARRFALASSVL
FT                   GLGLIAGPAFGGVLGALGPRVPFVAAGAIAALNFVSAACFLRESLPARRRVPVSWARAN
FT                   LFGSLRLVREDRVFRDLLAAVCLGMLAYGIYLSCFVLANAARLGWGPRENGLALAGLGL
FT                   GITLTQTLLLPRLVARLGEHRTALVGFGAFVLAYGLYSRADSVALVAAALAVHALSLIS
FT                   DPSVRSLISVHAGPQRQGEYQGALVCLTGLASSIAPLVGGNLFAFFTRAGASTYFPGAP
FT                   FLAAAVLYALAMLAVWRAMAGAARRRSASH"
FT   gene            complement(401914..414633)
FT                   /locus_tag="BURPS1710b_A0272"
FT   CDS_pept        complement(401914..414633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0272"
FT                   /product="thiotemplate mechanism natural product
FT                   synthetase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00501; match to protein family HMM PF00550;
FT                   match to protein family HMM PF00668; match to protein
FT                   family HMM PF00698; match to protein family HMM PF00975;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52337"
FT                   /db_xref="GOA:Q3JLX2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX2"
FT                   /protein_id="ABA52337.1"
FT                   /translation="MNHRLPHVERGDADEPSIETAAGEPPPLALPASVAQRRLWFVENG
FT                   DVRASTYNVPAAFTLTGPLDDAVLERALAFMQQRHPALRSRFRTRDGELRIELAPQPAP
FT                   LARQDLGALDADVRARTAERLCANHANRRFDLERDAPIRCLLLRLGENEHVLAVNVHHI
FT                   VFDDWSIRIFFRELGAVYGALLAGATPDLPALDYAAAVAASVPAAARHAAARQYWARAM
FT                   SGAPTLHKLPTDRPRPAEPRMRGAVHKHVFARRHAEGIRALCRRAGVTPYMLGVAAFAA
FT                   LLHRYSGEDEIVIGSPFANRVTQAQQSLIGFFINLIPLRVRFDAGVNFLDLLAQVRETS
FT                   FDAFEHAVLPFDQIVDAIRPPRSSSHAPVFQIMFDYLKSGGMLELDGVGVTGSLVHTGT
FT                   AKYDLTVSMEEGPDELAAIVEYDTDLFDAGTIARLGGHFERLLENVLASPAAPIAEGSL
FT                   LPADELRQVRRFTRPDEPYAHIPFSPMPQRIREAARRAPHAVAIVHGDARMTYETLDRR
FT                   SDALARALRARGVGRGSRVASLQSYSEKIVVAYLGILKAGAAYLPLDPADPRRLEKIED
FT                   AAPAMIVTARRDLEDVPQALRARTLTIDDPIECGKAPDAVNDAVNDVATDVVTDATARD
FT                   AELDFATLAEADPAYVIYTSGSTGKPKGVEVSHGSLNVSYHGWHRAYRFGKPGHPVTLQ
FT                   LAGMTFDLGIGDVSRTLACGGTLVMPPRDGLLDAGRLHALMRAERVSFGDFPPVILREL
FT                   IRHCNETGDRLDMLDTLVCGADVWFGHELRAARALCVPHARVLGSYGVTEAAIDSSYFD
FT                   PDLHALAPDSVVPLGRPLPSCELLIVDPLLQMTPIGVPGELLVAGPAVATRYLNNDALT
FT                   AQKFLRGRVDEHGRVIAGDGQTRFYRTGDICRFLEDGTIDFLGRRDNQIKIRGFRVELG
FT                   EVEGVLAAHPDVRQCAVVVRDEASGDPSLAAFVVSDAPIAALRGYLRGRLPAYMLPAAI
FT                   ERLGDMPLTASGKIDRNRLKAWPLSAPDVPPPDAATDVERRLLALWENLLSARVPSVHE
FT                   NFFQCGGHSLAAARLASSISQAFDVSIGVSSVFNHPSVAEQARLVEALASARAPRDARQ
FT                   TAHADAAEPAGDDGLLSYSQQSLWLTAKRTPDDFSYNIPVTWRLDGPLDAHALERAIND
FT                   VVARHDALRTVFSSDVRTVVGPHRESSQEPTQRVLDTLTIALRRVAVAPDDAASLPARL
FT                   REAHSRAFDLNAGPLLRAVLFEIAPTHHVLDVTIHHIVIDGPSFGLFWRDLQTAYRARV
FT                   AGEAPGWQRPARRHADFVSRQRQALRGEAAARQLAYWREQLSGLPAALPLPDAVLAAHA
FT                   PGSARSLTFEMPDDVAAGLAALARRTNGSPFIVYLALFAAALRQQTGEADFAIGTPLSL
FT                   RPHEGFADVLGFFANTMPLRMRLHGLDTFERVLRYVREQCLALYENGDVPFEYLVQALK
FT                   PARAARRNPVFQTIFSCEFDDERLQLTGVDAHALALDAYTAKLDLEMAINVSGGRVVCH
FT                   LMSRPGSFDADALSSIRHHFLRTACSATRAHAEREAAEARATHEVHEVHEVHEVHEMHD
FT                   VHEARAQLADDAPGARRPSADDLFGLFARSAARHAQRVALDSPTLRASYAQLAERVSAA
FT                   ARALAAHGVRRGDRVGIFVGHHPHNVTAMLAIARVGAAFVPMDPEHKPQWNRHIVDDAA
FT                   LTALVGGAWTADAARGFGLPVVDLDAPPPPASELADAPAAGGAHPDDCAYVIYTSGSTG
FT                   RPKGVAVSHASVCHNVRAMAEIMRIGPQSRMAQYVSPVFDVVLGEIFPALAAGAAIVFA
FT                   ERRRPLPGQALVDWLDAQRVSHVWIVPSALAMVPEAALPALEVLIVAGEACPRELAQRW
FT                   AAGRRLLNGYGPTEAAIVVSLTDYHAQRERLILRPMGGARLHVLDEALRPAPAGAAGEL
FT                   FIGGACVAQGYLGQPARTAQAFVADPFDAEPGARMYRTGDVVRRLDDGAIQFIGRVDRQ
FT                   VKIRGFRIELDAVRAALMEVPGVQAAEALAQPDASGQPLLVGYVVARRAKAELLDALRG
FT                   KVPDAMVPSTLVFLDALPTGSTGKTDLKALKALKTGDAARPAAAAADMPRAASQGRTLH
FT                   RVREIWRTLLERDDIGDDENFFDAGGHSLRAVALHQRITEAFGDVIALTDLFEHPTIGA
FT                   LAAHLDAFAPRDGEAADDAAGAAARAPADGVLDTDAIAVIGLAGRFPDAPDLDRFWERL
FT                   LAGYEAGRTLSDAELDAHGVPAELYRNPHFVRRFKELEGKAEFDAGFFGYSPREAQVMD
FT                   PQQRIFLELAWQALEQAGYGDRGRVRSVGVFASAAFNYYLVQNVMPNAERLRLEPGQWL
FT                   IGNDKDFIATRTAYKLNLLGPALSVGTACSSSLMAVHLACASLRNGEAQMALAGAVALD
FT                   PDQVGYLYAEGGIMSPDGRCRPFDAAAAGTAGGSGGGVVLLKRLDAALRDGDTVYAVIK
FT                   GSAANNDGADKVSYTAPSVAGQTAVIRDALRAARVSADSIGYVEAHGTGTPLGDPIEVR
FT                   ALAQAFAEAAAPGALANGRCGIGSIKGNIGHLDAAAGIAGFIKAVLALHREAIPPSINC
FT                   ETPNARIGFDKTPFSVVREARAWPRTATPRRAGVSSFGVGGTNVHVVLEEAPRVRAGES
FT                   AEPSRWQLLPVSARSPSALREQWRQLRDALAHARPRVQDVAHTLQVGRTAFEHRGFAVV
FT                   DAAADAPAQLDAAGSPPAFERRAAPPVVFMFPGQGSQYPGMGAALYRSGGVFQAEVDRC
FT                   AQLLRAHLDRDVRSLMFDAGASLLRETRYTQPALFAIEYALARQWLAWGVTPHAMIGHS
FT                   VGELVAAAVGETLALPDALALVVARADAMQRQPPGAMLAVLADARELAALNGPGCEIAA
FT                   INGPEQYVLAGDAARIAALEDACIAAGVACQRLATSHAFHSSAMDGAAREIDRASERIV
FT                   RRAARIPLISNRSGRWLNEQDLRDAGYWGEHVRQPVQFHAGVRTLLDALDAPIFVEVGP
FT                   GRALGNLIGGWAGLGPQRIVATLPHARERRDDMAAALRGVGTLWAQGVDVNWAGLHAPG
FT                   AARRIALPTYPFERTRHWIERPAGARAAPAREADGVPMRRGEDAADGSLTVSFALHERL
FT                   WFLDEHRIFDGAPVLPGTACIELVRRAYSLVRPGAAVTMRDVYFPTALILSTDESRNVR
FT                   VVFLPPERVSDGAAAGGDLAFVLESNDANGPAGWTPHASGRIGDDPPACAAPASLAALA
FT                   APASLAALAALDAPAALREQWGLTALDDVAALSAQAFADYGARWRGVDALWLGERAGLA
FT                   RLRLPAAGSGDLPDFALHPAMLDVATAFLPACLRPRDASVPFRYESIRMHRPLRADCYS
FT                   FAVETAPNVYDVTLFAWDEAARRADVLVAIGGFARREPAHRTRDVAQWCRTVSWRDAPA
FT                   ARALPPERWLVFGDEWFALAPAGSVLVREDDAFRAHGDNGYGVRPGEKVDCDRLIARLA
FT                   EQGGVPAHVVYGWAQTDVDRAFAGLAALLQALGEHPADFRVSLVTKGARSARTLDACAA
FT                   AAPAGLLKAVRWEYPRIVCRHIDIDDASDATIDALRAELSSEPATPPGAPPELPSSIAL
FT                   AGARREAPGFAALPAVARDDVLRDGGAYLITGGASGIGLELAAHIASRRRDVRLALLSR
FT                   SPHDENAARFAALDEAAASVLRLTADVAHAAQLADALRTVRARFGRIDGVIHAAGVEAS
FT                   GLLETGTPDAWRRVMAAKVHGARHLFDQLAGDPPDFIVLCSSLAAVVGGLGQADYAAAN
FT                   GYMDALAQHWRQRGVAAIAIDWDTWSDTGMAFDHAARTRRSNDRPGALPGLANREGRAL
FT                   FDLALAHDASRIVISKRGFEQDRRDAPTRARRAAAPGDAQAALVALWQELLGVEQVGVD
FT                   DDFFDLGGHSLLATQLISRVRDQYARSPTLGEFLEEPTIARLLRAIDHTGGDTGGDMSG
FT                   DTAGDAPDVDETLRYCVVPMVKAGSGAPFFCIPGMGGNITQLLPLANALGADRPVIGLQ
FT                   YLGLDGKHAPHASVEAIAAHYVRCIRSVQPAGPYFLGGHSLGGKIAYEVARRLHAQGDA
FT                   IGLVAMFDSAAPPYSFVAHQDDFAIASMILGVFAYYAGKMEMMAGIDDARLRDAPRERL
FT                   LAFMGERLAQFGVIQSQSDTSAIRGLFNVYRAAADFSARYAPPHEHLPLPILLVKATEP
FT                   MPDGIKLPEIRETPAWGWENFTRLPVRTCEVAGNHYSCLMDGYVERIADALRDALASAR
FT                   QAIEA"
FT   gene            complement(414683..415570)
FT                   /locus_tag="BURPS1710b_A0273"
FT   CDS_pept        complement(414683..415570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53225"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX1"
FT                   /protein_id="ABA53225.1"
FT                   /translation="MKSGIRIDRRESFDDRTNVHGFSVRDDSMHRIEEEAFSAESRAEP
FT                   DAGAALRALGWMMFGMEDLRLCADERRELAQLARYAQTLPIDGFGGNGRHRCYAEAVLS
FT                   PSARTLRWKPGIVGKDGTIEVEYEQETEFQPEYGGVRRRFARASDRVLQSSLIRKLIWF
FT                   DFDLIGWAGASEPLQCGFHLVRLQALPGKPSRSTPDCLHRDGQPYTAVHLVSRHDVTGG
FT                   LNYIAPPRYSGRNVDELPADALTTFTLTEPLDSYIVDDAAVCHHVSAVGCAPGAASGSR
FT                   TVMLIDFSPIPLSS"
FT   gene            complement(416016..416336)
FT                   /locus_tag="BURPS1710b_A0274"
FT   CDS_pept        complement(416016..416336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0274"
FT                   /product="phosphopantetheine attachment site domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53594"
FT                   /db_xref="GOA:Q3JLX0"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLX0"
FT                   /protein_id="ABA53594.1"
FT                   /translation="MSQPVSEPTRVLDPASAHSASIELWLIERIACYLQRAPHEIRPDT
FT                   PLDEIGLDSVYALTLCGEIEEVLHLTVEPTIAWDYPTVAEIARELDARLAQRSAQGEAH
FT                   AQ"
FT   gene            complement(416317..419886)
FT                   /locus_tag="BURPS1710b_A0275"
FT   CDS_pept        complement(416317..419886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0275"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52876"
FT                   /db_xref="GOA:Q3JLW9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW9"
FT                   /protein_id="ABA52876.1"
FT                   /translation="MPPGAPHEPEPCAVRARERVRPLSRRSVDARQRVFIRAMRAAGCA
FT                   RALSRRRLRDAVPVGAASLLRTRAVRRHAARFRAAAAADPDARAPRPDRRDRPRQDFSR
FT                   RSLRVGGRDARAGVALRAPDRRRRDRIVGADRARARQRSAAQRYVCRSRRRRIPDRRRE
FT                   MADQQRDARRHDQPARPHAARRRPPRLRHAARRQARAVPRPLSPAAEGAHARHPRRRYQ
FT                   RHRVRRCEDTGERANRLARRGPRNRAQGLAAHAHALRVAVARRGRSCAAARAGLRVRAP
FT                   AVRPHADRSAERAAHADRRVYGSTARRSRRARRGAKHPGIARRDERDVRGRQVSRAHAR
FT                   GGDARHARRVARRACVLSRYIRARDVPESAARQSDRVVVRRKHARQSERDRQCVPDAGE
FT                   ALSRARRRRRRTGARRVRSGHAAAGVRSRRAQPRVAARLPRRRRVAGVGRRHRAARGMR
FT                   AGAVAPGGAGSQARRADGRRAPADARVPAGSRARARRTIRAREALCAVPCGGVGARAVV
FT                   AYAASRRRGERRAAVAGRPVAARGAAAGARRAGRRGRFRRRGGRRIMARAAASASRRPA
FT                   VFAAAVRACRASRGGRMSADAILTGRERAHRRVDAAGPHADLEQALGDPFDAANPLGYA
FT                   RILDADEREALSPDAEAVLERWGMNAEFVPARLGGRWDSVTEMVRRLRPVFRRDAALGI
FT                   GHGVSSLVAAVGVWAAGSPAQQRELSELLLRGGKVSAAYHELDHGNDFLRNAFEAYPGA
FT                   DGALVLSGTKEVINNADRAHAWVVFARTDARAGGRSHSVLLLDRAALQPAIDAGELEIL
FT                   RRHRTAGVRGCRLAGLRFSRCRVPAERLVAARGAGVEISLRAFQVTRIALPGMAIGMLD
FT                   TALRTVVAFARERTLYGTRVIEMPYVRALLSDAMADLLAADCLVRAAARGLHLAPAHAC
FT                   VHAAAVKYLVPQLLRDSMNALSVVLGARAYLRDGRHAIFGKMMRDMPIVGLAHAGGTAC
FT                   LLTVLSQLPALARRAAHRARDAGAPFDERVALPPLDFDALTIAAHGEDWLLDALPNALD
FT                   AFEAAGERATPLARAVRHATAALDALRASAKRLPPSETGPAAHPESFELARRYAVLAAA
FT                   AACVGVWRAERARAGASFVGAPVWLEAALSRLSERLGMPKQPAPPHVCDAIVSELVARA
FT                   DEHRSFCLYHARLNGGADVPASV"
FT   gene            complement(418107..419867)
FT                   /locus_tag="BURPS1710b_A0276"
FT   CDS_pept        complement(418107..419867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0276"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52075"
FT                   /db_xref="GOA:Q3JLW8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW8"
FT                   /protein_id="ABA52075.1"
FT                   /translation="MSLNHAPFALASAFDRYLGDPSMPDNAFSYARCAQLDAHERFPDA
FT                   VCAMLSQWGLHRYYVPERFGGMLRDFEQPLQLIRMLARRDLTVAIGHGKTFLGAVCVWV
FT                   GATHEQASRFARRIGDGAIVSWGLTEREHGSDLLRSDTYAEADGDEYRIAGEKWLINNA
FT                   TRGDMISLLARTRREGGPRGFDMLLVDKHALSQGRFRPLPKERTHGIRGADISGIAFDD
FT                   ARIPASARIGSRGAGLETVLKGLQLTRTLCASLSLGAGDHALRLALGFACERRLYGRTL
FT                   IDLPNARRTLIDAYTDQLLAEAAALVGARSIQALPDEMSVTSAVVKYLVPTRAEAMLDT
FT                   LAELLGARAFLADTYAHGMFQKVQRDNRIVSLFDGNTLVNLNAIVNAFQTLAKRYRGRD
FT                   GADAGQALAAFDLGMPLPAFDRGALSLVSRHGCRVVGALPALADGIAQRAACEPALSRL
FT                   VAPVRRLAVLTDDVHRRMLACPPVRVHVPVEQFELAKRYALCHAAASALGLWWHTRHRV
FT                   GEASAAPPWRDGLWLRAVLRRVRVALGDAADFDDEAGDALWRALLRQHRDGLLFSLLPC
FT                   ELAEHRGEAA"
FT   gene            complement(419864..421663)
FT                   /locus_tag="BURPS1710b_A0277"
FT   CDS_pept        complement(419864..421663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0277"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51618"
FT                   /db_xref="GOA:Q3JLW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW7"
FT                   /protein_id="ABA51618.1"
FT                   /translation="MPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDA
FT                   RARSIAAWLSACGAARRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTR
FT                   RIVRDAGIALALTPTAADAHALANCLAAPGDAVSTVGALRCEATDALEPLDASAWSRPA
FT                   LDASAIAFLQYTSGSTGEPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMG
FT                   LIGMLLHPLYVGCDCVFMAPSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKRE
FT                   QLGGLDLSALKVALNGAEPVRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGR
FT                   PAAAPVLLDIDARALERHEASLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRI
FT                   GEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDL
FT                   LIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSIDADGERVVVVHEIKEARLDDGLSAA
FT                   ALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQ
FT                   VPVRSLRVAAGEGVAQDASRGAA"
FT   gene            422311..422817
FT                   /gene="rpoE6"
FT                   /locus_tag="BURPS1710b_A0278"
FT   CDS_pept        422311..422817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE6"
FT                   /locus_tag="BURPS1710b_A0278"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53270"
FT                   /db_xref="GOA:Q3JLW6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW6"
FT                   /protein_id="ABA53270.1"
FT                   /translation="MTGADIASTLPPLLPRLLAFARRLCGDTHDADDLVQRACLRALER
FT                   PHQLQRDTSPLNWMMAIVHSSWMSELRARHVRHRLQTDWNDDVIDALPGPTAADPQIHA
FT                   MNAQIIRAVELLPETLRAAMLLIAVEGLSYQEAAGVLDVPIGTVMSRLWRARQSIGAQF
FT                   GARER"
FT   gene            423259..424170
FT                   /locus_tag="BURPS1710b_A0279"
FT   CDS_pept        423259..424170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51922"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW5"
FT                   /protein_id="ABA51922.1"
FT                   /translation="MDPWSIARRAASAAAHPAACAGRKNGGHATRGVARSGKSARRRRD
FT                   RIRTAPECRDARHGKIYFLRPTRPRTHRAGERRPDEPTPADTRQKRKTPRAFDFLIPFA
FT                   TRNMTYTLAATYTRELDIRKSRFIAYAIPVEDRDAAMAELQRLRAEHPGATHVCWALLA
FT                   GGQSGMSDDGEPSGTAGRPILEVLRHHDLDGVLGAVVRYFGGVKLGAGGLVRAYTDAIA
FT                   AALIDAERVERIAYARLAIEIGYPDEARVRRWIEQEGHALVDSAYAMTVKLVIRLPAAA
FT                   ADAARDMLFDLTQGRAGFPSVD"
FT   gene            424186..425376
FT                   /gene="cnrT"
FT                   /locus_tag="BURPS1710b_A0280"
FT   CDS_pept        424186..425376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cnrT"
FT                   /locus_tag="BURPS1710b_A0280"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53408"
FT                   /db_xref="GOA:Q3JLW4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW4"
FT                   /protein_id="ABA53408.1"
FT                   /translation="MRAQTANRGPPPHKTDDRRPRVALSWRHFSTSIRAARAMPMSART
FT                   NAAFTALLAAALFGATTPLAKTLLGSLTPFMVAGLFYLGSGVGLGAFMLMRRLARGAGA
FT                   GASPAGHARLPLAELPWLAGAVAAGGVAGPALLMLGLATTPAATSALLLNLEGVFTALI
FT                   AWAVFRENVDAQIFAGMAAIVAGGVLLSWHPGAAGVPLGALLVAAACACWAIDNNLTRK
FT                   VSTHDAAAIACVKGLVAGTVNLGIALALGARLPAAADSAAAMLTGFAGYGVSLVLFVVA
FT                   LRNLGTARTGAYFSVAPLFGVGLSLALWPEWPPLSFWAAAALMALGIWLHLRERHEHPH
FT                   THEALEHSHRHRHDTHHQHAHDFDWDGTEPHTHAHRHTPITHTHAHFPDIHHRHSH"
FT   gene            complement(425505..425729)
FT                   /locus_tag="BURPS1710b_A0281"
FT   CDS_pept        complement(425505..425729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51383"
FT                   /db_xref="GOA:Q3JLW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW3"
FT                   /protein_id="ABA51383.1"
FT                   /translation="MIVWIAPDLVSLNVAAQGIHAAMLPLVAGLLVAPAAIALPPARRA
FT                   RGAYLGIVSAVAAAVSVAGIAGAASGRMP"
FT   gene            complement(426122..430051)
FT                   /locus_tag="BURPS1710b_A0283"
FT   CDS_pept        complement(426122..430051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0283"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52931"
FT                   /db_xref="GOA:Q3JLW2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW2"
FT                   /protein_id="ABA52931.1"
FT                   /translation="MRCVRMCRAPRRRRVRAPGGIDKPRALPQACAHEFPWLSHRAHYS
FT                   HHSSNGGLARVRKQSQQTRPVRRVFCFRLPGIPPRRACHAVRRRRHGNPRSAPPRSRRA
FT                   HGDRAARAHARRLPEAGPERARVRRRARDGARTRAQPVRAAGQRRLPEARGQPAGVLVQ
FT                   AARRVQQDGAHPGRRARARGDHRVGGQPCAGRRVLGRADEREGGDRRAGDDAAGEGRRG
FT                   ARARRADRRGDPGGRIVQRRVRARGEGAGRARPHVRPSVRRSVRDRGPGHGRDGDPAPA
FT                   SGADSRDLRADRRRRARGGRGRVREGGAPGDQGDRRADRRFVRDEAIARGGPARRAHRG
FT                   RALLRRHRGQARRRGDVPPLRGVSRRGRDRRYRRALRGDQGRVPGHAQRARAGRLARGG
FT                   GREAVCGAGGHRGRDARGGYLRREHEFRPDALRRRARRGGRGARGGVRGDDSRGARQLQ
FT                   ALLRARRRAQRDRVQLPDRRCAIGASLRRCADRASRRLGDDRGELRRARLRHRRSERRR
FT                   ARETARATHGGRALAARARRAAVPLRVSRAARRADEVPVVDGARLEHQPVPLPQSGRRR
FT                   ELDPRRPASAAGGPRGVRSLSRGARLSVSRGNRSSRLSVVSRLTFAAPAARGRRRVGGV
FT                   ASARCVARGSRLGVAPARAFAFVRVPDGAFVVAQARRRQPLAEREQRAEQRREIVRAHR
FT                   QRALLRADEAQVGHLREQRRIRLAAQRLPAERMRGGEARAIRAALEFGDERLVQRPGPD
FT                   CRLAARIHLRRGGQIPVERRLGRAAGLQQRDRLRRIRGFPFGEQREHERLSAAEVVIER
FT                   AARDAQASREAVGRHALRAFVVERGEARRDPVRSCRSCHENVQALYGPIVAAIVRPRST
FT                   LVAALAMHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPFHGHVIECGA
FT                   QFPSSGYRHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPASGLLGWRD
FT                   SVRVSRARAALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIFAPMIHGLY
FT                   FQPLRGASRALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDALSAHANGV
FT                   DACVGDRALRFDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFGLAPGWRAP
FT                   ARLRRVYGALLSPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRYASDDEIAR
FT                   VALDDLRTLLPGVAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARPRVLLAGDY
FT                   MGSPWTDGAAETGRWAARRLLDARA"
FT   gene            427499..428215
FT                   /locus_tag="BURPS1710b_A0282"
FT   CDS_pept        427499..428215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0282"
FT                   /product="putative TetR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53733"
FT                   /db_xref="GOA:Q3JLW1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW1"
FT                   /protein_id="ABA53733.1"
FT                   /translation="MARTTRTDWIAAGLAALDDEGAQGVSADRLARRLGVTRGAFYHHF
FT                   GSRKAFVLALLAEWEAAYTTQAIALLQAGGPPEAALDRYLAAASQMNPRREAAIRTWSL
FT                   HEPLVAEFQRRADRARLAAAHAFCRQTLRSEADAALFAQVAYLCFVGAQQSPLPMGPDD
FT                   FATLFRSLFALGERLSAPGLRNDERAVGNPDEREGARGRDAEPRAAGDASRGRDAAYPP
FT                   APARGRRGERQPRNNR"
FT   gene            complement(428194..429801)
FT                   /gene="ilvA"
FT                   /locus_tag="BURPS1710b_A0284"
FT   CDS_pept        complement(428194..429801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="BURPS1710b_A0284"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53497"
FT                   /db_xref="GOA:Q3JLW0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLW0"
FT                   /protein_id="ABA53497.1"
FT                   /translation="MQSDDVVTETPEAHPREAVAPTAIAPRARTLDDYLKLVLNARVYD
FT                   VARETALERARNLSARLGNAVYLKREDNQPVFSFKLRGAYNKMAHIPADALARGVITAS
FT                   AGNHAQGVAFSAARMNVKAVIVVPVTTPQVKVDAVRAHGGPTVEVIQAGESYSDAYAHA
FT                   VKVQAERGLTFVHPFDDPYVIAGQGTVAMEILRQHQGPIHAIFVPIGGGGLAAGVAAYV
FT                   KAVRPEIKVIGVQTDDSCAMKQSLAAGRRVELTEVGLFSDGTAVKLVGEETFRLCAAYL
FT                   DEVVTVDTDALCAAIKDVFQDTRSVLEPAGSLAVAGAKRYAEQAGIEGETLVAVTSGAN
FT                   MNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFKRFCALVGERNVTEFNYRIADARSA
FT                   HLFVGVQIGHRGDSATIAASFVAHGFGTVDLSGDELAKQHVRHMVGGRSPLAHDERLFR
FT                   FEFPERPGALMKFLSSMAPDWNISLFHYRNQGGDASSILVGLQVPRADHAAFDRFLAAL
FT                   GYPYREETGHPAYRLFLG"
FT   gene            430211..430468
FT                   /locus_tag="BURPS1710b_A0285"
FT   CDS_pept        430211..430468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51703"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV9"
FT                   /protein_id="ABA51703.1"
FT                   /translation="MQELSPQEIAHVSGGHYDGGGLFDTLGNLIEIAGKGAETIGNTLT
FT                   FGLLSPIGSAAYGVGEVLTTAAVNLGNSLLNLFGIPAKHY"
FT   gene            complement(430555..432096)
FT                   /locus_tag="BURPS1710b_A0286"
FT   CDS_pept        complement(430555..432096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0286"
FT                   /product="Polyphosphate kinase 2 family"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52348"
FT                   /db_xref="GOA:Q3JLV8"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV8"
FT                   /protein_id="ABA52348.1"
FT                   /translation="MLCTDDRRAAGRGARRNARRPAGDQRAARARSTERSPRARRGGSS
FT                   STRPSVDQAPNRAPAGLPTEARPSPDRAPTETRPRPDRDPTETRPRPDRDPTETRPRPD
FT                   RGPTETRPRPDRDPTETRPRPDRDPTEPRPRPDRDPTEARPRPDRGPTETRPRPNRGPT
FT                   EAQPGSPTKLPTKLPAAVIPPTSAPAIMSAERVCDARQGGHGMSEKDTRRDTAPLHERQ
FT                   RRFEEDLVDAYDEELEMELDDRRFDDESLFSPERREARKRYFRELFRLQGELVKLQDWV
FT                   VSTGHRLVVIFEGRDAAGKGGVIKRITQRLNPRVCRVAALPAPSNRERTQWYFQRYVAH
FT                   LPAGGEIVLFDRSWYNRAGVERVMNFCTDAEYEEFFRSVPEFEKMLVRSGIQIVKYWFS
FT                   ITDEEQEVRFQNRIEDPLKQWKLSPMDLESRRRWEAYTAAKEEMLLRTHIAEAPWWVVQ
FT                   AVDKKRARLNCIHHLLGLVPYYEIERDSVHLPRREHHDDYIRRPVPAEMIVPEIY"
FT   gene            431964..433751
FT                   /locus_tag="BURPS1710b_A0287"
FT   CDS_pept        431964..433751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV7"
FT                   /protein_id="ABA52187.1"
FT                   /translation="MNRPGGPLASARLIARGPPVDRLPAAGRSAALPGRPRGDRRCKAP
FT                   RGGCRRSPAKRVPRGSEPEIEQHRAEQHVRGKRRRVRCEDALRIVDVDRDRRLQRDVRQ
FT                   RGRQRQLTRELIVRADDEHGRPRAFHVRRRAHAVRQDQVRACLQQPVERARIGEQRLQI
FT                   AERDARRQQAAERCELVREHRVQVRVREARVAEAEADVRPQPVLALAEVILEHGRAEPR
FT                   ARRAERVALRVAEIDERQPPLHAREDLVERQPDAAVPAHRQFGRNPRDDLGRDVLAEEM
FT                   RERERRRVRVADRHRGARIREAADAERRRRRRHGRRAPRRQHVVPTDADHVAVVALQLL
FT                   EQRRALRLRQIGQPLRVDRMQFVRHPVVAHAGDEARRRAGGRAARRAACVAAVGHACAV
FT                   VARGRRRRAARRRPAGRVGEADAVVAVGAHAPRGVGHRRDALAERDPFFGELARRRRVR
FT                   IRGGRRRRGLRSRRRGGSVARVARRGATRVARHRPPRARVEAGRVAARKEADAVRAVAP
FT                   SGRAAVLRMRRPRAREQRRAEPAGHRSAPVAARTSTTMLVTHYAPAVTRAYRISAAGSD
FT                   TTVRTAIRAACASRARCPP"
FT   gene            complement(432144..433640)
FT                   /locus_tag="BURPS1710b_A0288"
FT   CDS_pept        complement(432144..433640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0288"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52575"
FT                   /db_xref="GOA:Q3JLV6"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV6"
FT                   /protein_id="ABA52575.1"
FT                   /translation="MGDKHRRRRARRDWRAPVSCWLGATLLACAWSAHAQDSGAARWRD
FT                   GADGIGFFPGGDAPGFDARAWGAVPGDARRAAASDARNGAAASAGSEATAAAPAADANA
FT                   APARKLTEERITLGERVAPVADAARRVRADGDDGIGFADAPGGPPAGGATPSAACDDGA
FT                   CVPDGGDAGRAPRRPPAGATPRFIAGVRYDRMPYELHPIDPERLPDLPEAQGPTLLEQL
FT                   QGDDSNMIGVGWHYVLSTGRSTPVTTSTAALGIGSFANPGSAVSISNTNTPAFTFTHFF
FT                   GEHVAAEIVAGIPPELTMRGHGSIGLPFDKIFPGVQGRLPLVDLGNTQSNPLGTTRAWL
FT                   GSAVFKYYLGKREDRLRPYVGLGLSYTRFTNTNLNPVFAHKLASLGGLLSAGISLGDLQ
FT                   SLLTDSGALDRLLQAGANLILPNGVRATADVKSAWTPVFVVGANYQLTRQLSLSTALSY
FT                   IPLKAAITVNINDTKGILASNTTTLSANVLLCTMLLNFRF"
FT   gene            433630..436053
FT                   /locus_tag="BURPS1710b_A0290"
FT   CDS_pept        433630..436053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51239"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV5"
FT                   /protein_id="ABA51239.1"
FT                   /translation="MSPITHRPSRGRTEYPLPDPIQRFEQPFEQRALLEHDVRPERHAG
FT                   LQRERLAFERRLAVDKLDPALEVSLRRAVVGGQIQLLRGERDGRHRQQLAAIGTELLDR
FT                   IAAVRELHFLARLHEAGLRRRNVQLGDEPVRLRRQDLDHARAGRIDHAALHDVEPHDLA
FT                   VGGRVQHLVHALVDVVFLRVQLFLLDLQLGVRAVVLALHGFEIAAQLHRVLREVGAAQH
FT                   QVLVRLARLQVLRVDLVVLLERDHLLVEQLLHAVAPLLVFGDDPLLVLDLLVDQPAALV
FT                   ERGDLLVDLLDRRLIFELRRVDLLTDLHALPLDRFAHALHVVRLRHEARVARDAQELLA
FT                   GLHVLVLRDEHLAHRPSGRRADADQPRARREHPHHALGVRVGEAHERDDEHREHHDRQI
FT                   AEKAHRNRHVDHAVDHGAERRAARELARRLLLSQSVHPDRHGRASSGAAQRLRGGARVL
FT                   LEQRGWHQVRREVLPEVPLLGLLHERFLELVGDPLVGRRDARRVVGDAEHPRRGPRVEL
FT                   DEMHLARVAKRHARRVRHEHRNVVLDRELHAAAREPHPAPAEPACVGLAEAAVQIGEQQ
FT                   EHGRFLAQARDEPAQMHALLDVDQLDLARAVLLDEAQRVVEERAGRVLVHHDHHLAVIG
FT                   NHQPQLRHVQHQVAEVQPREHQRAASRERRAQHALAFALHPVDQRLHRSDAVRAQHQPR
FT                   DLGLEQLAHDTVGDAANAHRIVVQMRAQHVPHRHLDRAANRRKQAQAHARAPAHHAEPA
FT                   RGRAAERDALDHPPQEEAIRERVEQEEPHQRHFCTSSSGCRAGVISARRPSRIS"
FT   gene            complement(433654..434949)
FT                   /locus_tag="BURPS1710b_A0289"
FT   CDS_pept        complement(433654..434949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0289"
FT                   /product="secretion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51487"
FT                   /db_xref="GOA:Q3JLV4"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV4"
FT                   /protein_id="ABA51487.1"
FT                   /translation="MPIRMNALREQKTPRKLTRGTTFGTVINGVVDVPISMRFFCYLSI
FT                   MMFAMFIVALVRLTYANTESVMGMLTPRSGLIGVGAPPGWAVREVFVAKDQHVKAGQKL
FT                   LSVTRDTSFVSQANNVQGMRESIKRQRVEVGQQIDAAKLEYQSTIQQINQQIAAFDESR
FT                   GLIDKQIQDQKRIVSEYQERRDRVKQLLNEQVVTLEQYNQVNTQYLQASQAYQDLMLRR
FT                   ADLAKNAMKLRGDLETVQSKYDGSNAELKIKQEELNSKEYNIDESVNQVLYAPADGQIV
FT                   RLDVVQGSVIDPPGTRVVEILPAKADGLIAELYIPSSKAGFVKPGQEVKLAYGSYPVEK
FT                   FGTYRGKLLSVSPVAFTAKELNLPADNGAPQTYFKSWVELVDRKPAFEGKALSLKAGMT
FT                   LRADIVLEKRTLLEWLFEPLYRIRQRIFGTPA"
FT   gene            434876..436021
FT                   /locus_tag="BURPS1710b_A0292"
FT   CDS_pept        434876..436021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51967"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV3"
FT                   /protein_id="ABA51967.1"
FT                   /translation="MPNVVPRVSLRGVFCSLRAFIRIGMGEPRQALRSVCAAARAFCSS
FT                   NGDGIRYGVKCSQKCHCSGCFTSASSSLSAIRWWAAATRDASSATPSIRGAGRASSSTK
FT                   CTLHASRNGTPVAYDTSIGMSCSTASFTPPPASRTQRPPSRHALVLPKRPCKSENSRNT
FT                   GASLRRPATSRRRCTRCSMSISSILPAPYSWTRRSASSKNAPGASLCITIIILRSSGII
FT                   SRSFDTYSIRLPKCSPASISGPPRASAARSTPSPSHSIRSISVFIEAMLCERSISPATS
FT                   ASNSSRTIPSATPRMRTGSSFRCALSMCRTDISIEPRIDGNRRRHTPAHQRIMPSPRAG
FT                   ERPSAMRLTTRRRRKQYENALNRKSRISVISAPPAPAAARA"
FT   gene            complement(434962..435876)
FT                   /locus_tag="BURPS1710b_A0291"
FT   CDS_pept        complement(434962..435876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51716"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV2"
FT                   /protein_id="ABA51716.1"
FT                   /translation="MMRWCAGVCLRLFPSIRGSIEMSVRHMLSAHLNDDPVRIRGVADG
FT                   IVRELFEAEVAGLMLRSHSIASMKTLIDRMECEGEGVLRAALARGGPLMLAGLHFGNLM
FT                   LYVSKLRLMIPDDRKMMIVMHKDAPGAFFDDALRLVQEYGAGKIELIDIEQRVHLRRLV
FT                   AGLRKEAPVFLLFSDLHGRFGKTNACRLGGRWVRLAGGGVKLAVEHDIPMLVSYATGVP
FT                   FRDACKVHFVELDARPAPRMLGVADDASRVAAAHQRIADKLEEALVKQPEQWHFWEHFT
FT                   PYLMPSPLLEQNARAAAQTLRSA"
FT   gene            complement(435981..438104)
FT                   /locus_tag="BURPS1710b_A0293"
FT   CDS_pept        complement(435981..438104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0293"
FT                   /product="family C39 unassigned peptidase"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53258"
FT                   /db_xref="GOA:Q3JLV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV1"
FT                   /protein_id="ABA53258.1"
FT                   /translation="MWFNTNKVRPILQDEVTECGLACLAMIATWHGRDTTLRTLRNRYP
FT                   VKIDSGLSFFDLMEIANDLGMRARGLQFEANEIDALKLPCILHWGMNHYVVLTKVCYGS
FT                   VHIVDPALGETKLPLAQALTQITGYALELNPDIGFKHVGTSDKIRLGDYLVGLTGIRKS
FT                   ILLGVAGGIAAQLLLLLGPSYVQLTIDEALKKTDVDILYLLTILFGIVFLFDTLYANLV
FT                   GNIKSYLRNIVSQQLSANMVGHLARLPIGYYLFHNTGDSISRVSSVSEIGRFLVDGLIG
FT                   GLLNVFTCVITLVLMLYYSPVLAGISLAGMVLFALSRLAIQPQLQDAMSQILTRGAEAD
FT                   ALLIENIRSAHSIKLLSSETSRSSLWVNAFTQKLQAVRQQERLQLLFDAISKGIVHVEQ
FT                   LVIVTYGAWLVMHGQSTIGIIYAFIQYKNLFADKFVDSIQLYVRRKVLQVHMDRVADVL
FT                   QTETEEPAPDAPVRSIEHFDGSLSIRALTYTPKGGRRAILEDVNLDVPAGAKIAIVGRT
FT                   GSGKTTLLNLICGLYPPAPGALFVGGVDLSEVNLRLYRKHVAAVTQSDQLFRGTIRDNI
FT                   TNFAPAPRLGAMHEAARLACIERDIDVLDNRYDTPLGDTQKFLSAGQMQRLLIARALYC
FT                   EPRLLILDEFSSNLDQATTHEICRNVLTLPCTIVLVTHDASILSMVDRIYEMRDGRLAD
FT                   ITPARQPELEVQK"
FT   gene            complement(438241..438594)
FT                   /locus_tag="BURPS1710b_A0294"
FT   CDS_pept        complement(438241..438594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLV0"
FT                   /protein_id="ABA53392.1"
FT                   /translation="MANRDTKTPFIRFGWQSEEMIRSGDSDVEAAPNGVVRAGGCGFGS
FT                   MTSLPSVKATPMQAISEQQARAIRGGGSAYANSAAYTVSLANQSITPVVNGLLNEYQTQ
FT                   AVNQFKMALGSGS"
FT   gene            complement(438673..438846)
FT                   /locus_tag="BURPS1710b_A0295"
FT   CDS_pept        complement(438673..438846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU9"
FT                   /protein_id="ABA53549.1"
FT                   /translation="MKVMTMEQAKVVNGGGPISSLGTLAAASGPLFTALGQFMPTLGGY
FT                   LQNPKNFNSNGK"
FT   gene            439125..440555
FT                   /locus_tag="BURPS1710b_A0296"
FT   CDS_pept        439125..440555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0296"
FT                   /product="outer membrane protein TolC, putative"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52720"
FT                   /db_xref="GOA:Q3JLU8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU8"
FT                   /protein_id="ABA52720.1"
FT                   /translation="MFETENLGASSKFRHAGFHLTTKSFRLRANVAYVTVCAVLAALGT
FT                   GSESARAFCLDEAYQHAISNDPKFLQARAEYDAARQKFPQARAQMLPQVSAQLEWGRYG
FT                   THANLFGIDVSGNSTAAYGAAQLSQALFNMPYLYDMSRAKEFEESARQQLEVAKQELIM
FT                   RVANACFDLLSAREKLQLADDEVGALTRLESDTRRMAQLGMKTIGDTAEIEARRSLAQS
FT                   DEALARTDVEARRARYETLLGSAIDFTRWPRLAMHGTSPRIPTGDYQPQDNPSYQQAYR
FT                   DLRVARLASKRINAEHLPSVDLFATYSRGLNPNLRGLTDKNDFHQSAVGVQVTIPIFSG
FT                   GSVHYRKIEADHVATQYQNRLREVEQQLSTDHRETLAALQSIGTRIRALQQSLQAARLA
FT                   YDSSMKAHQVGYSTTYETLNLRTDISNIRQKLFESYLDALKLQLKLKGILGTLDEQSLV
FT                   AVDSFLASNAAPADQKSE"
FT   gene            complement(440629..443142)
FT                   /locus_tag="BURPS1710b_A0299"
FT   CDS_pept        complement(440629..443142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53375"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU7"
FT                   /protein_id="ABA53375.1"
FT                   /translation="MIAARGATAARRSRFVGARAAAPRGGDLSRGGSSGRHAARRASPH
FT                   PCARLCRIGSLQVGPAQSSGGLVSVSVSVSVSVSVSVSGSGSGSGSGSGSARLDAVRCN
FT                   ATQRNAIRDDAPPPNTIRAAPAACIFAAVTAPAIASASVTAARAAGRLDALRRIRCNAC
FT                   RPRADRSLAGMPTKPHFCIRARPCYKPIRRTFVPQLARRSKWETSNECNESFQVDGARR
FT                   ARELGARRFSAERARPCEGPAAARRAGRLGRRGRRQVQRRRGRGDLQAGRQRGRRRGRD
FT                   RLHARRHLSGGGQHRRRRLHDRLHGRQAVLSRLSRARAARRDEGHVSRQGRQRRQGHEP
FT                   VRRSRGRRARHGGRDVGGAEALRQAEVEAGDRARDPLRARRLRCRRAARAAWRRRVEGV
FT                   RRQDELRSILQRPEGGRDLQAAGARCGARAHRERRREGFLRRQDGRPDRRIDEEGRRPD
FT                   HEAGSRPVQGGVAPADPGELERLSRDHRAAAELGRHRPRAVADDEGGPQGRFRRRRAQF
FT                   AAIRASDRRDREARVRRSRAVPRRSGFLQGARRAVDRRRVHRQARGRGESREAVRHEER
FT                   AAGPRHVDAGEGRDDAFLRRRQVGQRGVEHVHDQRLLRLGRRRRRHGHRAQRRDGRFLR
FT                   EAGRRQHVRRRRQRRERDRAEEAAAVVDVADGPHEGRQGRARDRHAGRLADLHVDLPGD
FT                   HEPVRLQDAAEGRGRRDALSPPAAAAEHDLLGAVPPDRRRAGEGHRGEGLHAQGPGFQR
FT                   RHPGDPDRRQDARGGVRSARPRRVARDPVSAARRRAEAAARRREHERAGESAARRPSRA
FT                   ALSRFRRRAFVLSAPRFRAFGALAV"
FT   gene            complement(440796..442517)
FT                   /gene="ggt"
FT                   /locus_tag="BURPS1710b_A0297"
FT   CDS_pept        complement(440796..442517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="BURPS1710b_A0297"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51206"
FT                   /db_xref="GOA:Q3JLU6"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU6"
FT                   /protein_id="ABA51206.1"
FT                   /translation="MNATNRFKSTVLAALVSSALAGFLPSAPAHAKGPQQRVVLDGSAV
FT                   AVADKYSADAAEEIFRQGGNAVDAAVAIAFTLAVTYPEAGNIGGGGFMTVYMGGKPYFL
FT                   DYRERAPLAATKDMYLDKDGNVVKGMSLYGDRAVGVPGTVAGMWEAQKRFGKLKWKQVI
FT                   APAIRYARDGFVVDEQLAQRGVDASKEFGGKTNFDQYFSGLKAGATFKQPELAAVLARI
FT                   ANDGAKDFYDGKTADLIAASMKKGGGLITKQDLVQYKAVWRQPIQANWNGYRVITAPPP
FT                   SSGGIGLVQLLTMKADRKADFDGVALNSPQYVHLIAEIEKRVFADRAQYLGDPDFYKVP
FT                   VAQLTDAAYIAKRAAEVNPEKPSDTKSVLPGLGTSMPEKAETTHFSVVDKWGNAVSNTY
FT                   TINGYFGSGVVAEGTGIVLNDEMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSSMSPT
FT                   VLTKDGKVALVIGTPGGSRIFTSIFQVITNLYDFKMPLKDAVGAMRFHHQLLPPNTIFW
FT                   EPYHPIDGELAKGIEAKGYTLKGQDFSGDIQAIRIDGKTPEAVSDPRGRGVSRVIR"
FT   gene            441000..442574
FT                   /locus_tag="BURPS1710b_A0298"
FT   CDS_pept        441000..442574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53282"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU5"
FT                   /protein_id="ABA53282.1"
FT                   /translation="MKAHRADRVLQRHLEVVQVRDHLEDRREDPRAARRADHERDLAVL
FT                   REDRRRHRRQRPLLRLDRVRVAADDAEHVGDARLRGEIVHLVVEHDARAFGDDARAEVA
FT                   VDRVRVRHRVAPLVDDGEMRRLGLLRHRRAEARQHALRVGRLLGIHLGRALGDVRGVGQ
FT                   LRDGHLVEIRIAEVLRAIGEHALLDLGDQMHVLRRIERDAVEIGLAVRLHRQQLHEADA
FT                   ARARRRRGDHAIAVPVRLDRLAPHRLVLDEILLRDQAAALLHRCGDQVGRLAVVEILRA
FT                   VVRDAREHRSELRLLEGRARLQAAEVLIEVRLAAELLRRVDATLRELLVDNEAVARVTD
FT                   RGRDHLLPLQLAEALLRLPHPGHRAGHADRAIAVQAHALDDVAVLVEIHVLRRGERRAL
FT                   AIVEKVRLAAHVDGHEAAAADVARLRIGDGEREGDRDRGVDRVAALPEDLLGRVGAVLV
FT                   GDRDGRAVQHDALLRALRMGGRARQKTGERRAHERGEHRRLETIRCIHWMSPISISLLI
FT                   GARKSDE"
FT   gene            443430..443948
FT                   /locus_tag="BURPS1710b_A0300"
FT   CDS_pept        443430..443948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52565"
FT                   /db_xref="GOA:Q3JLU4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU4"
FT                   /protein_id="ABA52565.1"
FT                   /translation="MASHAAHHASGWAAGLVAAALVAQAGAAGPWHVYSLAAFAAGVAG
FT                   GTAPDWLEIAWWRRTRRLWVTHRTITHWGVGWAALLAFAYRSLGHRHPWAAPLFGFACG
FT                   GLVHLIADWPNPLGVPWLWKRHSLNWWNSGHCDLIVVAAAWAGALWLAQAAWGHAAPLA
FT                   HWLGWLRTV"
FT   gene            444024..444809
FT                   /locus_tag="BURPS1710b_A0301"
FT   CDS_pept        444024..444809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0301"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU3"
FT                   /protein_id="ABA52122.1"
FT                   /translation="MPSPDHRGLTITARSATAHPSIARPASLRSMRATPMSARAAAIRP
FT                   TLAEPNAGRGRARCAARCSVEWRARPRRALRRSGRIVRDTTHKNMTDDITTPSPAPRPL
FT                   PSFGPLRWIVRHWRGGYSLAVSFWLNQAPIYALRTICSQVLMTRVFELLDPGQGPGDND
FT                   ALANALAAVPPVVLADAALSLLNVWWIVGVWRAASRHIAATGRRFWARAAQVMVALAAV
FT                   RIVYGIAVIPHSIESLQLLVIHPASLLTDPVGTLRNWLF"
FT   gene            444867..445133
FT                   /locus_tag="BURPS1710b_A0302"
FT   CDS_pept        444867..445133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51809"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU2"
FT                   /protein_id="ABA51809.1"
FT                   /translation="MPLKLPLKLPLKLPLKLPLKLPLKLPLKLPLKLPLKLPSQSQPKS
FT                   RPKSPLKSSSKLALKSQPKSKSQPLSETSPMSAKPVHRRPGCG"
FT   gene            complement(444989..445102)
FT                   /locus_tag="BURPS1710b_A0303"
FT   CDS_pept        complement(444989..445102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU1"
FT                   /protein_id="ABA51390.1"
FT                   /translation="MADIGEVSDKGCDFDLGCDFSANFDDDFSGDFGRDFG"
FT   gene            445144..450246
FT                   /locus_tag="BURPS1710b_A0304"
FT   CDS_pept        445144..450246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0304"
FT                   /product="ATP-dependent helicase, DEAD/DEAH family"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53707"
FT                   /db_xref="GOA:Q3JLU0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLU0"
FT                   /protein_id="ABA53707.1"
FT                   /translation="MRGDSRLRNHFRPVQGSRAPRPHAADTIASPFTQQHPAVSRTLEP
FT                   PHLLRAARPPSTPPAARRPPPAATRRPPGVCKPSARLAHYPPGRALRRPHPPPSRLAMH
FT                   ATPARPAAGALDAFHPVVAAWFSDTFAAPTGAQALAWPHIKAGRSTLVAAPTGSGKTLT
FT                   AFLSALDDLVRDALAHDGALPDETLVVYVSPLKALSNDIHVNLEAPLAGIAAEIARRGL
FT                   PVPQIRTAVRTGDTTQAERVAHRKHAPHILVTTPESLYVLLSSESGRRMLASTRTVIVD
FT                   EIHALANAKRGSHLALSLERLDALVGRKLPRIGLSATQKPVEAVARFLVGGRDDAPLDC
FT                   AIVDTGHTRTRDLALELPPMPLGPVMANDVWERLYDRIAELAAAHRTTLVFVNTRRMAE
FT                   RAARHLADRLGADAIAAHHGSLAKEHRFDAEQRLKHGKLKLLVATASLELGIDIGDVEL
FT                   VCQLGSPRGIAPFLQRVGRSGHHIGGVPKGRLFPLSRDELVECAALLDCVRRGELDVLR
FT                   IPRAPLDVLAQQLVAEVACREWDEHALYRCVTQAAPYATLARETFDEVLKMLAEGFTSR
FT                   RGARAAYLHRDVVAHTVRGRRGARLAAVTSGGTIPDNADYAVLLEPQGVNIGTVNEDFA
FT                   VESLAGDVFQLGNQSYRIIRIETGRVRVEDAHGQAPNIPFWLGEAPARSDELSAGVARL
FT                   RARLDALLAHGDAAGAGAALPVNAASAPAPEREAAAAGQGARARAAAPHGTPALARRAL
FT                   PAALPAAPPAVCARAAPSAAAPSTAIPSAAAPTVAAMPVPPEAELRAEPRRLAPALAWL
FT                   TGELGLDAEAARQIADYLARARAALGALPTQDTLVMERFFDESGGMQLVIHSPYGSRIN
FT                   RAWGLALRKRFCRSFNFELQAAATDDALILSLSHAHSFALDEVWRYLRASSAEHVLIQA
FT                   LLDAPLFAARWRWNATTSLALPRFAGGRKVAPQLQRMKSEDLLATVFPDQVACAENIVG
FT                   EREVPKHPLVDQTLDDCLHDAMDTEGWLALLRRIEAGDVALVARDLPAPSPLAAEILNA
FT                   KPYAFLDDAPLEERRTQAVLARRWSDPESADDLGALDAGAIEAVRDEAWPLVREPDEMH
FT                   DALVGLACIADDEIASHDGWRACVAQLAAGGRAARLALAGGRGLWIAAERVACMRALYG
FT                   ADVALDPPLAPPPGFDAPWEPEAALVDVIRARLTGFGPLTAAALAAPLALPAASVAIAL
FT                   AALEREGYVMRGRFTPGARDDEWCERHLLARIHRYTVKRLRREIEPVELADFMRFLFHW
FT                   QRVAPDTRGLGGDALAAVVHQLEGFEAAASAWEDEILPARLADYVAGGLDEPCRAGKLT
FT                   WTRLGAPAKAASAPVKTTPVVLLPRRELAIWQALRDPAAQPALSARAERVRATLAAYGA
FT                   MFFDELAAHARLLPVELERALGELVAAGLVNADSFAGLRALLRPAAQRGAQRPSRARRG
FT                   GALIGGMDDAGRWALVQRLPLAPLDFGEGGSEDEAANDDDAPSGDGTPGAGPEAARRGG
FT                   VREGGAEADARIARAMRAAPPQAGRHAIAPAALEHVARTLLRRYGVAFWRLLACEAEWM
FT                   PSWRELLPVYRRLEARGEIRGGRFVAGLAGEQFALPDAIPILRELRRRPAEGLMLCVSG
FT                   ADPLNLTGTLLPGERVPALAGNRILFRDGVPIASLVGGQFAFARELDALAQDRARARLA
FT                   RQR"
FT   gene            450314..450505
FT                   /locus_tag="BURPS1710b_A0305"
FT   CDS_pept        450314..450505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52744"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT9"
FT                   /protein_id="ABA52744.1"
FT                   /translation="MRRSRTDHARSPLAKHASVRRASRADGGRPPSLIIADRFAADPPL
FT                   APPPRLDARGNPPPRSPT"
FT   gene            complement(450334..450561)
FT                   /locus_tag="BURPS1710b_A0306"
FT   CDS_pept        complement(450334..450561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT8"
FT                   /protein_id="ABA53309.1"
FT                   /translation="MCGERVGRGRLEAREAGADHVGERGGGLPRASRRGGGASGGSAAN
FT                   RSAMMSEGGRPPSARDARRTDACFASGERA"
FT   gene            450864..452159
FT                   /locus_tag="BURPS1710b_A0307"
FT   CDS_pept        450864..452159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0307"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51252"
FT                   /db_xref="GOA:Q3JLT7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT7"
FT                   /protein_id="ABA51252.1"
FT                   /translation="MNAPAEPGATTVPHRAGSLTILQGAALYIGAVLGTGVIALPALAA
FT                   EVAGPASLLAWAALVMLSIPLAATFAALGARYPDAGGVSTYVRKAFGPKAAAVVGWCFY
FT                   FAVPAGAPAAAMFGGAYVAAVTGGAHATMIASAAVLIALVAAANAFGVTVSGRMQLVLS
FT                   ALLVALLVAAVLASAPHARAANLHPFAPHGWLAVGEAAALLVWSFAGWEAITHLAAEFR
FT                   RPARDLPRSTGIAVAVVGLLYLSVAAASVLVLGPAAGESGAPLAALIARGIGGNAQLIA
FT                   TAAALLLTLGTMNAYFAGAAKLGAALGRDGALPRWFAQGSQTGGVPRRSLAVIAALAGC
FT                   ALVAAVATGMGPKPLVLATSGNFVMVYVLGAAAATRLLPRGGLAHRASIVALLSALLLL
FT                   ATTGWYLLWPLLLTASAIGYLFITGRRAAAKR"
FT   gene            complement(452192..452527)
FT                   /locus_tag="BURPS1710b_A0308"
FT   CDS_pept        complement(452192..452527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT6"
FT                   /protein_id="ABA53412.1"
FT                   /translation="MRDEAWRASDAHGARHASRRVGRFIAREGVALSSNGSRTAVGEPR
FT                   GRNVPAVSRSRSSGLAAALHSPSAQGRREVYAKCRTIGAPSLRLRDAKPARHGRVYRGA
FT                   APAHFPA"
FT   gene            complement(452537..455173)
FT                   /locus_tag="BURPS1710b_A0311"
FT   CDS_pept        complement(452537..455173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT5"
FT                   /protein_id="ABA52352.1"
FT                   /translation="MCAAARAGRAGGRCDAPAGRSGGAPPPHRLRERVEHGLGLRPAQA
FT                   RVGDRHAVLQRHAGLQVLPAGLQVALDHHAGDASLAVRQLAREVLGDVDLPQVRLVRIR
FT                   VRAVDHHLLALARRAQHRARLVDARAIVVRAPLAAAQDHVRGVVAARLENRGHPHLRHA
FT                   HERVARARRDDRVGRDLHAAVGAVLEADRAAQPRRELPVALALGRARADRAPGDQIRDV
FT                   LRAQQIEEFGAGGQAERVDVDQQPARGAQPFVDAEAAVEARIVDVALPADRRARLLEIH
FT                   AHHDQQVVAQRVGGAFQPARVVERLIVIVDRARADDREQAVVAAVQHVADRVAARFDER
FT                   LDGARHRQFVLQQRGRDERAHRADAHVVDARRVLRRVGEAGFPIALRIVDVLHGGVPVL
FT                   RNQPRLWHSRRARRDDRRRVALRCRKRARGRLATHAAAQAATGTAARGRLFFGANVSNP
FT                   AAFGRRDVVAARWRRARPGGGAARFVHSRRQQNARDGHGEGDERIGGGQAADAGTVRGD
FT                   GPVQRGAREGRRDSRGRRPASECEGQAGAFLGQRAERDRRAVCANRRARRRVLAVEGRF
FT                   DGRSRRMGEAMPESDGERFGNRNPAAVRARGFRRCIHARAARAGGAAARRDRRAGQESA
FT                   LTPRRGARGGPRRRGGRRFVHGRCSVAAQPPFNRRLTAVQSPLNHRLVAAAPCIERHRL
FT                   SRIGPDRAHAVRLAFERERLGADLVGEQPSAGSRVVPKRHVVAPVLPARDEVLDREEAP
FT                   LDCEPVLVRVLRVERIALAAFVRAQHDLVVARREPERAVGLLFDDDERARRRLARRIGR
FT                   PMQHDQIADAAGVDIGPLPGGHDLVAGRQSRQHGRWQAGGARGDAGDGEENRDRRGAAH
FT                   AENHVDG"
FT   gene            452549..453130
FT                   /locus_tag="BURPS1710b_A0309"
FT   CDS_pept        452549..453130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0309"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT4"
FT                   /protein_id="ABA53063.1"
FT                   /translation="MILRMRRAPPIPILFAVACVAARAAGLPTPVLSRLPPGYEVMAAR
FT                   QGPDVDAGRISYLIVLHRPADSASEPSPRPLVIVEQQADGTFRLAARNDEVVLRANEGG
FT                   QCDPFDPQDADENGLAVKGRFFTVQNFVACGQHWSDYVTFRHDARTGRWLFANEIRTES
FT                   FPLEGKPDRVRAIRADPRKPVALDAWRRGD"
FT   gene            complement(453265..454005)
FT                   /locus_tag="BURPS1710b_A0310"
FT   CDS_pept        complement(453265..454005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0310"
FT                   /product="DGPF domain protein"
FT                   /note="identified by match to protein family HMM PF04946"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52853"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT3"
FT                   /protein_id="ABA52853.1"
FT                   /translation="MFCMVGFRFCEISPDYGTRAGPGATIGGVSRCAAANARAAGSRRT
FT                   RPRRRQRAPPRAAGCFLARTCRIRRRSVVEMSWPPDGAGPDPAAARLDSSTRGGSKMRV
FT                   MVMVKATNESEAGKLPTREQFEAMGRFNEALVKAGVILAADGLHPSAKGKRVRFSGSAR
FT                   SVIDGPFAQTGELVAGFWLWKVASMDEAVEWVKRCPNPMESDSEIEIRPLYELEDFGDA
FT                   FTPELREREARLRDEIDEQGKKAP"
FT   gene            453995..455113
FT                   /locus_tag="BURPS1710b_A0312"
FT   CDS_pept        453995..455113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0312"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR00034"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53756"
FT                   /db_xref="GOA:Q3JLT2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT2"
FT                   /protein_id="ABA53756.1"
FT                   /translation="MQNIDNPQRDRETGFADATQDTTRIDDVRIGAVRPLISPALLQDE
FT                   LPVPSAVQALVEASRDAIGDVLHGRDDRLLAIVGPCSIHDHDQALDYARRLKSAADALR
FT                   DDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRAARRLLIDINALGLPAGTE
FT                   FLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVAADAIVA
FT                   ARASHAFMGMTKMGMAAIFETRGNDAAHVILRGGKRGPNYDRASVDEACAVLRAAGQRE
FT                   QVMIDCSHANSNKSHLRQVDVAEDLARQLSDGERRITGVMVESNLEAGRQDLKPGVPLQ
FT                   YGVSITDACLSWAQTEPVLDTLAQAVRRRRAA"
FT   gene            455197..455334
FT                   /locus_tag="BURPS1710b_A0313"
FT   CDS_pept        455197..455334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT1"
FT                   /protein_id="ABA51693.1"
FT                   /translation="MITFGEPLVALFDGSAVRNIQVGAPCYPTSRRYAAIDHGGAPAGA
FT                   "
FT   gene            complement(455615..456283)
FT                   /gene="mdmC"
FT                   /locus_tag="BURPS1710b_A0314"
FT   CDS_pept        complement(455615..456283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdmC"
FT                   /locus_tag="BURPS1710b_A0314"
FT                   /product="O-methyltransferase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01596"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52607"
FT                   /db_xref="GOA:Q3JLT0"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLT0"
FT                   /protein_id="ABA52607.1"
FT                   /translation="MNERQWSAVDDFFCSQLAPSDPVLDAALASSRAAGLPAINVTAHQ
FT                   GKFLNLLATIRGARRILELGTLGGYSAIWLARALPPGGVLITLEANADHAALARENLGR
FT                   AGLGGVASVVVGRAKDSLERLIAERAEPFDLIFLDADKDNYPAYLPPMVALSRPGTVIV
FT                   ADNVVRQGRVADRRNQDPDALGVREYFRLIAAHPRLTTTALQTVGSKGWDGFALTIVTA
FT                   "
FT   gene            complement(456900..458354)
FT                   /locus_tag="BURPS1710b_A0315"
FT   CDS_pept        complement(456900..458354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0315"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52605"
FT                   /db_xref="GOA:Q3JLS9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS9"
FT                   /protein_id="ABA52605.1"
FT                   /translation="MVIAGAVAVAIVMMSICAAILRDSRDDAFEHAQRAARNTLQMIER
FT                   DVTRGFRLYDRTLARIAAQFGDRRIAALPAGLRREILFDSAAAANEAGVMYVLDASGHV
FT                   TLASTRGPLPAERFASYDFFAAQRDTPALGMYLSGPYRMSSRDGEPYVALSRRIERADG
FT                   AFAGVVVLAVRIAYFRQLLAAANVGPHGALVLMHTDGRILMRIPFDEKFVGLDLTGTSL
FT                   YSRMQFGRSGEFFDVEPIDHVKRFYLYRRLDDVPLVVQVAIADDDIYATWRLRAWRFGV
FT                   LTGVFALIFVVMSAYLAHSLWRKSTAEAALARLAGTDSLTGLYNRRALDETLEREWRRA
FT                   VGGDRPLAILFVDIDHFKRYNDTYGHQVGDEVLATVSRCIAQQAARLGDVVARYGGEEF
FT                   VVVLPDTPRGGALVVAERVRLGVRMLGIEHEGSEVGFVTVSVGVAVWHPDGASAPHIAA
FT                   IVEAADQALYRAKADGRNRVVDLGLG"
FT   gene            458836..459759
FT                   /locus_tag="BURPS1710b_A0316"
FT   CDS_pept        458836..459759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53689"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS8"
FT                   /protein_id="ABA53689.1"
FT                   /translation="MDHRSWGAGHGSHGNLRLRPCIPALAHAALLVILLHGAPARGATP
FT                   AAGRAARSRRLVAGTSRRCAFARAGAATAHPIRSPFTQAMAYAKSSSSVPTEFLYIGAA
FT                   GEHYIMSECFRHNMEAFKLPIDKGFDLVVTRAYRHLSRLDDVRKPVDPGLPDTPIYVQV
FT                   KSRQATPVAPPRKKGERPVWEGHFPIKPADLDLICATPNSALACVLFIDTRGELMRSRT
FT                   AYAWWMSSAYVNQLRDAGHFIAMPRKDALELWVRYVEPAPDSGYKQNTYISLLKQCQIK
FT                   GSEPGKKSTGFLLSEERFDFGKLGVE"
FT   gene            complement(460495..461499)
FT                   /gene="pcaQ"
FT                   /locus_tag="BURPS1710b_A0317"
FT   CDS_pept        complement(460495..461499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="BURPS1710b_A0317"
FT                   /product="pca operon transcription factor PcaQ"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR02424"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51819"
FT                   /db_xref="GOA:Q3JLS7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS7"
FT                   /protein_id="ABA51819.1"
FT                   /translation="MHNRIADGRVKFRHLQCFLAVAQFGSVQKAAHSLSITQPAVSKTI
FT                   AELESILGVRLFERGRQGARPTREGQLFMPHASACVLALRQGVGLLAREGGGAAATLEI
FT                   GMLPTVAASLAPAVLKTLAAEWPRAVVRITTVANAELLERLKAGAIECAIGRLSEPERM
FT                   VGLSFEHLYNEPLVAVVRAGHPLAASASPAAQLARYPVVLPPYGTMIRQAAEQLLSACG
FT                   APPLESFVEVLSVSVARALALENDAVWFVPRYAAEFDLAAGTLTRLALPVDGADEPVGL
FT                   ILRTDAQPSPVARALIDAVRAIARRRLAGAGTTSGRARGARGATGKGRGRRDA"
FT   gene            461607..462311
FT                   /gene="pcaH"
FT                   /locus_tag="BURPS1710b_A0318"
FT   CDS_pept        461607..462311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="BURPS1710b_A0318"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="identified by match to protein family HMM PF00775;
FT                   match to protein family HMM TIGR02422"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52244"
FT                   /db_xref="GOA:Q3JLS6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS6"
FT                   /protein_id="ABA52244.1"
FT                   /translation="MDSSTLAPRDWPSHPAYIHPPYRSSVKRGPTQPLIPLKETLRNQH
FT                   APVYGADDLGALDHDLTKNAAKNGEPLGERIVVTGRVLDEGGKPVRDTLVEVWQANAAG
FT                   RYVHKVDQHDAPLDPNFLGAGRCLTDANGRYRFLTIKPGAYPWGNHPNAWRPNHIHFSL
FT                   FGDYFGSRLVTQMYFPGDPLLALDPIFQGTPEDARERLISRFSIDTTEEGFALGYEFDI
FT                   VLRGRDATPMER"
FT   gene            462314..462907
FT                   /gene="pcaG"
FT                   /locus_tag="BURPS1710b_A0319"
FT   CDS_pept        462314..462907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="BURPS1710b_A0319"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="identified by match to protein family HMM PF00775;
FT                   match to protein family HMM TIGR02423"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51441"
FT                   /db_xref="GOA:Q3JLS5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS5"
FT                   /protein_id="ABA51441.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYNYDLKSLFTAEIATPDAAGE
FT                   PILLVGRVLDGDGHPVGDALLEFTHVDGDGRYPASRDEAAQRGFSGFARVGTGTHAQNR
FT                   FVVRTVKPARTSDTDAPHIDVTVMMRGMLAHAFTRIYFDDEAAANAADTALASVPAARR
FT                   ATLIATRDAQANGVTVYRFDIHMQGERETVFFDV"
FT   gene            complement(463269..464096)
FT                   /locus_tag="BURPS1710b_A0320"
FT   CDS_pept        complement(463269..464096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0320"
FT                   /product="family M55 unassigned peptidase"
FT                   /note="identified by match to protein family HMM PF04951"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52313"
FT                   /db_xref="GOA:Q3JLS4"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS4"
FT                   /protein_id="ABA52313.1"
FT                   /translation="MKVLISTDIEGVAGVVSVEQTRAGNPEYERARRWMTAEANAAVEG
FT                   AFAGGATRVWVNDSHGGFRNLLPDGIDARARVVLGKPRPLGMMAGLEAGPDLVFMIGYH
FT                   AKAQTRGLLAHTINSSAFARVVLDGRDVGEAGLYGALAHEYGAHVALLSGDDVFVDETR
FT                   PLFPAAQFVTVKEAAGFASGASMTPAAACGAIGVAARQAVEQAREGARAARPHAPRAAR
FT                   CELQAQSVAAADLFCQWPSLERVDALTLRFFAPSIEHVVRTLNCLSAMSFMLR"
FT   gene            complement(464096..465424)
FT                   /locus_tag="BURPS1710b_A0321"
FT   CDS_pept        complement(464096..465424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0321"
FT                   /product="aminopeptidase DmpA"
FT                   /note="identified by match to protein family HMM PF03576"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52596"
FT                   /db_xref="GOA:Q3JLS3"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS3"
FT                   /protein_id="ABA52596.1"
FT                   /translation="MRARTSGRADAAEALDAADAAPHVGALPAGPLRSIADVAGVTVGH
FT                   ATLDARGVQTGVSVVRPHAGDVYRDKVPAAAAVINGFGKSIGLVQVDELGVLETPLALT
FT                   NTFGVGALAQAQIRAAIDANPQIGRAWPSVNPLVFECNDGYLNDLHAFAVTPAHYAQAL
FT                   ADARRAFARGAVGAGRGMSCFDLKGGIGSASRVVRAAGEAWTVGALVLANFGRLPMLTI
FT                   AGVPVGRMIAERDAGGAPGAAGGQGADGARDDVAAAGARGARGDGPHGTYGTYGAHGRE
FT                   NAGTGGGAAGGLAPRRARDAGASSPGAAPDAAPPEQGSIIMLVATDAPLSSRQLKRVAL
FT                   RAAVGLARTGSVYGHGSGDIALAFSTAYTVPHDAERVSLPALVADAALDPLFAAAADSV
FT                   EQAIVDALWRATRVTGRDGHTRRALRDAAPELERWLRAARAGA"
FT   gene            complement(465424..466332)
FT                   /locus_tag="BURPS1710b_A0322"
FT   CDS_pept        complement(465424..466332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0322"
FT                   /product="putative ABC transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53313"
FT                   /db_xref="GOA:Q3JLS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS2"
FT                   /protein_id="ABA53313.1"
FT                   /translation="MNATVSSPPSAPASAGAPAAIRTPWSEFWRKFRKQRVALAAGAFV
FT                   LLLVAVAIVGPHVVPYDPENYFDYDALNAGPSAAHWFGVDSLGRDIFSRIVAGARISLA
FT                   AGFFSVALGAAIGTFFGLLAGYYEGWWDRATMRVADVLFAFPGILLAIGVVAILGNGMI
FT                   NVICAVAVFSVPAFARLVRGNTLALKQMTYVEAARSIGASDRTIIMRHILPGTVSSVVV
FT                   YFTMRIGTSIITAASLSFLGLGAQPPTPEWGAMLNEARADMVNAPHVALFPSIAIFLTV
FT                   LAFNLLGDGLRDALDPKLERR"
FT   gene            complement(466340..467260)
FT                   /locus_tag="BURPS1710b_A0323"
FT   CDS_pept        complement(466340..467260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0323"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53732"
FT                   /db_xref="GOA:Q3JLS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS1"
FT                   /protein_id="ABA53732.1"
FT                   /translation="MLNFLVKRLFGLLPTLACVAVLVFLFVHLLPGDPARLAAGPEADD
FT                   ATVALVRADLGLDKPLPAQFASFFARIAHGDFGVSTRSKRPVATEIGERFMPTLTLTVV
FT                   SMAWATLFGMAIGIASAVWRNRWPDRIGMTLAVSGISFPAFALGMLLMEVFSVKLGWLP
FT                   VVPDGSWKSYVLPSVTLGAAVAAVMARFTRASFVEVLNEDFVRTARAKGVREPMVVLKH
FT                   CLRNAMIPVVTMMGLQFGFLLGGSIVVEAVFNWPGLGRLLVDAVTMRDYPVIQAIVLLF
FT                   SLEFILINLSVDVLYAVINPTIRFK"
FT   gene            complement(467397..468959)
FT                   /locus_tag="BURPS1710b_A0324"
FT   CDS_pept        complement(467397..468959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0324"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51837"
FT                   /db_xref="GOA:Q3JLS0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLS0"
FT                   /protein_id="ABA51837.1"
FT                   /translation="MTQPHSFLPFSPRALLVACAGAIAMSSAPLALAERAAVMAVDSTF
FT                   TTLDPYDSNDTLSQAVSKSFYQGLFGFDKDMKLVNVLATGYEASPDAKVYTIRLRQGVK
FT                   FQDGTDFNAAAVKANFDRVTDPANKLKRYNLFRRIAKTEVVDPYTAKITLTEPFSAFIN
FT                   VLAHPSAVMISPAALKKYGREIGLHPVGTGPFELVEWKQTDDLKVKKFAGYWKAGYPKI
FT                   DAIDWKPVVDNNTRAALMKTGEADFAFRIPFEQTAELKASPKVDVIERASIIQRYVSLN
FT                   VMQKPFDNPKVRQALNYAVNKEALAKVAFAGNATPATGIVPQGVDYAVKLGPWPYDPAK
FT                   ARALLKEAGYPSGFETTLWSAYNNSTSQKAIQFVQQQLAQVGVKAQVQALEAGERVAKV
FT                   ESAQDPAKAPVRMYYIGWSASTGESDWAISPLLASSSIPPKLVNTAYYRNDAVDADLAK
FT                   ALETTDRAKKAELYADAQRRIWADAPWIALVQEKIVYARSKRLQGAYVMPDGSFNFDEI
FT                   AIK"
FT   gene            complement(469163..471220)
FT                   /locus_tag="BURPS1710b_A0325"
FT   CDS_pept        complement(469163..471220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0325"
FT                   /product="putative ATP-binding ABC transporter protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52340"
FT                   /db_xref="GOA:Q3JLR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR9"
FT                   /protein_id="ABA52340.1"
FT                   /translation="MSASRAAPSLPDARVLAVDGLTVTFRREDAAFVAVRDLSFHVDRG
FT                   ETLAIVGESGSGKSVTSLALMRLVEHGGGAIAGGAIALRRRGGAVLDLARATPSTLRTV
FT                   RGADVAMIFQEPMTSLNPVFTVGDQISEAIALHQHKSAGEARAETLRLLDLVRIPEARR
FT                   VFARHPHQLSGGMRQRVMIAMALSCRPALLIADEPTTALDVTIQAQILQLIRGLQDEMD
FT                   MGVIFITHDMGVVAEVADRVLVMYRGEKVEEGACDAIFAAPSHPYTKALLAAVPRLGSM
FT                   RGTDAPAKFPLLRFDPAAGDALVVAGGDATAASGDAARESVLFVDSDAAAASAASTAST
FT                   ASAASAASAASAASAASAASAAPTACARPAIDAGAPPLLRVRELVTRFPVKSGVFGRVS
FT                   QYVHAVERVSFELRAGETLALVGESGCGKSTTGRSLLRLVERVSGSIEFEGREIGALKG
FT                   RELQALRRNIQFIFQDPFASLNPRLTVGFSIMEPLLVHGVASGRQAQARVDWLLERVGL
FT                   PADAARRYPHEFSGGQRQRIAIARALALNPKVVVADESVSALDVSVQAQIVNLMLDLQR
FT                   ELGVAYLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFETPRHPYTKKLMSAVPIA
FT                   DPARRHAPRTLPADELPSPIRALGDEPEVAPLVAVGPAHFVAEHRVGGAY"
FT   gene            complement(471261..473324)
FT                   /gene="ansA"
FT                   /locus_tag="BURPS1710b_A0326"
FT   CDS_pept        complement(471261..473324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="BURPS1710b_A0326"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="identified by match to protein family HMM PF01112"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52925"
FT                   /db_xref="GOA:Q3JLR8"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR8"
FT                   /protein_id="ABA52925.1"
FT                   /translation="MKIYFFHFADCVNLLSSSSDATPPPHAQLTRHAACRRALDRRAHR
FT                   RRAAVAHADPSAHGRVRARESVPRGDDAHRRARERGGRVDRDREPLRARARLRRLPGAA
FT                   RGARARLRGDARARRAAALCAGARGGRARRRADRRELRAGAREPRAHARAARSRERRGG
FT                   RRFAARRTPDLHRRDGRERVSRRLDGARAVRLPRQRAIARAARRADRCRAAPVQRARRR
FT                   SRRRDRVSALRVRHDRAHAARGRARRARARDHRRARFADRAVRRARAFRARGAPARGDL
FT                   RGRGARARRGADRRGRASLAALGARGRRSDRIHAAVARGAGRMRRAAAPAAPFQENRPM
FT                   TSPAIVAIHGGAGTILREAMTADAEAQYRAELAAILAAAQKVLAEGGSALDAVSVAVRM
FT                   LEDCPLFNAGRGAVYTADGTHELDAAIMDGATLAAGAICCATRVRNPVLAARRVLEASE
FT                   HVMFAGAGADAFAAAQGLELAPPGYFDTEPRRAQWLKARRAAGTMLDHDAAAFAFGRGG
FT                   GDGSGNDGGNGGGPGARAACAPEPLDPDRKHGTVGAVARDLHGHLAAATSTGGITNKQP
FT                   GRVGDTPIIGAGCYANDATCAVSATGTGEMFIRLATAYDVSAQIEYRGASLAGAAYDVV
FT                   MNKLPSIAGRGGIIAVDARGNLAMPFNTEGMYRGYARVGEAPVTAIYREDAA"
FT   gene            complement(472304..473248)
FT                   /locus_tag="BURPS1710b_A0327"
FT   CDS_pept        complement(472304..473248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0327"
FT                   /product="RpiR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52594"
FT                   /db_xref="GOA:Q3JLR7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR7"
FT                   /protein_id="ABA52594.1"
FT                   /translation="MPSSPATPLAAEPSIAARIAAALPSLTPIHRRMGEYVLANPFRAA
FT                   TMRIDELANAVDASIATANRFARALGFDGYPALRAALVRGFEATLAPVERLRCAQEREA
FT                   GARGGELIDASFEQALANLERTRGRLDRANVEAAVDSLLAARRIFIVGMGASAFLAGLM
FT                   EHGLSVYRDNVQSLALLGGPTDAARRLFSARGDDLVVAIAFPRYVYDTIELTRRAAERG
FT                   APVLAITDGPDSPIAPFAARALFVHAERRLAATSEAAVLALVEALIDAVAHRSQRSARA
FT                   AAEVTEFMLPWLEARGACAAPPRPPRRSRKTDR"
FT   gene            473600..475630
FT                   /locus_tag="BURPS1710b_A0328"
FT   CDS_pept        473600..475630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0328"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52924"
FT                   /db_xref="GOA:Q3JLR6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR6"
FT                   /protein_id="ABA52924.1"
FT                   /translation="MPPSRSTPRTTLKPPVVVPSLAVIGALLAVCALRPNEAGALFGAA
FT                   QQWIVERFDWFYVLAITTFLIFLVLIAASRFGNIKLGPDDAEPEFSFVSWTAMLFAAGM
FT                   GIGLMYFGVGEPIQHYLSPPTAAGGTPAAAREAMLMSFFHWGLHAWATYGVMGLVLAYF
FT                   GFRYNLPLTLRSGLYPVLREGVNGWIGHTVDAFALVGTVAGIAVTLGYGVLQLSAGLHT
FT                   IAGWQTDTDTFRIGLVTVVVALAGLSAASGLDKGVRRLSELNLMLAFALLAFVVVAGPT
FT                   SFLLRAIGDNIGEYLSKLVSLSFRTYAYEAPNDKGWFGGWTLLYWAWWVSWSPFVGMFI
FT                   ARISRGRTIRQFVIGVLLVPTAFNLVWMTAFGNSAIWLDTHAAAGALAQTATNVDALLF
FT                   RFFDYLPLTQLLSVAAIVLIAVFFVTSADSGAFVIDAIATRGAPQSPVWQRLFWAAVLG
FT                   VTASVLLVAGGLKALQALTLVAALPVALVMLALCYGLWRGLKADHAHYSQDMAPATSFW
FT                   TGQHWRHRLSQILRHTSDADARQFIAQTVEPALRKVADELKAGGVDAHVARDDDDAVRL
FT                   TVPAPAQRDFVYGARVSRKSAPAFRIREAAEPEPQREHVCEVLTFFADGRLGYDIEYLR
FT                   GDEIIADVLRQYERYVSLAADTRTHLLNRAPEHAGPDGLSR"
FT   gene            complement(475885..477084)
FT                   /locus_tag="BURPS1710b_A0329"
FT   CDS_pept        complement(475885..477084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0329"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53117"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR5"
FT                   /protein_id="ABA53117.1"
FT                   /translation="MNSAFDAPASAAAAAFPPADDAALAARLDRVLGAALGERRIVGAV
FT                   ALAARHGRLVYRRAHGLAERETQRPMREDTLFRLSSITKPIVTVAVLRLVADGRMALDA
FT                   PITRWLPDFAPALPDGRAPALSVHQLLTHTAGLSYWLLEAPGSAYHTLGVSDGIDLVDF
FT                   DLAENLRRIAAAPLAFEPGSAWRYSLALDVLGAAIERETGRALPDAVARLVTTPLGMHD
FT                   TGFVAADPARFAVAYANAAPEPARITDNLDVPLPEGHGVAVRFAPSRVFDATAFASGGA
FT                   GMYGSADDVLRVLETIRTGGDGFLPAALVAAMRTDHTGPAAGTRGPGWGFGYGGAVLSD
FT                   PALAQSPQSAGTLQWGGVYGHSWFVDAARGLTVLLMTNTAYEGMSGPLTLEVRDAVYGV
FT                   "
FT   gene            477279..477614
FT                   /locus_tag="BURPS1710b_A0330"
FT   CDS_pept        477279..477614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0330"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53686"
FT                   /db_xref="GOA:Q3JLR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR4"
FT                   /protein_id="ABA53686.1"
FT                   /translation="MTVPATLAAAGTPPLAEWIGLGTLALLYLFGLGWAVRGAASRARG
FT                   RAYWIACAALIVGGTACALVAPPSPPDSGEMPPGFGLGVLVTLLGIAGTTAGCAWRAIA
FT                   RLRRGRP"
FT   gene            477693..479153
FT                   /locus_tag="BURPS1710b_A0331"
FT   CDS_pept        477693..479153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0331"
FT                   /product="phosphoesterase family protein"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF04185"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51860"
FT                   /db_xref="GOA:Q3JLR3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR3"
FT                   /protein_id="ABA51860.1"
FT                   /translation="MPRRPGARTGDAAARAPHEKENAVAKILENVEHIVVVMFENRSFD
FT                   TMLGWLYSPDAPPAHVLPPQSSPQFDGLRPEMSNPSKAGKTIAVTREALNSVIPDPQET
FT                   FVNVTSQILGPSDAGNPWPPMQGFVVNYETTQTTDPGHVMQCHSVAQLPTLTALARAYA
FT                   VSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEWDVPTIFDVLSSIGASWAVY
FT                   SDTTVTPSLTHTMFPSLWKDAYAERFRRFPDFVAACGNDALPQYAFIEPSFLFEPNDQH
FT                   PPHDVRAGDKFLHDIWTAIRTSPGWPRTLLVVTYDEHGGCFDHVLPPANATPPDNASNP
FT                   GDEAFGFYRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSILATLRDWLDIPPDRMLG
FT                   SARIANAPTLAQLVTRDTPRTDLPTIAAPSTDFVHPPPDAPLNDVQKSLVTGTSRRDGH
FT                   DPAAGVAPIATRQHALDFFKRRAAAKTA"
FT   gene            479633..480274
FT                   /gene="albD"
FT                   /locus_tag="BURPS1710b_A0332"
FT   CDS_pept        479633..480274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="albD"
FT                   /locus_tag="BURPS1710b_A0332"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53099"
FT                   /db_xref="GOA:Q3JLR2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR2"
FT                   /protein_id="ABA53099.1"
FT                   /translation="MKLSPGLVAELTVNLLLPWAAYRAALPYWGETGGLVASAVPPLVW
FT                   STVQLARFRRVDALSALVLFGIVLSIAAALAGGSARMLLMRESLASGAIGVAFLASLAL
FT                   RKPLVFHLARATLAREAHDGAARLDALWAERPAFVASMRLMTLVWGCGLVAENLLRAWM
FT                   VWNWPVERVLVVAPFVGYGVYGALMMWTLWYRKVMRANALAGLPPGGALG"
FT   gene            complement(480328..480678)
FT                   /locus_tag="BURPS1710b_A0333"
FT   CDS_pept        complement(480328..480678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53315"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR1"
FT                   /protein_id="ABA53315.1"
FT                   /translation="MGFVEVERRRANVGKPNDIDGATLVSEVRSEPLVSAGGAPCDDAP
FT                   LTLYGAYRQGFADYLAGRPNPYRIGSRLAGIWHEGHAEAASNDALDFAVRVRFCWGARA
FT                   AANPIAFFRRRR"
FT   gene            complement(481208..484129)
FT                   /gene="ileS"
FT                   /locus_tag="BURPS1710b_A0334"
FT   CDS_pept        complement(481208..484129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="BURPS1710b_A0334"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51197"
FT                   /db_xref="GOA:Q3JLR0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLR0"
FT                   /protein_id="ABA51197.1"
FT                   /translation="MSEYKETLNLLQTPFPMKGDLPRREPALVERWAAQRVYARMRAAA
FT                   AGRPPFVLHDGPPYANGDIHIGHAVNKVLKDIVLKSRFAAGYDAQWIPGWDCHGMPIEH
FT                   RIEQLHGRGLPPAAVQRLCREYAFEQTERQRRDFLRLGLLGDWPHAFRTMDFRTEANEL
FT                   RFLERIRARGLLYRGQKPVNWCVDCQSALAEAELEYARKTSVAIHAGLRVRDPVDFASR
FT                   FRRRPVLDKPAMLVVWTTTPWTIPGNAAAGVRADAPYGLYDTPGALIVVAQPLADALFA
FT                   SLGVDHALCALARGRELVGLALGQPFFAGRDVPVVEAEFVTLDAGTGIVHLAPAHGAED
FT                   AELCRRLGIAGENVVDGAGRFAADLPEIGGLPLADGIARIVAKLRADGTLVREAAFEHA
FT                   YPHCWRHKTPILFRSTPQWFIGMDIECEQGEADPGRADVTEEAGATGEARKVGKAEEAK
FT                   EAEEAEEAGPAKTLRASARDAIADVPFYPPSARQRMEAMIDGRPDWCVSRQRTWGVPLP
FT                   YFVRRDDRSLHPRSARLVEAVAARVERDGIAAWSRLRPAELGVDENAYEKLSDTLDVWF
FT                   DSGSIHATVYRDAARADTGGYPADLYLEGADQHRGWFGASLMTGCAADGRAPFRAILTH
FT                   GFVVDGAGRKMSKSLGNTVSPQRIADTRGADILRLWIASTDYAAEMSISDEILERVVET
FT                   YRRMRNTLRFLLQNVADFDPRDDAVPAGQLLDVDRYALARCREFVDACRSAYARYDFLA
FT                   VTRLAHGYCAEELGGFYLDALKDRLYASVADGVERRAAQTALHSVLANLLISIAPILSF
FT                   TAEEAWTVFAGDERDSVFLHTWDEHAPPPDDAALARWAHVRALRPHVTKALEEARGAAL
FT                   IGRSSEAELVVRAPRDVLDALAPLHGELAAVFIVAGVTLETADQIAVAVARTPLARCER
FT                   CWRHEPSVAAHASGDALCARCRHALSRRARAERSEPRAAVGSR"
FT   gene            complement(484213..485151)
FT                   /locus_tag="BURPS1710b_A0335"
FT   CDS_pept        complement(484213..485151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0335"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53731"
FT                   /db_xref="GOA:Q3JLQ9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ9"
FT                   /protein_id="ABA53731.1"
FT                   /translation="MTQRLLAAAWRRPVWLLWVPPAFWAGNVVLGRAFSTSFPPVSLAV
FT                   GRWLVALVALAPFVWRDVLRERRLLLRHWKLIWACGALGIAGYNALAYVALRTVPAASV
FT                   AFLNSTLPLMVPLAAAMLGVERITSRAIVGIVVSFGGVAWIVARGHWEDLVALRFDHGE
FT                   LIVILATANYAIYSVLLRRKPAAIGPLAFLAATMAAGLAVLAPFWALELAGGARIPFDP
FT                   KAIGAVLYIGVFASLIAFILWGHCVQVLGATVTGVSFHLVALFTAVLAALTLGEPVRSY
FT                   HLVGIALILFGFFVATRAAPGVRSAPNARSL"
FT   gene            complement(485148..485867)
FT                   /locus_tag="BURPS1710b_A0336"
FT   CDS_pept        complement(485148..485867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0336"
FT                   /product="putative alanyl-tRNA synthetase related protein"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF07973"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51227"
FT                   /db_xref="GOA:Q3JLQ8"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ8"
FT                   /protein_id="ABA51227.1"
FT                   /translation="MNRLFCQDDPDTLLLSGTVVDTRPGAVRLSRHPFYPGGGGQLPDL
FT                   GTVRWEGGVETVAGFSEDGGGLWIEFANGVEIVGDVQSSVDAAFRRAMRELHTDLHVLN
FT                   ALVYRDFDGALVTGVQMNADRTARIDFDLPDADNDRLRALEAEMNDVVRRDLPVRTRYV
FT                   PLADAQQASGLLRSRSVAPPPTADGLVRIVEIDGLDSQACGGTHLASTGGSSPVRILKI
FT                   ENKGRSNRRVRIGLEPR"
FT   gene            complement(486417..487910)
FT                   /locus_tag="BURPS1710b_A0337"
FT   CDS_pept        complement(486417..487910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0337"
FT                   /product="D-lactate dehydrogenase (acceptor: cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52262"
FT                   /db_xref="GOA:Q3JLQ7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ7"
FT                   /protein_id="ABA52262.1"
FT                   /translation="MREVTDDGQQWDGRAAAFAGVPPGGGAPAAFATPQTIGRCVEALR
FT                   AIVGERLAVGRAVREQHGKDISFHPGAPPDAVAFVRTTAEVAEITRACHRLRVPLIPFG
FT                   TGTSCEGHIAALRGGVCIDLSGMNRILRVSAEDLDCTVEAGVTRKQLNAHLRDTGLFFP
FT                   IDPGADASIGGMCSTRASGTNAVRYGTMRESVLALEVVLPNGDVVSVGSRARKSAAGYD
FT                   LARLFVGAEGTLGTITGVTLRLHPRPDRLSAAVCSFPDLKAAVDSVIGVIRSGVPIARV
FT                   ELLDALQIVACNRYAKLSLDERPTLFFEFAGFGAAVDEQIDWVGEICAGYGGGEFRWAS
FT                   RPEERSALWAARHDAWWAALALRPGCEGMPTDSCVPVSRLAEAVLAARADVDALGLVAT
FT                   ICGHVGDGNFHVCIAIDPADADELARATELNRRLALRAIALGGTCTGEHGVGYGKIGYL
FT                   EREHPTALQLMAAVKRALDPRGIMNPGKVLHHDRYPPFD"
FT   gene            487387..489393
FT                   /locus_tag="BURPS1710b_A0339"
FT   CDS_pept        487387..489393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0339"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53246"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ6"
FT                   /protein_id="ABA53246.1"
FT                   /translation="MPPIDASAPGSIGKKSPVSRRCALSCLRVTPASTVQSRSSALTRR
FT                   IRFMPDRSMHTPPRSAAMCPSHDVPVPNGISGTRSRWHARVISATSAVVRTNATASGGA
FT                   PGWNEMSLPCCSRTARPTARRSPTIARNASTQRPIVCGVANAAGAPPPGGTPAKAAARP
FT                   SHCCPSSVTSRMRRLRSSIAPARRGAQPAHTRGRPHPRAAARAPRACRPPSGPRSRRPS
FT                   FPLEAADDHQLHVGRAFAQRLRVLIIGRMIEARRRVRVRELDEHDPPLVGGPLERQLLA
FT                   AACEEAAAVARDDVGRQRLVTRVFRRIADRHPAQQICRHGSLAPQASEKRRRAAPCPAS
FT                   SRRLLHVARFQQRRIEQIPHARERIEKLLRAFDHERRMLGFQRGLHRGARVLLMLLLGA
FT                   DLAPMLEQVVHLGHLERRAVQPAVDETVLLARDQLAIRDHLERERGAEIAIRRFDVDKL
FT                   AALEHVDRTAHLRREAGLVVVAGQRAEQFVRIALERALDGRLIVQIGNHRAARRAIDDV
FT                   ARHRRELGTVPRFAVDDLGHQLALLLQPVLGERARKIPARARRRAEMLDLMEQRPDDLR
FT                   FGIDLRPVQEHRVAIAAMAFDFLNQFIDSDRHDTLLGSDYITSAQDNEEHLLKRSPESS
FT                   GHRGGRAFRRRRFRTPPARISPATRPRSAAGAT"
FT   gene            complement(488050..488346)
FT                   /locus_tag="BURPS1710b_A0338"
FT   CDS_pept        complement(488050..488346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07045"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53003"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ5"
FT                   /protein_id="ABA53003.1"
FT                   /translation="MAAYLLGRMAISDPSKYARYKALTPDIIARYGGRFLTRGGEKLTL
FT                   EGPADERRIVLVEFADADAAARFYHSADYQHAKSLREGAADMQLMIVGGFERK"
FT   gene            complement(488407..489210)
FT                   /locus_tag="BURPS1710b_A0340"
FT   CDS_pept        complement(488407..489210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52374"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ4"
FT                   /protein_id="ABA52374.1"
FT                   /translation="MPITVDELVQKVKSHRCYSHPVFLNWAKVDPEPKVVGALFHQIQH
FT                   FCASTRPGWNFPRALAEHGLQKQSELMTEIVDSESGHGPELATMAGYIVNRAAGGAVIP
FT                   DLYDQAAVEGALKRYSDELLGSLPGYDDETGLTTQVRRAINVFERRKLVDVESTYRNLG
FT                   TALALEMISNRQLIPGEKHCLVDSGLYGASLEVPEMHYLLEHWGEVGAEQQHEENARAA
FT                   VKPALESEHAALVIEGAQEFLDALASVWDLLDASLLESGYVKKAA"
FT   gene            complement(489269..490513)
FT                   /locus_tag="BURPS1710b_A0341"
FT   CDS_pept        complement(489269..490513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52616"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ3"
FT                   /protein_id="ABA52616.1"
FT                   /translation="MAALHDRCACPPRAPGPQDRAGRCCRPGEAPSGGACGGFGAACVG
FT                   LPRLRIDRIGAFQFHPIQPIKADIVLRRGLCNLKTRKGVAMQNVDRPTGSSLAGAAILL
FT                   EIGAAYGIVDFIRHSNGFDVAALAERSGIGEPMIADYVDAMREAGLVTLAKAGERDIYR
FT                   PADDFPDVVNDVGYLSWALLACAPLIVNAREFAADNALAQARHPRDGGLVARTSKWMGE
FT                   LSFYPQPERAILKLRPKKIVDLGSGSGGFLIRMLHQLDGARGVGVDLSATATEQAKQAA
FT                   EANGFAGRLEFLHRPIQSLVDDPAPLKGADVVHAGFVMHDLLPAEERTLDALLETCREH
FT                   ASSGTVVIVDAVPLAPDRWERSFAAAFNHLHRNFMSRRLLSEDAWREKFEQAGFGNVAV
FT                   ETLGHPGGRMILGSA"
FT   gene            490679..491977
FT                   /locus_tag="BURPS1710b_A0342"
FT   CDS_pept        490679..491977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0342"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51368"
FT                   /db_xref="GOA:Q3JLQ2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ2"
FT                   /protein_id="ABA51368.1"
FT                   /translation="MDARYPGDSNYRFAQILCFNAETYFRGASPCTRKYRARRSRFAVR
FT                   APQARASEPRAAVPDARFASPRRFPLEWCPSAHGARAAATGAAARHGMKLASHGWRAPR
FT                   AHMPTTSKHPPACAAPSTRTERPRPPPAVSFHRNRGSTVAKLDHRNQSRYWHSPGISGV
FT                   DLLLADFTTHDYAPHVHDSLVVAVTEVGGSVFKSRGQTRLAEPNAVLVFNPCEPHSGRM
FT                   GGSSRWRYRSFYLAEAGLSRVLTLLGMTQPRFFTSNVLDDPQLVEQFLTLHRAMDEQDD
FT                   LLRQQELLVSSFGTLFSRHGLQAGLGAGPGFGTKAGLPALKPALDLMNDCFDHALTLEQ
FT                   IAAAAGLTSFQLITAFNRVIGLTPHAYLNQLRLRAALRELQAGRSLADAALTSGFYDQS
FT                   ALCNHFKRTFGMTPMQYTRALAPGKRALAPIGI"
FT   gene            complement(492163..493236)
FT                   /locus_tag="BURPS1710b_A0343"
FT   CDS_pept        complement(492163..493236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53743"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLQ1"
FT                   /protein_id="ABA53743.1"
FT                   /translation="MTPHGPRDSRFATRVRAAALAGICAHYSRGFTATMESAMDISKIQ
FT                   HSAVALDASSDSSSGQQASGHTAARQTSSRGAGAALGGLKELQDLKRGDLIMEHGNMHA
FT                   VMYAGGDKPLVHSTNGKFFGVLQQGPNYLTKKFGNEAPTKLPVYRMKNADSPIPSEAAR
FT                   IGEQWAIRSGDTETTKTKTPFGENRLNDADEDKAVEWSPEATFRAARAALRSDEGMPLS
FT                   KQQGVSCSQFVTYAYQAAALKKGGDASGGAHEALDSVKQAGAHRQGAFKTAENKVQQQA
FT                   GLVQGAHEQATQAMPHTLQVNAKHMTADVLAERLRERGGDFERVGYAVPYEKDGESGVK
FT                   LLPKDDPRATQKISNIE"
FT   gene            complement(493374..494390)
FT                   /locus_tag="BURPS1710b_A0344"
FT   CDS_pept        complement(493374..494390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0344"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01274"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51522"
FT                   /db_xref="GOA:Q3JLQ0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLQ0"
FT                   /protein_id="ABA51522.1"
FT                   /translation="MNLQKFPRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGL
FT                   AFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVN
FT                   YHDAVYDRVGNIQMSRMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCS
FT                   DHPLGGLGFVGFAEEVRAQEAELGFQFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGV
FT                   DASAKPAQTREQILRIAKHTADRVELGRDITSADVVLDERFGGPEYGLPNEGTLEAIRL
FT                   CAKLEGVLTDPVYEGKSMHGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG"
FT   gene            494583..495092
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_A0345"
FT   CDS_pept        494583..495092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_A0345"
FT                   /product="Lrp regulator"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52675"
FT                   /db_xref="GOA:Q3JLP9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP9"
FT                   /protein_id="ABA52675.1"
FT                   /translation="MRATKKSSPKAAAPPAGVDIDRVDRAILRVLQRDASVSNVALAAK
FT                   VNLSPPACLRRVERLKEMGLIRGIVALLEPKALNAGMLVMIGVVLDRSTPDSFGAFEQA
FT                   AQKVSGCMECHVVTGEFDYIMLIRTRDSDTFNRLHAEQLLYLPGVRQIRTFVVLKEILS
FT                   TTSFPI"
FT   gene            complement(495055..495423)
FT                   /locus_tag="BURPS1710b_A0346"
FT   CDS_pept        complement(495055..495423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52280"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP8"
FT                   /protein_id="ABA52280.1"
FT                   /translation="MNGAVNARGKWGGRRCERLDGGRGRGFSLRRPLDGLNARLLERGN
FT                   AETRRCESPQARHSPGIPRALPEHAASAAPRAWRHACAVGGAHRAADGAFGARFASAGR
FT                   HAKAARLKSENSSSTESP"
FT   gene            495522..496973
FT                   /locus_tag="BURPS1710b_A0347"
FT   CDS_pept        495522..496973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0347"
FT                   /product="Protein of unknown function family"
FT                   /note="identified by match to protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53410"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP7"
FT                   /protein_id="ABA53410.1"
FT                   /translation="MALPQDSVNMALFCDFENIALGVRDTKFEKFDIKPVLEKLLLKGS
FT                   IVVKKAYCDWDRYKTFKAAMHEASFELIEIPHVRQSGKNSADIRLVVDALDLCYTKAHV
FT                   DTFVIISGDSDFSPLVSKLRENAKRVIGVGVKNSTSDLLVANCDEFIFYDDLAREQQRA
FT                   LAKRDARKAEAGAKRTADDDKHRKHDGDARKAEAISLAVETFDALASERGESGKIWASV
FT                   LKSAIKRRKPDFNESYYGFRAFGNLLEEAQARGLLEIGRDDKSGTFVFRPIQTAAVEVM
FT                   RPIEAAVDDASAGAKPSGKKAHGKARGAKKRMPEQMPLIVETAAGAEGHAHADIEANAE
FT                   LAEASDSAPRGMRRERPADDARDTHPAHGAHEPHETRAAHEPARAGESTKVAEAAEAQA
FT                   ADTAKPARSRARKTAVKKAKGTQARAADASPVAAAEADAAGEPSHAAPHAFAPESATEA
FT                   APAKTPRKSAPRARRPRKTAATSES"
FT   gene            complement(497177..498472)
FT                   /locus_tag="BURPS1710b_A0348"
FT   CDS_pept        complement(497177..498472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0348"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51297"
FT                   /db_xref="GOA:Q3JLP6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP6"
FT                   /protein_id="ABA51297.1"
FT                   /translation="MDETSIRERAVMAKIARRLMPLLVIMFLIAFIDRQNVGFAKLQMV
FT                   HALGMTETSYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMMTWGVITVLLGFTH
FT                   STGVFYVFRFLLGVAEAGFYPGVIYYLTLWFPQSHRTRVLGLFTLGSALANMLGSLAGG
FT                   LLLSLDGRLGLAGWQWVFVATGLPAIAVALVAWRYLPESVERATFLSDDEKRVALAALK
FT                   REASPEAVSESPWRALVDPRVLMFALAYMLMSTSLYGVTYWLPTLLKSNGVPSSLNGLL
FT                   NMIPWAIAALLLLWLPARLKRERIVLKAVAAVAGVGVAGFALSLALPGLPLRFAALVLG
FT                   GACIPLLYPCFWSLPPRFFSGARAAASIAAINSIGNLGGFFAQNLMPYVGKAAGSAGAP
FT                   MLVPVVCLAALGVGMLAAASMAGRRRPAGMAA"
FT   gene            498532..499365
FT                   /locus_tag="BURPS1710b_A0349"
FT   CDS_pept        498532..499365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0349"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53529"
FT                   /db_xref="GOA:Q3JLP5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP5"
FT                   /protein_id="ABA53529.1"
FT                   /translation="MRNYPCSLPELGKHHRVCPDSLRTTSCKHIDEFGETMHATDDRLP
FT                   RYQRLRDELAALIAARHWLPGEAIPTEQALAKRYDVAIGTVRKAVDLLVADGMLERFQG
FT                   RGTFVRRASFDSSLFRFFRFQGRHGERRIPESRILRREVVEAPSAVAAALQIPARASVI
FT                   EMTRVRLIDGAPMLAEEIWLPYDRFAAFARLELASIGDLLYPVYEAHCNQIVASATETL
FT                   TVEAIGPVHARLLRIEPGTPAVVIERLAYGYDRRPLEWRRSRGPASEFIYQAEIR"
FT   gene            499425..500849
FT                   /locus_tag="BURPS1710b_A0350"
FT   CDS_pept        499425..500849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0350"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51520"
FT                   /db_xref="GOA:Q3JLP4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP4"
FT                   /protein_id="ABA51520.1"
FT                   /translation="MERRAARMASSARQETTVFTWFAAVSPRERRTFWACFGGWALDAL
FT                   DMQMFSLVIPAIVAEWSLSRTQAGFVGGATLVASALGGWVAGMLSDRFGRVRALQWTIA
FT                   CFSVGTFACAFATSYPQFVTLKTLQGLGFGGEWAAGAVLMAETIRAEHRGKAMGAVQSA
FT                   WALGWGSAVLLYALAFSLLPAELAWRVMFAIGLLPALLIVYVRRGIAEPSARALNPSGP
FT                   CDPPEPPNSPDGAPPSGASPAVRASAPLVGIFSRGTRRMTLIGALLGVGAHGGYYALMT
FT                   WLPTYLKTERHLSVLGTGGYLAVIIVAFFCGCLASAQLLDRIGRRGTILAFAACCVGTV
FT                   ILYLFAPLGNAAMLALGFALGFFAAGIPASMGALFNEMYPRGTRGTGVGFCYNFGRVAS
FT                   AGFPVLVGHMSAGMPLGTAIGIGAAVAYSIVVVAVLMLPETRGRTLDDCASADADAARA
FT                   GAGRIGAPAAPGARHR"
FT   gene            500901..501791
FT                   /locus_tag="BURPS1710b_A0351"
FT   CDS_pept        500901..501791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0351"
FT                   /product="hydrolase"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53500"
FT                   /db_xref="GOA:Q3JLP3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP3"
FT                   /protein_id="ABA53500.1"
FT                   /translation="MSEQEWNAFAPAAAAPHAACGITAIDAHAHVFETGLPLAGRRRYA
FT                   PDYDAPLDAYLAQLDAHRVSHGVLVQPSFLGSDCRYLLRALARQPRRLRGVAVIDAGCA
FT                   PAALDALDRAGVVGIRLNLIGMPDPALDGPAWRATLERVAALRWHVELHAQAQRLARLI
FT                   APLLAHRVNVVVDHFGRPEPARGIADAGFRDLLRAAATRRVWVKLSGAYRNWPFAPGEA
FT                   HARARAAFDALAAEFGAERLVWGSDWPHTQFERTETFGRALAFARRWIPDDAMRRAIFV
FT                   ETPARLFRFGEQRGA"
FT   gene            502014..503684
FT                   /locus_tag="BURPS1710b_A0352"
FT   CDS_pept        502014..503684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0352"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51705"
FT                   /db_xref="GOA:Q3JLP2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP2"
FT                   /protein_id="ABA51705.1"
FT                   /translation="MPRVARHPHAPERAARLPARPSPAHVARGIALVPAVAARRAMMSC
FT                   RLHISYIGRAYFYGFPTGTTMPRPILRAAALSLTLAGAALFHACTSSVDNQPDAASAPA
FT                   NIQAAWVEIGDANQAIARVITNYAPPPAAPGEPAPAVCPQLNADGKIARMTLRVAAGTA
FT                   AQRPTASDPADSKPSSFPVSVCETTLPANAKDVSVASRALPLPKAEPQRVAIVADTGCR
FT                   MKKADNAFQACSDATVWPFATIAASIAKLNPDLVLHVGDYHYRENACPPDIAGCRNSPW
FT                   GYGWDAWRADLFEPAAPLLAKAPWVVVRGNHEECARAGQGWFRFLDPRPYSDARSCNDA
FT                   ANDGNANYSEPYAVPLGTGSQVIVFDTAKVGRAALKTTDTQFQLYQKQFQTVAALASKP
FT                   GMSTTIFTNHHPILAFAPIPGSTPAPGNLALQSVMSSLYAQAYYPPGVQVALHGHVHDF
FT                   QAINFASGHPATIVSGNGGDNLDVALPDPFPANLTPAPGVVIDKLSHNNSFGFLIMERR
FT                   AAPARGWTFKAYTAAGKLLASCDQAGATLTCDKTGFVAP"
FT   gene            503681..505303
FT                   /locus_tag="BURPS1710b_A0353"
FT   CDS_pept        503681..505303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0353"
FT                   /product="di-haem cytochrome c peroxidase family protein"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51958"
FT                   /db_xref="GOA:Q3JLP1"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP1"
FT                   /protein_id="ABA51958.1"
FT                   /translation="MTGGKRSGAARRAGAAFAARGPALAGAPGARNARRIVSTLAIAAV
FT                   TRAAGGALAACASAIAFASGAAAPGALDAVRAAHPASSLSPARTPGAGGAAHVKPVQEA
FT                   LRAKAASPSPSLLPSPPSPTTSLLPGAPPQRVVATIGRGTPQVASKVDPTAAAFHPDPA
FT                   LAALGKRVFFDPALSEPRGTSCASCHDPGRAFAPTLSRAALAGPRVPQGSRPGHFSRRN
FT                   APSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASPA
FT                   ALTRKIGGTALGAALAERFGPSVRRDPERMVRALGEAMQAYLQSDEMAPFSSRYDAYVM
FT                   QRAPLTPQEKRGLALFRNPDKGNCMSCHTLSDTASRPERSLFTDFGYDAIAVPRNRALR
FT                   ANRDPRHFDNGLCDTAAKLRWPEPAQWCGYLRTPGLRNVAIKESFMHNGVFDTLRDAVA
FT                   FYNTRSTDPKRWYHGRDTFDDVPAAYRGNINVNSTPMNRRAGTPPAMTDADVDDIVAFL
FT                   RTLTDARYVGLMPAAPDGKAARP"
FT   gene            505482..506342
FT                   /locus_tag="BURPS1710b_A0354"
FT   CDS_pept        505482..506342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0354"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52567"
FT                   /db_xref="GOA:Q3JLP0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLP0"
FT                   /protein_id="ABA52567.1"
FT                   /translation="MSNQSIGAPDSTAVRVALWRALHARIDAPPHVLDDEIGLALAAPD
FT                   DDWRSRPDMDPQASRGYRASIVGRARFVEDLVDEQADRGVAQYVVLGAGLDTFAQRRAK
FT                   LASHLRVFEIDQPGTQAWKRQRLIALGYGVPQWLRLVPVDFETSGAWRAQLSAAGFDDS
FT                   RPAVVSSTGVSMYLTREAIAGTLSQIATLAPGSTLAMTFLLPLELIDDPAERAQHAAVY
FT                   ERARAAGTPFVSFFSPSDMLALAREAGFREARHVSTDDLVRRYFESRPDGLRPASGEAF
FT                   LVAST"
FT   gene            506961..507302
FT                   /locus_tag="BURPS1710b_A0355"
FT   CDS_pept        506961..507302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53446"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN9"
FT                   /protein_id="ABA53446.1"
FT                   /translation="MQLHIPPILDKLTVLYLCPVRCEMEHLVRIVNDTDRQILAWLRSQ
FT                   VGDERVERAAQHMGRVRKPYLSAVCRYLGVWPPISLRYPPRHGAVDHAVGDRYLTLIRQ
FT                   HLAAHTAGR"
FT   gene            complement(508200..508709)
FT                   /locus_tag="BURPS1710b_A0356"
FT   CDS_pept        complement(508200..508709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0356"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51428"
FT                   /db_xref="GOA:Q3JLN8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN8"
FT                   /protein_id="ABA51428.1"
FT                   /translation="MISIRLLEPADAAAFSALRLVAIDTSPSAIWPTRAEEAGRSMREV
FT                   EARLRASGTQAVFGALTDDGGLIGIAGVRREALVQLAHKAVLWGVFVAPAYRGNGLARR
FT                   LIDAALTHASRDWGVEQVNLCVNTENEPAKALYASLGFETFGVERRAMRVGDRFYDEQH
FT                   MVRGRR"
FT   gene            complement(508804..509226)
FT                   /locus_tag="BURPS1710b_A0357"
FT   CDS_pept        complement(508804..509226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0357"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51610"
FT                   /db_xref="GOA:Q3JLN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN7"
FT                   /protein_id="ABA51610.1"
FT                   /translation="MSLLFAFLSGLLFGAGLLLSGMANPAKVQGFLDLAGNWDPSLAFV
FT                   MAGAIAVGSIAFAFAKRRERSLLGLPMQIPPRGAVTPRLVAGSAAFGVGWGLVGFCPGP
FT                   AVVSLGLGGAKAFGFVAAMLIGMAAFECGERFRAKR"
FT   gene            complement(509228..509662)
FT                   /locus_tag="BURPS1710b_A0358"
FT   CDS_pept        complement(509228..509662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0358"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52172"
FT                   /db_xref="GOA:Q3JLN6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN6"
FT                   /protein_id="ABA52172.1"
FT                   /translation="MAVDLVHFTPGLSFAGGLLIGAAAALLVFFDGRIAGISGIVGGLL
FT                   AGGRSDAGWRAAFLVGLIAAAVAASALDWFSMPAVDAGWARVIAGGVLVGIGTRYAGGC
FT                   TSGHGVCGISRGALRSIVATAVFMAAGIATVFVLRHVVGG"
FT   gene            complement(509652..509999)
FT                   /locus_tag="BURPS1710b_A0359"
FT   CDS_pept        complement(509652..509999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0359"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53177"
FT                   /db_xref="GOA:Q3JLN5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN5"
FT                   /protein_id="ABA53177.1"
FT                   /translation="MSAACSPIDLSGMRASADAACALLKVLSNPDRLLMMCELAQCGEL
FT                   CVSDIEARLDIHQPTLSQQLGVLREHALVDTRRDGKNIYYALTSEPAVAIMAVLYEQFC
FT                   ATHQKGKRRGR"
FT   gene            510135..510320
FT                   /locus_tag="BURPS1710b_A0360"
FT   CDS_pept        510135..510320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN4"
FT                   /protein_id="ABA52628.1"
FT                   /translation="MAHAKPPIGIGMNRIDMKRILILLLCLGVLGVASGCAAPQTALDS
FT                   SVDTRRPARAGRPNWL"
FT   gene            510513..511046
FT                   /locus_tag="BURPS1710b_A0361"
FT   CDS_pept        510513..511046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0361"
FT                   /product="cytochrome b561 family protein"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51624"
FT                   /db_xref="GOA:Q3JLN3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN3"
FT                   /protein_id="ABA51624.1"
FT                   /translation="MTPSTRTPDRYDLLSRILHWSVAALVLAQFALGWTMPDVHGTAPP
FT                   VGLVAWHVALGTALIVVIAARLLWSIVRRSPPAHQQGALLSFAASATHKLLYVALIAVP
FT                   LLGWLNANGRTWQLKLTGAIPLPTIAAPHSLGAAIGEWHSLSATLFIVLIGMHALAALV
FT                   HRFVMKDGAFERMI"
FT   gene            complement(511337..513394)
FT                   /locus_tag="BURPS1710b_A0362"
FT   CDS_pept        complement(511337..513394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0362"
FT                   /product="possible selenocysteine lyase"
FT                   /EC_number="4.4.1.-"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53635"
FT                   /db_xref="GOA:Q3JLN2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN2"
FT                   /protein_id="ABA53635.1"
FT                   /translation="MRWLSSMTWRSASTMTIPTPTVDSAMSAAPVALPDAAPPAGLPDP
FT                   ATLARLASEFLAALPGQPAAPNAGAGSGAVGGVPSALPAAAPMLASVSNPAPPGSPLAG
FT                   PGGTGTGVPGIGVPPGKVPGANLVPAPTHVLSLGNRTPALVGHAAAQNGWPDSAVAIAP
FT                   ALEPRAGGVALGVPPVPEPDAVRRAGDASAAAAPSPWSYYFVEPASDDWWRDAARTPID
FT                   VPRDGVASPRAFGLPDENAWRDLLSIGWPAADRHRASRYFVDDAQPTNAHAPGAGAHPP
FT                   FDIAAIRRDFPILAERVNGKPLVWFDNAATTHKPQAVIDRLAHFYAHENSNIHRAAHAL
FT                   AARATDAYEHARATVQRFIGAASPDEIVFVRGATEAINLIAKTWGVGNVGEGDEIVVSH
FT                   LEHHANIVPWQQLAASVGAALRVIPVDDAGQVLLGEYRKLLNDRTKIVSVTQVSNALGT
FT                   VVPVKEIVELAHRAGAKVLVDGAQSISHMRVDVQALDADFFVFSGHKIYGPTGIGVVYG
FT                   KRALLDGMPPWQGGGNMIADVTFERTVFQPPPNRFEAGTGNIADAVGLGAALDYVARIG
FT                   IERIARYEHDLLAYAAGVLAPVPGVRLIGTARDKASVLSFVLKGYETEEVGRALNAAGI
FT                   AVRSGHHCAQPILRRFGLEATVRASLAFYNTRDEVDAMVDVVRELAARRI"
FT   gene            complement(513327..514259)
FT                   /gene="srpI"
FT                   /locus_tag="BURPS1710b_A0363"
FT   CDS_pept        complement(513327..514259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srpI"
FT                   /locus_tag="BURPS1710b_A0363"
FT                   /product="major membrane protein I"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN1"
FT                   /protein_id="ABA53406.1"
FT                   /translation="MSTTVSAQTALGDNAARQLANATKTVPQLCTITPRWLTHLLQWVP
FT                   VEAGIYRLNQVKNPEAVRAACTAREDEGALPRTFVPYEEEPREYFLSAVSTVLDVHTRI
FT                   SDLYSSPHDQIKEQLRLTIETIKELQESQLINHPDYGLLANVAEAQRVFPLTGAPTPDD
FT                   LDELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDK
FT                   VPVADGKTKILLLRVGDKRQGVVGLYQPGIAGEQGPGLSVRFMGINNQAIASYLISLYC
FT                   SLAVHSPDALAVLDDVEIGKYHDYPDTYR"
FT   gene            complement(514380..514664)
FT                   /gene="sgraIC"
FT                   /locus_tag="BURPS1710b_A0364"
FT   CDS_pept        complement(514380..514664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgraIC"
FT                   /locus_tag="BURPS1710b_A0364"
FT                   /product="possible transcriptional regulator, XRE family,
FT                   CUPIN domain"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52830"
FT                   /db_xref="GOA:Q3JLN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLN0"
FT                   /protein_id="ABA52830.1"
FT                   /translation="MTALVQRFGAAIRQLREARAWSQEQLAEHAGLNRSYVGEIERGTA
FT                   IASIVTVDKLARAFGVPIARLLSPAGDAGPPPHGFGAPPASSAPLSSTR"
FT   gene            complement(514661..515488)
FT                   /gene="srpH"
FT                   /locus_tag="BURPS1710b_A0365"
FT   CDS_pept        complement(514661..515488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srpH"
FT                   /locus_tag="BURPS1710b_A0365"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51936"
FT                   /db_xref="GOA:Q3JLM9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM9"
FT                   /protein_id="ABA51936.1"
FT                   /translation="MRLGPPDLRQESENFYVSHALDDALHALLAQARLELRYKGRHDAD
FT                   APAEAAIDAKADAAVRAFAARLPDIRALLDSDVLAAFHGDPAAGSVDEVLLCYPGVLAM
FT                   IHHRLAHALYRLELPLLARIVAEHAHAQTGIDIHPGAQIGGGFFIDHGTGVVIGETAVI
FT                   GERVRVYQAVTLGAKRFPRDASGHLEKGLARHPIVEDDVVVYAGATILGRVTIGKGAVI
FT                   GGNVWITQDVPPGSHVTQAVTRSDPARPADAAASSPRPAGAHDATLSAAQALR"
FT   gene            complement(515765..516232)
FT                   /locus_tag="BURPS1710b_A0366"
FT   CDS_pept        complement(515765..516232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0366"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52363"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM8"
FT                   /protein_id="ABA52363.1"
FT                   /translation="MTIELEARATHAVLDAAREAALAAGLPYAGGVSPRDAWALVAAGH
FT                   ARLVDVRTAEERTFVGHVPDSLHVPWATGTSLTRNPRFVRELEAKTGKDAVVLLLCRSG
FT                   NRSALAAQAAAKAGFTQVFNVLEGFEGDLDDAGHRGTTNGWRLHGLPWRQS"
FT   gene            516368..518716
FT                   /gene="ptrB"
FT                   /locus_tag="BURPS1710b_A0367"
FT   CDS_pept        516368..518716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="BURPS1710b_A0367"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51778"
FT                   /db_xref="GOA:Q3JLM7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM7"
FT                   /protein_id="ABA51778.1"
FT                   /translation="MTRRAWVIVGIAHGYGRSGKRHGVGTGFGQPRHDEGTLATCTRRA
FT                   TRAPRMPAADASQSTSRQPSASAARLTLPLHAMPLAKNAMPHASWPEQADPHQFLEELD
FT                   SAASVGWVDAQNARTHDAPWLDEAHYRALVERFTRALLPRERPVIPQRWQDWAYDVWQD
FT                   EQHPKGLWRRTRWTSWRSGHADWQTLIDLDALGEAQGVQWVFDDQLILEPDGDRALIVL
FT                   SDGGADAVVVREFDIAQCRFVDDGFSIEAAGKHSVEWIDRDTIYVGWDDGGATVTRSGY
FT                   PREVRRWTRGTPLSSAPVVFRGARGDISVDAQYDPLDRHHAIEQAINFYDANTYRLAED
FT                   GAWARYDVPPHVEVGYWSGWLLLQPRLDWTCGGARYAGGSLLAIREDAFVAGERAFAAL
FT                   FEPNERTSACGWTHTRRYVLVSWLDDVLTRTMLWLPERQDDGAWRWHARPFPARGLAQV
FT                   DVSPVEPTFDDEVYVSVDDYLKPPEYSLANLASDDLSAWTLLDRWPTQFDASELTVRRE
FT                   HARSRDGTLVPYTLVGPRDVLDNAARAPRPCLLNGYGGFAIALTPDYDPLLGIGWLEKG
FT                   GIAVFAHIRGGGEFGTQWHESARQTQRQRSFDDFIAVAEKLVADGVTSAAQLGIRGGSN
FT                   GGLLVAACMIQRPDLFGAVVSDVPLLDMQRYALLHAGASWLDEFGDPDDPAHASALAAY
FT                   SPYHRVARDIAYPPALFTTSTSDDRVHPAHARKMVARMQAQGHRNVWLIEKTDGGHGSA
FT                   DAIDTAEHEAIGYVFLWTHLSRGAHDARE"
FT   gene            518713..523395
FT                   /locus_tag="BURPS1710b_A0369"
FT   CDS_pept        518713..523395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52086"
FT                   /db_xref="GOA:Q3JLM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM6"
FT                   /protein_id="ABA52086.1"
FT                   /translation="MNRRDGACGRSPRLSCMRGGSTLPPRRIAAGAAARARCRRESRLS
FT                   PSSCTDSRRCDRLSIARRHRAMTRIARAAPVASFIEAIARVWRMASRTSCGAHARTIAV
FT                   LALLPTSSRFLAPSRFIPRHAGTTPPPRSPSHRLTASLPHCLTASLPHCLTASPPHRLT
FT                   ASPPHRLTADHASSAITPIDPAPRPTRSTPAPVPAPPRPRDPPGLSLPTVVRADHRLGR
FT                   RLRLARVHFVHPRALRRQRRVAVQQMPAARLRLHRRAHRQPHPQRVRRQLRRLQRDHHR
FT                   QALHHLDPVPRRVLRRQHRECAARARREALHPSVIRHPRAVQVRFEPHRLAHPHVPQLP
FT                   FLEVRLHPHLPQLHHRHQRHPRPHLLPDLHRPLPDRPVHRRHDRRALQVPVRQLELRGR
FT                   LLHRRVLPDRPLAAQRARRLPLRLRSRQRRLRVRQRRLRPRQLLRRHHFHRRPRPRPIR
FT                   LLRELQVRLARLHRLLVRLHRQPRVRHLPHRLRELRLRLRERRRRLRVVEPHQRLPRLH
FT                   LLRVGHQHVGYRPLDLRGDLHDVARHVRIVRLFAEAAHDEPVERRAQRDDRQHSEEPCE
FT                   AAAARGPARGKRRGGFGRRRQAVPARGRAVGNGRIGGRLRARSVGGGVVQDGGVRDVGG
FT                   AGRRGSDGPGRRRGAARGASMLGGGVGVGRISRIHGEGGVGVDVFALAALTRCARACVV
FT                   SAAHGRRGRGVGARRAAIAAASGGVAIAASARPLLSIRAALPAASPAASPCLGHRSIIR
FT                   RSRGRRARAPDASARSLPSFAHSSSRIRSRLPRASHRSIRLRIVRRHRPRRRRERLARL
FT                   RGRRAARRPRVEAAAQRADQPHPQRAPPRLQLHHVRALVQQRELRHVDVLAHPHPPAMP
FT                   VLRQRHHPLRRAQRLLLRLQQRVERRQRRQLPRHLAQRRIHRLVVQRERHVRVRHVAAQ
FT                   LRLQPAAIEDRQRQRRPDRAAQRIVPEQRRRREREQPAQRRQVHVRVERRARAVDRRVR
FT                   RLHPQSRRDDVRPPPQQPGRQPRGQRRVRERRELRPRERQPALRPPPAQHAQLQLLQLD
FT                   LLVGQRDLLEQLAALERRVVRVVAVVDPARRALAQHRLDLLARAALLLQQLAQRIRAVQ
FT                   LAVQRHDRHRQREPRLLGLHARRIAHRQQPARGRRVLAPQVQLIVQPDEQRRRRHHRFA
FT                   HERHRHRQAVQRRIEGAARARHVRLGERGARRRGEPRQRFELLQLRLRDADARLRGLQR
FT                   RVLPQRFVDERVELRIAELAHPVRARPCAVRRAAGGVRERVVAGRARRERRLQARRHAA
FT                   GERPGERERREPARRAADRQGRRACGCVRCGLRHACDASFVRARFLCGRRRRCRTASPV
FT                   TASGIARPPRLAADTGASLCAVGVVGVVFLFTVIIGACRCVTRIDTAAGMPCAPGRAVV
FT                   PSPRSSRRADAGVRAPRLTTAAALRASPPRVPCGGPRAPPRTTPGARTPRRARPARSRA
FT                   ASRPSPARTAPPGPPARSSADSAPAPPETATRTAAPAASRCARRSIGAATHGASPSART
FT                   APPCAGAARRSGASAPATAPRTAARCAPARAGSTRCRHGR"
FT   gene            complement(519337..520806)
FT                   /gene="emrA"
FT                   /locus_tag="BURPS1710b_A0368"
FT   CDS_pept        complement(519337..520806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="BURPS1710b_A0368"
FT                   /product="multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51450"
FT                   /db_xref="GOA:Q3JLM5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM5"
FT                   /protein_id="ABA51450.1"
FT                   /translation="MSGRDDARTSASGECRERENVNSNASFTVYTRDSTDTDTAAEHRS
FT                   APRRAAAAPGPVRSAPAGATDITHATILNDTATDTARAKAPTDPAVSDGAPASGHGLPA
FT                   SPETAATLAARRATRRRRFAWFFGVLAIVALGAALYWFIVGRFSEETDDAYVAGNVVQI
FT                   AAQIQGTVTDVLVADTQQVKAGQALVRLDDAEAAAAFAQAQAQLAQAVRQVANTRLSMQ
FT                   TYEQTVKAREADLKLAQQAYRARAGASVEVVAPEELARAKSSLANAQAALAGAQAQREA
FT                   ARALGSERPVGQNPAVQQAAAQFKLAYRNLKRTTIVSPVDGTVGQRSVQIGQQVGPGVP
FT                   LMSVVQLRQVWVEANFKEGQLRHMRVGQPVRLESDLYGARVTYHGRVEGFSAGTGSAFS
FT                   MLPSQNAAGNWIKVVQRLPVVISLEPSELAAHPLRVGLSMRATVQTKARGGHLLDGDAP
FT                   LPAQRTRVHEMHAGEAEAAAEAVIRANDGGQ"
FT   gene            complement(521083..522666)
FT                   /locus_tag="BURPS1710b_A0370"
FT   CDS_pept        complement(521083..522666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0370"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53220"
FT                   /db_xref="GOA:Q3JLM4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM4"
FT                   /protein_id="ABA53220.1"
FT                   /translation="MTQTATHAATRTTTLPVRRPARRLAALALAWALAGCVPSGLKPTL
FT                   APRTPGDDALAHTTGGATHGAWPSPDWVRQLGDPQLDALVDEALRQNPTLQAAQARIGV
FT                   AQSQLQQFESLTGFTATAGASLSKAHVPRSGGTLNTTLNGLPVSVPLVGESVVSSSSLF
FT                   VGLNYQLDLWGKNAAATRGLLSMRDAARVEAEQARLTLSVAIVTLYGELDRAYALRELL
FT                   QQKRRASEQVEAVLRERAARGIDNGYDADDAALKRGKLLEQIALTDEQIQLQKLQLGVL
FT                   SGRGPERGLSLARPKLAPLADAPLPARLPAGLLGRRPDIVAARLRVEAAYAAIDGTRAS
FT                   FYPDVNLAALGGLFALTPASLFRHDALGGSIGPALSLPIFDRSRLKAKLGGDVANADMA
FT                   LALYNQTVDAALGEVARQLTSLATLDTLLKAQQQALRAAQRMVALAQDRHRRGMGMRKD
FT                   IDVAQLTLLDERAHVVELQARRRTLRVGLIGALGGGFDARPASGAPPAQAGQPFAAASR
FT                   PVAAHDAQPD"
FT   gene            complement(522971..523966)
FT                   /gene="rhlC"
FT                   /locus_tag="BURPS1710b_A0371"
FT   CDS_pept        complement(522971..523966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlC"
FT                   /locus_tag="BURPS1710b_A0371"
FT                   /product="rhamnosyltransferase II"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM TIGR01556"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52194"
FT                   /db_xref="GOA:Q3JLM3"
FT                   /db_xref="InterPro:IPR006446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM3"
FT                   /protein_id="ABA52194.1"
FT                   /translation="MTTLGALVILYYPTDEQLSGLEALARDSDALAVIDNTPHEHAAAR
FT                   ERVRALAARAHGEARVVWRHHGNRGGVAGAYNAGLSALFAQGVEAVALFDQDSTVPAAY
FT                   FARMRDACAQLGTQPGAHAGAFIAGPRIYDANEQRFLPELMTSGVAVRRVRVEGERAPQ
FT                   RCAFLISSGSVISRGAYARLGRFDEALFIDHVDTEYCLRALAHNVPLYVVPSLVLTHRI
FT                   GARRRHKVGPFELTAMHHGWLRRYYGARNAMQLGLQYGLRFPVALVPNLLTIWQVVQVV
FT                   LCEREKGAKLRGIALGVLDGVFGRLGSFEAARAGHRTAREEAMREARQQS"
FT   gene            complement(524207..525793)
FT                   /gene="bcrA"
FT                   /locus_tag="BURPS1710b_A0372"
FT   CDS_pept        complement(524207..525793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcrA"
FT                   /locus_tag="BURPS1710b_A0372"
FT                   /product="multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53653"
FT                   /db_xref="GOA:Q3JLM2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM2"
FT                   /protein_id="ABA53653.1"
FT                   /translation="MSAPARPAAAAANGAGAHEPAAARPLRGAKLALLTFALSLATFIE
FT                   VLDSTVANVAVPAISGSLGVSNSQGTWVISSYSVAAAIAVPLTGWLARRVGEQRLFVAS
FT                   VILFTLTSLLCGLARDLEVLVACRALQGLFSGPMVPLSQTILMRAFPPAKRTLALALWG
FT                   MTVLLAPIFGPVVGGWLIDNFSWPWIFLINLPIGLFSFAVCTLMLRPRASRGEASPIDV
FT                   PGIVLLVIGVGSLQAMLDLGHDRGWFDSSLITALAIAAGVSLVSLLIWELGEAHPVVEL
FT                   SLFRERTFTFCVVIISLGMMSFSVVGVVFPLWLQAVMGYTAYQAGLATASMGLLALVFS
FT                   ILVGVYASRVDARVLVTFGFGVFAAVMGWSTHFTLSMTFAQVVTPRLIQGMGLPCFFIP
FT                   LTAATLSRVADDKLAAASSLSNFLRTLSAAFGTALSVTWWDNRATYHYAVVSQAVTRAS
FT                   ENTQRYVDALHAMGLHGARELSSLHQVVRQQAYMMATNDMFYMASVTCVLLAGLMWLTR
FT                   PKRGAAATMGH"
FT   gene            complement(525790..527109)
FT                   /gene="rhlB-1"
FT                   /locus_tag="BURPS1710b_A0373"
FT   CDS_pept        complement(525790..527109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB-1"
FT                   /locus_tag="BURPS1710b_A0373"
FT                   /product="rhamnosyltransferase I, subunit B"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53006"
FT                   /db_xref="GOA:Q3JLM1"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLM1"
FT                   /protein_id="ABA53006.1"
FT                   /translation="MAKVIVTAIGSAGDVHPLLGVSRALAARGHDVVFCTHAPFEAAVR
FT                   ASGFAFVPVGTAEAYAQAMADPALWDPRTSFRTLWRVIAPVLRPHFDTLRALSDADTVL
FT                   VGTLWAFSARLMQERFGARYVSVQVSPSTLLSAHAPPTHKRLTIPKGLPLAVKAGLMTL
FT                   IERQVLDRVCGPELNAARRALGLAPARRILGRWLHSTDGVLCLFPSWFAPAQPDWPANH
FT                   LQSGFALFNDVGPVPADAELDAFVASGEAPVVFTAGSTLVDGRAYERAVTQVLRATGVR
FT                   GILLAPDAPAASDGTTGPRERTAETTARANGAALLKRRYVPLAALLPRCRALVHHGGIG
FT                   TASLAYAAGVPQVVTPFAHDQFDNAQRVAASGCGVRLDAPVRGEPLARALARVLGDAAM
FT                   AARCAEVRARMAAQPDGCDEAARFIERFAPGVAARQAQPA"
FT   gene            complement(527379..528278)
FT                   /gene="rhlA-2"
FT                   /locus_tag="BURPS1710b_A0374"
FT   CDS_pept        complement(527379..528278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlA-2"
FT                   /locus_tag="BURPS1710b_A0374"
FT                   /product="rhamnosyltransferase 1, subunit A"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53734"
FT                   /db_xref="GOA:Q3JGQ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JGQ8"
FT                   /protein_id="ABA53734.1"
FT                   /translation="MPIEKQVVALPSGLKVHVERHVFDPTFETVILVNGALATTASFGQ
FT                   TIRYLGERVNAVCFDLPYAGQSRQHNPGEYILTKDDEVEILLHLAERFEPSLLLSVSWG
FT                   GVASLFALARGCASVRRAVIASFSPFLNDAMTDYVTRARDHIAAGENLKAAQLLNDTVG
FT                   RYLPRIMKLYNYRYLTKLPRNEQDQVAFHVDQILAMQPEQYLPEFRQIGCAVKFINGEL
FT                   DEYTTASDVRRLAAYVRRAEFATIRQAGHFLDLEGRQQQEQVRAAVLGFFADERASAAR
FT                   DAAQDETLAPLGQLPALS"
FT   gene            529239..529847
FT                   /gene="betI"
FT                   /locus_tag="BURPS1710b_A0375"
FT   CDS_pept        529239..529847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="BURPS1710b_A0375"
FT                   /product="regulatory protein betI"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53008"
FT                   /db_xref="GOA:Q3JLL9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLL9"
FT                   /protein_id="ABA53008.1"
FT                   /translation="MLNEGSPMPKLGMREIRRAQLIDATLRSIDEAGLPGTTLASVAQR
FT                   ANISTGIVSHYFGDKDGLLEATMRHVLRDLWAATTRRRAAASDAPRARLRAVVAANFDD
FT                   TQISAPVMKTWLAFWSQSMHEPTLRRLQRVNTRRLHSNLCAEFAKTLPRARAREAASGL
FT                   AALIDGLWLRGALAGEPLDTKAALKLANDYIDQLLAPRV"
FT   gene            529890..531359
FT                   /gene="betB"
FT                   /locus_tag="BURPS1710b_A0376"
FT   CDS_pept        529890..531359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="BURPS1710b_A0376"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01804"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51910"
FT                   /db_xref="GOA:Q3JLL8"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLL8"
FT                   /protein_id="ABA51910.1"
FT                   /translation="MSVYGLQRLYIAGAHADATSGKTFDTFDPATGELLARVQQASADD
FT                   VDRAVASAREGQREWAAMTAMQRSRILRRAVELLRERNDALAELEMRDTGKPIAETRAV
FT                   DIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWKS
FT                   APALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIA
FT                   KVSFTGGVETGKKVMSLAGASSLKEVTMELGGKSPLIVFDDADLDRAADIAVTANFFSA
FT                   GQVCTNGTRVFVQQAVKDAFVERVLARVARIRVGKPSDSDTNFGPLASAAQLDKVLGYI
FT                   DSGKAEGAKLLAGGARLVNDHFASGQYVAPTVFGDCRDDMRIVREEIFGPVMSILSFET
FT                   EDEAIARANATDYGLAAGVVTENLSRAHRAIHRLEAGICWINTWGESPAEMPVGGYKQS
FT                   GVGRENGITTLEHYTRIKSVQVELGRYQPVF"
FT   gene            531379..533076
FT                   /gene="betA"
FT                   /locus_tag="BURPS1710b_A0377"
FT   CDS_pept        531379..533076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="BURPS1710b_A0377"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199; match to protein
FT                   family HMM TIGR01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51751"
FT                   /db_xref="GOA:Q3JLL7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLL7"
FT                   /protein_id="ABA51751.1"
FT                   /translation="MTTREFDYIICGAGSAGNVLATRLTEDPGVTVLLLEAGGPDYRFD
FT                   FRTQMPAALAYPLQGRRYNWAYETDPEPHMNHRRMECGRGKGLGGSSLINGMCYIRGNA
FT                   LDYDNWATHKGLEDWAYLDCLPYFRKAETRDVGPNDYHGGDGPVSVTTSKPGVNPLFEA
FT                   MVEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPRGRRASTARGYLDQARARPNLEIVTH
FT                   ALADRILFSGKRATGVTFLHGSARVTAHARREVLVCSGAIASPQLLQRSGVGPGEWLRE
FT                   LDIPVVLDLPGVGRNLQDHLEMYIQFECKEPVSLYPALKWWNQPKIGLEWMLNGTGLGA
FT                   SNHFEAGGFIRTRDDDPWPNIQYHFLPVAINYNGSNAIEMHGFQAHVGSMRSPSRGRVK
FT                   LKSRDPHAHPSILFNYMAEALDWREFRDAIRATREIMRQPALDRFRGRELNPGADLKSD
FT                   NELDTFVRARAETAFHPSCSCKMGYDDMAVVDNEGRVHGIDGLRVVDASIMPIITTGNL
FT                   NAPTIMIAEKIADRIRKHKPLERSNAQYYVANGAPARGGKPARAPAVV"
FT   gene            534336..537533
FT                   /locus_tag="BURPS1710b_A0378"
FT   CDS_pept        534336..537533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05853"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53174"
FT                   /db_xref="GOA:Q3JLL6"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL6"
FT                   /protein_id="ABA53174.1"
FT                   /translation="MREYGYDAPIDLTDYDGAQASASVQDALRNTGWTPCGTVWHRTQT
FT                   SPSLAQPPLITRTTLERLSSVDLVRQIVLQLTTFGWTATEDGSLTWTHERIHSYLSPDF
FT                   VERMRADKAAVLESLFDNGWRVCGAGYWQPGKARSPYLPITADGIVDASREALREGAAV
FT                   VHLHTRATDDQATLAIPGLNTPIGIGSQRNHIVLDDYDRIVPTMLDLEPSAILNLSTSA
FT                   RGDRRASQSPLRRAHLKRYGHAQLAPDVASFSPGPVVFQAGGGYDNPNAFLADQLAHFA
FT                   EVGVRPEIEVFNHTIVENSVTLYQSPLVKAGVPVLFMLVAAVDQYHRDPVSGDTSDDSL
FT                   IDVPTRKAIAKLLQAGTDDAHEKAVELAATQLRPTVDKLRDNFPSCKISLLLPGPFQAL
FT                   LVDVAIALDLDGIRVGLEDALNVFDARVPGGVRKACGTGDQVRWLRLELERRGIGIVDA
FT                   EALRDELGMSRPDVALFRQAEAALAHYPADERLVSADTILDALRPIVDTYRKVEDRLAT
FT                   HLASAEALPADPAALAEHVLTAARSFGVTIRSFVEELDRYEDHEYLVARYIQVPQALNF
FT                   ARELLVPRGYSIDAYDRALEDYARPGKTVTREHASYSVRVDQFKPLPLRCLEYLVGIPC
FT                   RYNGDYSNVVNLGLRQSPRYSATMALLYHALRELTLELRERSNASRKTCGPVWTVLETS
FT                   ANASEPPVRRDIAPDALTAAIDGVDWVVLPSTPTTNYPLGLKLANGMAQLFHGFVAQIA
FT                   ADPTLRPSRQTHRDTPLRLLAITHSGRRDDGETVIEASMLHNRFALNADPSGIYFSEES
FT                   QLIYERLILPRLVDKPAKLAYNERQLVRRDTAGFPLYQDGSRARRIKAEQIERLPFLKC
FT                   FAHSSGIATAQQLDVQACRDGERLGLTADELRAFFDRALLVSFGSAADIHLDWLGTSVV
FT                   DVTAFNDVRSLAGTTSRHYLIQPGEHADVLQHCLVHTQPADYRYDHATPVWQEGRQGKV
FT                   VARLTGVFLLDDHARLDDGHSIRRYLAASPLWLRQWIARFHDAPADAGAHAILRELQAS
FT                   MTDYRSSANQTTRRALA"
FT   gene            537727..539163
FT                   /locus_tag="BURPS1710b_A0379"
FT   CDS_pept        537727..539163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0379"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53791"
FT                   /db_xref="GOA:Q3JLL5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL5"
FT                   /protein_id="ABA53791.1"
FT                   /translation="MPAAPAVPSRAARASAAARLERLPFSGYHKLIFVIIAIAFFFDSV
FT                   DLGTMTFVLGSIKREFGLSTATAGLVASASFFGMVLGAAVAGLLADRFGRRPVFQWSMV
FT                   LWGAASYLCSTAQSVDALIVYRVLLGIGMGMEFPVAQTLLSEFVPAAKRGRLIALMDGF
FT                   WPLGFITAGVVSYFVLPLFGWRTVFALLALPAVFVLVVRRLVPESPRWLEHRGRLAEAG
FT                   RVLAHVEAKVMKSARVASLPAPSRLAEPACAQGRGAFGEIWSPAYRRRTTMVWLLWFFA
FT                   LLGFYGLTSWLGALLQQAGFAVTQSVFYTVLISLGGIPGFLCAAWLVERWGRKPTCIAS
FT                   LVGGGAMAYVYGQSALFGGSVTLLVGTGLAMQFFLFGMWAVLYTYTPELYGTGARATGS
FT                   GFASAIGRVGSLIGPYAVGIVLPVFGQGGVFTLGALSFVVAALAVGVLGIETQGLALEA
FT                   LASTHAADDDARDPAGAAAN"
FT   gene            complement(539244..540635)
FT                   /locus_tag="BURPS1710b_A0380"
FT   CDS_pept        complement(539244..540635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0380"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF07730; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51734"
FT                   /db_xref="GOA:Q3JLL4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL4"
FT                   /protein_id="ABA51734.1"
FT                   /translation="MTEFAPHVVNAELLSAALECTKRAHFDVVLLDLGLPDAHGLDTFR
FT                   QFHRQVPDVPVLVLTGLDDLSVGLQAIQEGAQDYLLKKRVETPLLSRAIRYAMERHRVA
FT                   AALAASEERFQLAVSGASAGLWDWNPKTGAMYLSPHFKKIMGYEDHELPDEIPGHRESI
FT                   HPDDLKRVLDALKAHLEHRDTYDVEYRVRTRSGDYRWIQSRGQALWNSAGEPYRMVGWI
FT                   MDVTDRKRDEDALRVSREELRRLSAHIQSIREEEKTRIARELHDDLGQQLTALKMAVTL
FT                   VDNELKDAGWASRTSRLPNVYALIGQLLDSVRRIAADLRPVMLDDLGLMAAIEWLTHEF
FT                   VERYRIPVTSRIEADDIAFTRGSATEVFRIVQEALTNVARHSEATEVTLDIIRDEPNCI
FT                   VRIADNGCGTARDTRPNRHSLGLLGMRERAARLGGEIRIDTAPGRGFALTATLPLAVIE
FT                   AADSA"
FT   gene            complement(540719..541171)
FT                   /gene="rre-1"
FT                   /locus_tag="BURPS1710b_A0381"
FT   CDS_pept        complement(540719..541171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rre-1"
FT                   /locus_tag="BURPS1710b_A0381"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52312"
FT                   /db_xref="GOA:Q3JLL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL3"
FT                   /protein_id="ABA52312.1"
FT                   /translation="MIADERGNFVEILLVEDSPTDVMMTKEALEYYKVLNPLNVVEDGV
FT                   AAMAYLRREGPYAGARRPGLIILDLNLPRKSGREVLQELKLDPELSTIPVVILTTSKSE
FT                   EDVARSYGLHANCYITKPVDFAKFTDVVHSINEFWLSVVTLPPAKS"
FT   gene            complement(541175..543346)
FT                   /locus_tag="BURPS1710b_A0382"
FT   CDS_pept        complement(541175..543346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0382"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM PF05227;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53527"
FT                   /db_xref="GOA:Q3JLL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL2"
FT                   /protein_id="ABA53527.1"
FT                   /translation="MASGIGRFGKRASRLIDFGLWAAAALLLLTAGVGALGTARLSDNE
FT                   ADIHRASEVISGLERLLALARDMETSQRGYILTGKTDYLQPYKAALPEIRKQFDALATL
FT                   VQGDAVQQQRLATLRMLLEKKQHELAATIELRKTEGFDAAQAIVSSDAGKIFMDRARVM
FT                   VNEMEATVQQQLRTLRDRARATRDIAIGVGLASGLLTLAVCVSFGYVMRRLLLVEAAAA
FT                   HDLFEQRELLHVTLASIGDGVIATDVGGRITFFNRVAEEMTALCADAVVGQPIEQVLTF
FT                   RHAATQRVIDNPARVAVERRRTASLPAHTRFVGRSGGELPVDGNAAPTFDANGKLVGAV
FT                   LVVRDVSERERAEERFRLAVEAAPTAMIMVGRDGRIVLVNSQAEKLFGYARGDMIGHGI
FT                   DMLVPERFRAGHWAHRDAFFGNPDARPMGEGRDLFGLRRDGSEFPVEIGLNPITTSEGA
FT                   FVLCSIADITARKRAELELRRRSEELARSNQDLEQFAYVASHDLQEPLRAVAGPLQLLQ
FT                   RRYQGQLDARADEFIGHAVDGATRMQSLIDDLLSYSRVGRLEDARRPVDCEHVLDEALR
FT                   NLSAAIRESGAQVTHDPLPTVHGIEAQLVLLFQNLIGNAIKFRGKDRVARIHLEAHTRD
FT                   DAWLLRVRDNGIGIDPQYFERIFLIFQRLHTRREYPGTGLGLALCKRIVEHHGGRIFVE
FT                   SEPGQGTTFSFTLSRPGADETRWPRDPRE"
FT   gene            complement(543935..544420)
FT                   /locus_tag="BURPS1710b_A0383"
FT   CDS_pept        complement(543935..544420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0383"
FT                   /product="OsmC-like protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51510"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL1"
FT                   /protein_id="ABA51510.1"
FT                   /translation="MSTYTAEVAWQKQESETFADNRYSRKHEWRFDGGVRVPASSSPHV
FT                   VRVPFSDPTAVDPEEAFVAALSSCHMLWFLSLAAQKQFVVTGYRDVAEGTMAKNAQGKA
FT                   AMTRVVLRPHVTFGGERAPTRDDVDALHHAAHDACYLANSVRTDIDIEGSWAHAPAR"
FT   gene            complement(544459..545442)
FT                   /locus_tag="BURPS1710b_A0384"
FT   CDS_pept        complement(544459..545442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0384"
FT                   /product="glyoxylate reductase"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52067"
FT                   /db_xref="GOA:Q3JLL0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLL0"
FT                   /protein_id="ABA52067.1"
FT                   /translation="MRAIVTLASTLLPPTFAMKPRLLVLIPLRDHAHAHIADVFDILYA
FT                   LTPDQRRRAIAERGAAVQAVLTNGTTGLFAEEIACLPALEFVAALGAGYENIALDDARS
FT                   RGITVVNGAGTNDDCVADHAFALLLAAVRAVPKLDAACRAGVWRDALPMRPNMSGKKLG
FT                   IVGLGNIGQKIARRAAGFDLEIGYHNRRPREGAAYRYFAGLDALAHWADFLVVATPGGA
FT                   ATHHLIDARILDALGERGFLVNVSRGSVVDTAALADALREGRVAGAGLDVYEGEPQPPR
FT                   ALAALDSVVLTPHVGGWSPEALERSVRQFLENAARHFAGRPVLTPI"
FT   gene            complement(546048..546266)
FT                   /locus_tag="BURPS1710b_A0385"
FT   CDS_pept        complement(546048..546266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0385"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52649"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK9"
FT                   /protein_id="ABA52649.1"
FT                   /translation="MQRPVVPTGALAGACAKLLIEKHRPAASAETMAIVFISTPDYSGW
FT                   ARAGGASARARVTTRAALTQSLRQYRH"
FT   gene            546490..546624
FT                   /locus_tag="BURPS1710b_A0386"
FT   CDS_pept        546490..546624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0386"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51323"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK8"
FT                   /protein_id="ABA51323.1"
FT                   /translation="MNTDTKVYHCATDKYYGKTKHGEYMSEAAAKAKGFRASHGKTCS"
FT   gene            546827..547030
FT                   /locus_tag="BURPS1710b_A0387"
FT   CDS_pept        546827..547030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51885"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK7"
FT                   /protein_id="ABA51885.1"
FT                   /translation="MSAAHGPRYGSAAGTAGQPASTPRRVAWRSIGVGRCRMLRRDAPR
FT                   CHAAQCGDQPRVSIQFRAQQAE"
FT   gene            complement(547401..547604)
FT                   /gene="cspD"
FT                   /locus_tag="BURPS1710b_A0388"
FT   CDS_pept        complement(547401..547604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="BURPS1710b_A0388"
FT                   /product="cold shock transcription regulator protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52426"
FT                   /db_xref="GOA:Q3JLK6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK6"
FT                   /protein_id="ABA52426.1"
FT                   /translation="MDTGTVKWFNETKGFGFITPDSGGDDLFAHFSEIRSEGYKTLAEN
FT                   QKVSFETKRGPKGLQAANIKPL"
FT   gene            548256..548468
FT                   /gene="rpsU"
FT                   /locus_tag="BURPS1710b_A0389"
FT   CDS_pept        548256..548468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BURPS1710b_A0389"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52848"
FT                   /db_xref="GOA:Q3JLK5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLK5"
FT                   /protein_id="ABA52848.1"
FT                   /translation="MTTIVLNPNEPVEVALRRFRRSIERTGLIKELRARTSYEKPTTER
FT                   KRKKAAAVARLRKQVRRSMPPKKKY"
FT   gene            complement(548366..548605)
FT                   /locus_tag="BURPS1710b_A0390"
FT   CDS_pept        complement(548366..548605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK4"
FT                   /protein_id="ABA51692.1"
FT                   /translation="MTRARHDERCVRRAMHRAAAASSVRNECIIRGPACAPLTRMRSIL
FT                   AQYFFFGGIDRRTCLRSRATAAAFFRLRSVVGFS"
FT   gene            complement(549103..549564)
FT                   /locus_tag="BURPS1710b_A0391"
FT   CDS_pept        complement(549103..549564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0391"
FT                   /product="dihydroneopterin aldolase, putative"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51456"
FT                   /db_xref="GOA:Q3JLK3"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK3"
FT                   /protein_id="ABA51456.1"
FT                   /translation="MKPVEEPFAALDPARSRGRGWSVFVDALKVPARIGIHAHEHAAPQ
FT                   PVVIDARLAYRREPSEASGDGWIDYDAYCARIASFLARKPHTRLLETLALEIAVLSFDE
FT                   WPALDALTLALHKPKIRPGTKRVGVELDWTRGDYRAWRAASEPNGASSG"
FT   gene            complement(549564..550199)
FT                   /gene="soxG"
FT                   /locus_tag="BURPS1710b_A0392"
FT   CDS_pept        complement(549564..550199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxG"
FT                   /locus_tag="BURPS1710b_A0392"
FT                   /product="sarcosine oxidase gamma subunit"
FT                   /EC_number="1.5.3.1"
FT                   /note="identified by match to protein family HMM PF04268"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53325"
FT                   /db_xref="GOA:Q3JLK2"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK2"
FT                   /protein_id="ABA53325.1"
FT                   /translation="MWNETRNEASVAAHAQGGARLESPLVGAGDALKAYDARGSKQFRF
FT                   RERPFLDLVNVRGEPNDPAFVRAFEQVVGCRPPVKPNTVARGADHDVLWLGPDEWLVRS
FT                   NGAVAAGALEAKLAQAVQGLHAAAVDVGSGYTVVEVSGARARDVLARGCPLDLHPRVFG
FT                   VGQCAQSHYFKASITLVPTGDDSYDIVVRRSFADYFCRIMLDAATPLA"
FT   gene            complement(550189..553197)
FT                   /gene="soxA"
FT                   /locus_tag="BURPS1710b_A0393"
FT   CDS_pept        complement(550189..553197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA"
FT                   /locus_tag="BURPS1710b_A0393"
FT                   /product="putative sarcosine oxidase alpha subunit"
FT                   /EC_number="1.5.3.1"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01372"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52546"
FT                   /db_xref="GOA:Q3JLK1"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK1"
FT                   /protein_id="ABA52546.1"
FT                   /translation="MSQKDRLGAGGRINRAQPLTFTFNGRTYQGFQGDTLASALLANGV
FT                   HFVARSFKYHRPRGIVTAGVDEPNAVVQLETGAYTVPNARATEVELYQGLVATSVNAKP
FT                   SLEHDRMAVMQKLARFLPAGFYYKTFMWPRNLWPKYEEKIREAAGLGKAPDTLDADRYD
FT                   KCYAHCDVLVVGGGPTGLAAAHAAAVNGARVILVDDQRELGGSLLACRAEIDGKPALQW
FT                   VEKIEAELAKLPDMSILTRSTAFGYQDHNLVTVVQRLTDHLPVSMRKGTREMIWKVRAK
FT                   RVILATGAHERPLVFGNNDLPGVMTASAVSAYIHRYGVLPGRVAVVATNNDRGYQCALD
FT                   LKACGAKVTVVDARASTRGALPAVAKRHGITVMSGAAVSAAAGKLRVASVDVVSYANGR
FT                   SGGKIATLPCDLVAMSGGFSPVLHLFAQSGGKAHWNDDKACFVPGKPVQAEASVGAAAG
FT                   EFELARALRLALDAGVAAAKSAGFAAERPPVPKLAEAVEDALLPLWLASGAEAAVRGPK
FT                   QFVDFQNDVGAADILLAAREGFESVEHVKRYTAMGFGTDQGKLGNINGMAILAQALGKT
FT                   IPETGTTTFRPNYTPVSFGAFAGRELGDFLDPIRKTCVHEWHVEHGAMFEDVGNWKRPW
FT                   YFPRNGEDLHAAVKRECLAVRNGVGMLDASTLGKIDIQGPDAVKLLNWVYTNPWNKLEV
FT                   GKCRYGLMLDENGMVFDDGVTVRLGDQHFMMTTTTGGAARVLTWLERWLQTEWPDMKVR
FT                   LSSVTDHWATFAVVGPKSRRVVQKVCKDIDFANDAFPFMSYRDGTVAGVKSRVMRISFS
FT                   GELAYEVNVPANAGRAVWEALMDAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSIT
FT                   PFDLGMGGLVAKSKDFLGRRSLTRADTAKSGRKQFVGLLTDDAQSVLPEGGQIVELDAA
FT                   ARADGTTPMLGHVTSSYYSPILNRSIALAVVKGGLSRMGERVAVSLANGRRVAATISSP
FT                   VFYDTEGVRQHVE"
FT   gene            complement(553194..553487)
FT                   /gene="soxD"
FT                   /locus_tag="BURPS1710b_A0394"
FT   CDS_pept        complement(553194..553487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxD"
FT                   /locus_tag="BURPS1710b_A0394"
FT                   /product="sarcosine oxidase, delta chain"
FT                   /EC_number="1.5.3.1"
FT                   /note="identified by match to protein family HMM PF04267"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52521"
FT                   /db_xref="GOA:Q3JLK0"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLK0"
FT                   /protein_id="ABA52521.1"
FT                   /translation="MLLIECPWCGPRAESEFSCGGEADIARPLDTDKLSDREWGDYVFM
FT                   RKNPRGKHREQWLHTQGCRRWFVAQRDTVTYEFQGYETFGTPAAHAAKDTSK"
FT   gene            complement(553763..555007)
FT                   /locus_tag="BURPS1710b_A0395"
FT   CDS_pept        complement(553763..555007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0395"
FT                   /product="sarcosine oxidase, beta subunit"
FT                   /EC_number="1.5.3.1"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM TIGR01373"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52353"
FT                   /db_xref="GOA:Q3JLJ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ9"
FT                   /protein_id="ABA52353.1"
FT                   /translation="MSRYSIFSLFRNGLSYHENWEKQWKSPEPKREYDVVIVGGGGHGL
FT                   ATAYYLAKEHGVTNVAILEKGWIGGGNTARNTTIVRSNYLWDESAGLYEKAMKLWEGLA
FT                   QDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQIKEIEPTINLN
FT                   SRYPVLGASIQRRGGVARHDAVAWGFARGADRAGVDIIQNCQVTGIRREGGAVVGVDTV
FT                   KGFIKAKKVAVVAAGNTTTLADMAGVRLPLESHPLQALVSEPIKPVVNTVVMSNAVHAY
FT                   ISQSDKGDLVIGAGIDQYTGFGQRGSFQIIEGTLEAIVEMFPVFSRVRMNRQWGGIVDV
FT                   SPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIARDEPHALNAPFALDRFY
FT                   TGHLIDEHGAAAVAH"
FT   gene            complement(555024..556661)
FT                   /gene="sdaA"
FT                   /locus_tag="BURPS1710b_A0396"
FT   CDS_pept        complement(555024..556661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="BURPS1710b_A0396"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00720"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51620"
FT                   /db_xref="GOA:Q3JLJ8"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ8"
FT                   /protein_id="ABA51620.1"
FT                   /translation="MYLRSAGVRRPPAAQSVLRASPIGPRGTCVFSPRTIAETHRMAVC
FT                   RGGWRRRPTPMPFLFYRRILRFDVLTPNVNQASSRKGSQMNVSVFDLFKIGIGPSSSHT
FT                   VGPMIAACRFASHVEDANLLGFVRRVRAELYGSLGATGKGHGTDKAVLLGLEGHLPDSV
FT                   DPDLIEPRLKAIRAEKSLALLGKRGIRFDEKDDIGFYRKLMSGTSVVHPNGMRFQAFDE
FT                   HGQLLVEKEYYSVGGGFVVNRDGDRVNGVRAAADVPYPFRTGDDLMRACRASGLSIAEL
FT                   TFRNECALRPADEVRAGLVAIWRTMAACVERGCKADGELPGPMRVKRRAAELYTRLRDR
FT                   SEESLRDPLSMLDWVNLYAMAVNEENAAGGRVVTAPTNGAAGVIPAVLHYYVKFVPGST
FT                   EQGIVDFLLTAAAIGIIYKETASISGAEVGCQGEVGVACSMAAAALAAVMGGTPGQVEN
FT                   AAEIGMEHNLGMTCDPVGGLVQIPCIERNAMGAIKALNASRLALKGDGQHYVSLDSVIK
FT                   TMRETGADMKTKYKETSRGGLAVNVIEC"
FT   gene            556697..557887
FT                   /locus_tag="BURPS1710b_A0397"
FT   CDS_pept        556697..557887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0397"
FT                   /product="putative AraC/XylS family transcription factor"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53456"
FT                   /db_xref="GOA:Q3JLJ7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ7"
FT                   /protein_id="ABA53456.1"
FT                   /translation="MTADVPASPLAADSAQPRLRFGIVLLPNFTLTAFSGFVDMLRLSA
FT                   DDGDHSKPVRCSWTVIGDTLAPVRASCGIQLTPWQTFDAADAFDYVVVVGGLLHSGPQA
FT                   GPQTLEFIRRAAAAGANLVGICTGAFALMRAGVLDGHRVCVSWFHYWDFVERFPGADPD
FT                   LLIADRLFVIDRRRITCSGGRASIDVAAAILLRHFDHATVQKALRILLVGEMQKGNAPQ
FT                   PHPPGLEPATHPKVKRAILLMEQHVGRALPLDELACKLDLSTRQLERLFKAQTGKSPQA
FT                   FAKQVRLRTAAWLLTSSDRTVADIASSCGFADASHLGREFRKQFGAPPAAYREKGGAAG
FT                   DADADAGAGAGADANAGAMGGARPRPDADGGPEADFDANTRKHPDDDPTGGGRDAR"
FT   gene            complement(558260..558598)
FT                   /locus_tag="BURPS1710b_A0398"
FT   CDS_pept        complement(558260..558598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53499"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ6"
FT                   /protein_id="ABA53499.1"
FT                   /translation="MPYRLTVMAQSRHKVRSTVKFRHHSSEFAMKAEAVLPDHVNRVEI
FT                   DGVSIRKGTVAAFLASARVWTDAQAAAHAREEAERDLLDTLPSLRVLGLFDVLEIRDAR
FT                   LRAFVDAH"
FT   gene            complement(558704..559597)
FT                   /locus_tag="BURPS1710b_A0399"
FT   CDS_pept        complement(558704..559597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0399"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /note="identified by match to protein family HMM PF04337"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51202"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JLJ5"
FT                   /protein_id="ABA51202.1"
FT                   /translation="MPASALRRGACRAGRRRACRRRAVPGGDYPKRRARLSLNPFAVIV
FT                   RRVPDPVLTQAHPAATSPMNSTPDTFQRPALRELTPLEARVLGVLIEKQHTVPDTYPLS
FT                   LNALTAGCNQKTARSPVMNVSEAEVLTAIDGLKRLSLASEGSSSRVPRFEHNMNRVLGI
FT                   PSQAAALLTMLLLRGPQTAAELRLNSARLHGFADISSVEAFLDELAARTPPLVVKLPRA
FT                   PGARESRWMHLMCGDVAPDEAPAHGAHEDAVPPSEFEALKAEQKALTAELAQLRALVEY
FT                   MANELGIDVGKLTRGV"
FT   gene            complement(559644..560372)
FT                   /gene="gst12"
FT                   /locus_tag="BURPS1710b_A0400"
FT   CDS_pept        complement(559644..560372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst12"
FT                   /locus_tag="BURPS1710b_A0400"
FT                   /product="possible glutathione S-transferase P subunit"
FT                   /EC_number="2.5.1.18"
FT                   /note="identified by match to protein family HMM PF00043"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52393"
FT                   /db_xref="GOA:Q3JLJ4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ4"
FT                   /protein_id="ABA52393.1"
FT                   /translation="MRYELYYWPDIQGRGEFVRLALEAAEAEYVDIARESSRKGMGVPA
FT                   MTRLLESDAMACLPFAPPFLKAGEQLIGQTANILLFLGARHGLAPRDDAGRLWAHQLQL
FT                   TVADFVVEIHDTHHPIAGGLYYEDQKAEAAMRAEDFIEHRLPKFLGYFSRVLAHNPHKH
FT                   GYMVGAHLSYVDLSMFQLIEGLRYAFPKAFARVAKQHAALIELGDRVAQHPPVARYLAS
FT                   ARRIPFNEQGIFRHYAELDR"
FT   gene            560541..562817
FT                   /locus_tag="BURPS1710b_A0401"
FT   CDS_pept        560541..562817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0401"
FT                   /product="hydrolase, NUDIX family domain protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52592"
FT                   /db_xref="GOA:Q3JLJ3"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ3"
FT                   /protein_id="ABA52592.1"
FT                   /translation="MRGQSVLVVRLPPLTVRRSPFAVRRSPFAVRRSSCAVRRYQPTAR
FT                   YPPCPSPVAFACRSLLPAHYPLPLRPFIPSHLLSPFDRVQSPASSPRPAARRSANAARL
FT                   PGRGGPARQPPVPDMMRTGRAHSAHSRIRARRAPSECRAITRANMEEFAMRCSPTAPAR
FT                   NRSCQARTRDVRPGRRLRVPRDRPMHVYAHVDTQSRRKLTRKEAQCMNRSHSMPAWPGG
FT                   GPRRQHARPARQAPRRRHAAATQRARLRRRQAACRRQRAMTSPACASPTARRPIRREHP
FT                   RGLQHRDANAHWHGRIEACFIGARLGSRMPPPRAPHRAAPASIGGRGTLLRLARGVVSV
FT                   TVTVVVRVPPRGLAARLAQRPRPQRELQIGVRKPLELVLRRILDADQPVARGFRRRDQL
FT                   VELQMQRDAVPILVALEQEHHQKRDDRRTGVDDELPRVGEMDERPAREPSDRDRDRDAE
FT                   RDGRAGPLRDARGEPLECLRDRVAARRSRRVAPLRDVPALLFVVRLAHDPLSMKAAKRS
FT                   SVAARSRVAGGGAPPAPHARTGSKRRAAAARRGTRMARQGGGDARPSTKRRRDNGRPST
FT                   LARPAFAAPPAKHAAAPIKERATIVCRRGARMPLVARTLSRGSPPGGIIRCGEAPLDAA
FT                   RRALEEQTRLAGLELMYFFHVDGHAKRPPVFVASVPPGMRACPSREVARGRRSSADALA
FT                   RVPVRACDNAHARHRRPARERGRRAARARRTARRVTCARSRRRRAPCRGTPSMTSTRRT
FT                   AAPAA"
FT   gene            complement(561507..562505)
FT                   /locus_tag="BURPS1710b_A0402"
FT   CDS_pept        complement(561507..562505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0402"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07300"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51231"
FT                   /db_xref="GOA:Q3JLJ2"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ2"
FT                   /protein_id="ABA51231.1"
FT                   /translation="MKKIHQFKPGEPRLLLQRATGGVERRFAAADDAARRRPARQRAGD
FT                   ERHAGAAAAHDRRSFLDGRGGVLGGRRGESRPSEGGRATIVAASFRGRACIPPPLASHS
FT                   RAAPRGGGTALATGSRMRGGRRAPAGDARAGGDGGPFRRFHGERIMRETNDKQQRGNVT
FT                   QRRDTPAAPGGNPVTQAFERFAARVTQWAGSPVAFGVAVAITIGWLACGPLVHFSDAWQ
FT                   LVINTGTTIITFLMVFLLQRNQNRDSVALHLKLDELVAATKSASNRLIGIEDASEDELK
FT                   RLAHAYLELALRARTLRETSGEPARRDADDDSDGDGDDAASEAQERPTPAD"
FT   gene            complement(562726..563736)
FT                   /gene="cydB"
FT                   /locus_tag="BURPS1710b_A0403"
FT   CDS_pept        complement(562726..563736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="BURPS1710b_A0403"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51964"
FT                   /db_xref="GOA:Q3JLJ1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ1"
FT                   /protein_id="ABA51964.1"
FT                   /translation="MLLDLVPLWAGVLALSVLMYVLLDGFDLGVGMLFFFHRDEAERDR
FT                   MIASVSPVWDFNETWLVLGGTLLLAAFPGAFSVVVPAVYFPVLAMLLGLLFRGVAFEFR
FT                   GVAGARKTVWSRAFAIGSLVATAAQGVVLGMFVQGFEVAHGRFVGTSWDWVAPFPLVTG
FT                   AGLVAGYLLLGATWLVLKTDGPLQRAARVAAARALVCVIAFIAVVSVWTPLADARIAAR
FT                   WFAWPNLLFFSPVPVLTAALAWLAARSLRRGGEALPFVASIGLFFLAFSGLTISLWPHV
FT                   APPSITLWSAASASASQEFLMIGTAFMLPVLLFYVCWSYWVFRGKVRGDVGYEHM"
FT   gene            complement(563726..565444)
FT                   /gene="cioA"
FT                   /locus_tag="BURPS1710b_A0405"
FT   CDS_pept        complement(563726..565444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioA"
FT                   /locus_tag="BURPS1710b_A0405"
FT                   /product="ubiquinol oxidase subunit I, cyanide insensitive"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53413"
FT                   /db_xref="GOA:Q3JLJ0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLJ0"
FT                   /protein_id="ABA53413.1"
FT                   /translation="MTPERASRGCGTVCAPIMEKRHVRLQFPLAPPASCTPRGRRVRGA
FT                   RRARGHALGRARVRATGAAARVGRGDRNGARQPDAGIRARRSQDDGRDARRAVHGRRRS
FT                   RFRRAHGAASSGRDRHGAGGVEERQGSGAQAARAPDHRRAARRDRIHGALAEAARRRPL
FT                   IGAAARRPSAAMRCDSIRLEAGAGAARAAPAGPCGNGSLARMRRPCRHARARRRRWASR
FT                   LLRRPPCASSAHIVIQEAPHDGNRRLAPVAPSVRVGHRAAHPAARAHRGARVLRRDARG
FT                   ARVGDGPRRLPASFRVLAADLRGVVRDGRGVGDRDAVPVRHELEPLRRGDVERDRRLHG
FT                   VRGADRVLPRIGVPRRAAVRPPARAAMGARAGGGARRARHAAVVVLDSRREQLDADAER
FT                   LPVRRRALLSGEHRRGAAEPVVSVPARAYGRRVLTLWRGGRLYVRRGWLATCRAATPIG
FT                   FVAVLAGWTTTEAGRQPWTVYGLMRTADSVTPSLTTTDVALSLAAYVLCYLAMFGAGFV
FT                   LLLRLLRLGPPAASAASSACAAEPDAAAVPGRRSARPLSAVSGGAAGTTEQNDAA"
FT   gene            complement(564145..564720)
FT                   /gene="cioA"
FT                   /locus_tag="BURPS1710b_A0404"
FT   CDS_pept        complement(564145..564720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioA"
FT                   /locus_tag="BURPS1710b_A0404"
FT                   /product="ubiquinol oxidase subunit I, cyanide insensitive"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53623"
FT                   /db_xref="GOA:Q3JLI9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI9"
FT                   /protein_id="ABA53623.1"
FT                   /translation="MMEIDALLLSRLQFAWVIALHILLPALTVGLACYVATLEALAWAT
FT                   GRDVYRHLSAFWLRIFAVSFGMGVVSGIVMPFQFGTNWSRFVAATSNVIGGFMAYEVLT
FT                   AFFLESAFLGVLLFGRRRVPQWAHALAAALVALGTLLSSFWILAVNSWMQTPSGYRFVD
FT                   GRFYPESIVAVLLSPSFPYRLAHTVVAC"
FT   gene            complement(564955..565380)
FT                   /locus_tag="BURPS1710b_A0406"
FT   CDS_pept        complement(564955..565380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0406"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03713"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51288"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI8"
FT                   /protein_id="ABA51288.1"
FT                   /translation="MSDCSFHSRRPRRARRAAGVCAALAVLAATLWAAPACAQPEPPPA
FT                   SGAVTETAPDSPTRAFERADRKMMDAMRAAPYTGDVDRDFVAHMAPHHQGAIDMAQVEL
FT                   RSGKDPALKQLARRIIAAQRDEIAFMERWQKQHGAGR"
FT   gene            565392..566297
FT                   /gene="mgtC"
FT                   /locus_tag="BURPS1710b_A0407"
FT   CDS_pept        565392..566297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="BURPS1710b_A0407"
FT                   /product="MgtC family membrane protein"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52215"
FT                   /db_xref="GOA:Q3JLI7"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI7"
FT                   /protein_id="ABA52215.1"
FT                   /translation="MIGAQTVPHPRDARSGVTPARRPPRPCAIRCAAHRACPGRRAQPA
FT                   RPPPLAAGHGACWSPEKNDEWWRTIMINHVELLGRLLLAALLGSVIGFERERMNWAAGL
FT                   RTHMLVSVGSALVMLVSAFGFADVQGRAGVVLDPSRVAAQVVSGIGFLGAGSILLRGEV
FT                   IRGLTTAASLWAVAGIGLATGGGMYVGAIGATAILLMILAGLKPLERRFIAPRQQRRVR
FT                   LVVERGGLTLDQLHDTLGHGGIRVKQFIVQQSDDDPDVDDVSIALSRASVPEFAAICRK
FT                   LENLAGVLECRPDIQIRSPA"
FT   gene            566436..569897
FT                   /locus_tag="BURPS1710b_A0408"
FT   CDS_pept        566436..569897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0408"
FT                   /product="putative Endonuclease/Exonuclease/phosphatase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52358"
FT                   /db_xref="GOA:Q3JLI6"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI6"
FT                   /protein_id="ABA52358.1"
FT                   /translation="MTASGSRSPRRSSRTGSTQPPRAATRVGSPRGSANGWPPTRSGRQ
FT                   CKRCARAATRCCNGSAAIDAPARPRPRPRAAPPVSAQPAFPPHDDALSFAARRAGKPRR
FT                   RSARAWRTARTRPQLRRAAARGALRDAHRRRRVFLDAARGAAARAPHGLHRRLGHRQPA
FT                   AARAGRRARRLAGAARGVPARARERTPTAADLCAGMGFLDDLRARARMAARVPHRLALA
FT                   ARHRVPTRRHAPARRVASPEVRRDRRSRRVRRRLRSDALALGHAAACARRAAPRRSERR
FT                   ALRAVSRRAGNVRRRRGGRDRRARARALGAHLRQARRDPRAPAARGGRRSLAAQRAGGR
FT                   ARRDPRDRAHDAAPSRRRRSRPHPCADRGCDRGRAPRPVHREPVLHRGRRARGAHRAAR
FT                   GRRSARRRRGRAARAERLAAGSDDGRAARAAASCARRRRPPRPLPAAVSARRRPRRAVR
FT                   ERAQQADVRRRRLSRDRQREPEQPLDGARHRMQHRARRQRRAARARGDRAHARAPARRA
FT                   SGRIGRCGRRRARLHGPPESRDRRAARRASAPHAAAVHAERIRGPRCARAGERVARSGA
FT                   PHRRGPPHERIRAARAESLADRALSRARRVRAVRRGARRRVAVHAARPAPERRIARAGR
FT                   RARRRAAGRARRARRRLRGRRAARGARHAADHRDGPRVRRMAGHRLRGGRHAARGRRDI
FT                   RHRPLARARRGAAARGPPREPAERAHRPPRHRRDGRAAAAADRAVYGRQSRRGRFVDRV
FT                   SRLPGRHGARHAAGHRADRHVRASVERGARSPHARRVRVARRDRAGVRRRVGAAVARAG
FT                   TPTVTPTMMPPDTPTPAGAPPNATTADDALRDIAPQTGARALGAAAARAQPRTRELRIA
FT                   TYNIHGGLGAWTASAAERIAVVLDELCADVIALQEVPLGGARGADVLAHLRACTGMHAA
FT                   EGPTIDTPARRYGNAVLSRFPIRAARMLDLSFGNREPRGALDADIECGFGVLRVVATHL
FT                   GLSATERSAQVARLLAAFDTRALPVILLGDINEWFVRGRALRALVTHFRRAPAPRTFPT
FT                   LCPLFSLDRIWVHPGEWLVDVAAHRSARARRASDHYPLVARIRAAPETDADIAQAPASA
FT                   SRTPPERPCEPTDSTEPASTTGAPARSPATTPRCASSPSRRASSSP"
FT   gene            complement(569684..570367)
FT                   /locus_tag="BURPS1710b_A0409"
FT   CDS_pept        complement(569684..570367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0409"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52706"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI5"
FT                   /protein_id="ABA52706.1"
FT                   /translation="MWRARFARCKLADTASAWVPAAPAANAARRGRASHPRYRPDIARV
FT                   ARRGRIAVLRDRLARVVRLDLAAAHLMGLLGRCVDRIAETRAHERARERDAQIGVVRAA
FT                   DGAHAREARGALDAAVVAAGDGQRIGAREHVARIGPRRRRREALVELAQRAARHGDDDA
FT                   RRDGDEAQRGVVAGERAGAPVVEAGSVESVGSHGRSGGVREADAGACAMSASVSGAARM
FT                   RATSG"
FT   gene            complement(570543..571277)
FT                   /locus_tag="BURPS1710b_A0410"
FT   CDS_pept        complement(570543..571277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0410"
FT                   /product="putative rotamase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53019"
FT                   /db_xref="GOA:Q3JLI4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI4"
FT                   /protein_id="ABA53019.1"
FT                   /translation="MKERLNVDAVRKLGQLSGRNNIGSLNADASESASGAAASDGQDDA
FT                   EKSRALDRALILAHAKSSGMQSRPDVDRALQVAHETTLIDAYIDDFFSAVSVDEDDIGA
FT                   AYARIKSKLGTTEYLLSILTVPGEADALRLRNQLIQGASFGELAMRFSTDASRDSGGDI
FT                   GWVAQGVLSDVARNEIDAIVKSGFSMPIRGSNGYHLLYVRDKRDIVAPSLDQIREQLIE
FT                   LARVDKFERHLCELRGAVRPVK"
FT   gene            complement(571438..572892)
FT                   /locus_tag="BURPS1710b_A0411"
FT   CDS_pept        complement(571438..572892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0411"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI3"
FT                   /protein_id="ABA53443.1"
FT                   /translation="MGNNEHQPTKLNRSEMFSSLRDLSKPGGDGREIKVQFKAKSAPEL
FT                   NADSTADVHLPSTRNTEHVPEGRLENTGSLQEGGSADRVEPEASNAPSRTSHGVEPGGE
FT                   GERVSRASANEGVGHAALSMLKNGMRNVGAVAARNLVSVLPQTAAREAVRAYLTPALAA
FT                   APAGVATAAGAVAAAAPIVQNFVGLVRDIQNGTSSRTRVISRTAMMVTTGGFLAASAAT
FT                   GTLAAAAPALVAANAIYTPLRDLVQYNVQLKDNNQQPANMKRVLGSAAAYGVNQGLVNE
FT                   AMDRVAGAARGRFEAETSVRSGVTTDGTPQVSTAALETHTNPSASLGVDVPSSGYVLAR
FT                   SAGFAAANFAGETLDELTLRGATALQQGNLSNLQISVGWRPQDERTWSAVADQAFTTNA
FT                   ARSTLFANAYMGAYAIPSPPGAASDAVVGSILGGLYTAFIKVHDTPQRALPDEERGIDE
FT                   LASTGRGRENAAVLTIEDETRSTSGV"
FT   gene            complement(575655..579485)
FT                   /locus_tag="BURPS1710b_A0413"
FT   CDS_pept        complement(575655..579485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51564"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI2"
FT                   /protein_id="ABA51564.1"
FT                   /translation="MLFLKEIMPVIIRSSGASIHQSDLSSRRSEADASDPAAAGPAREP
FT                   DRVAGAESRSFVQPAPLNKTADKVKGGTPAIPLSLQVLGLYQRDKVCAQPVRPDHASLP
FT                   ESTRAEGLPRLDGKLPKRIETAPFARALVQGNAGSGHNSRDVFLNVTGGVSGKAAPSNA
FT                   DHLTDVLLSDCRPGESLAGTPDDNAFMIGGHSEIIDVATRPDGLSRADKARQMAIVMFG
FT                   VTDPANDQIAFAERKLTALENAETRHLAMSLFTGEEGREALSGWIADFDPGGAARLQRM
FT                   HQLMYAAAVVLKQNGRAAARLLRNYCGMSTERPDLQLKRQSYSMQRVLVSARGTSLDIL
FT                   GIPPSITGREHHAEQKSVYRNALAIAQYLHEKLDAAYKPDSLEDMLAAAQIVSAEALGG
FT                   SGDRTEREYHFSRVVDNLGSIYQEERLSIDALACAANLISIDRDNGAKALGAVAMLSSS
FT                   EQADVMDALEQAGELVRLLPLGIRRDIATVADLDKVLNANAEGPGARASVSSVDPMGQA
FT                   SAQKAIGKLRAALAVAPDIGNIPIGAAARAAIPMQQKIAYFKWRNGLADERKARLVFER
FT                   LYKLNKYADRAIPRGKNLTGRLRRIGDDIAGAFGHRKNPVGMLEEGLLLGGFLREDVFN
FT                   EKIAPAFHSLIEKYRESGAGAGAGAGAGAGAGVAKARSEVVSRVFEKLKIDGFSSKIEI
FT                   KSDDLKKWVALAVAGGRNDAVKRSLEFESIRRDLNNGFSVDVLERWAAEAGLDDGNFRR
FT                   QLNDLRSVSNNGYGEIPELGDRASVFSAFSEIVARYRAGKSLKFSSGGVGGLALGDSQS
FT                   IGPLVSVSPTLGAGGGRVATVEIGGASGRGGLIAVTRANSQKLKVGASVFAGPQFIHVV
FT                   RAGGSANLELVSAEQTREKGAIVRFVPRAGSLGGGEAWRGWAQDCLSIIGNSADSADLL
FT                   ERLAEEYVNAGEIGIGMTEKEENVISSSAAVGAGVKASSSGGDFRGGAGVSASIGVKRE
FT                   WRRHKAVRELDNKMGNHKFDQSSSTSVTWNAGLNASESYQLNPTPDFSTSASASAQAFS
FT                   VGGTLFSAKEGASVAIRLRDGMVDSELAILERTRNRGRRGVELIARDYPLWVKAMGKTD
FT                   AEGEAALNRFFASELGRGVNRPLRPEVPETYVASYRMTKEAASALNHYRAQIDLEQMLG
FT                   TNKSRVSELRRRYAEVIENSASWRPSSIQHYVETSSAKSVGLHNVFGVEAKKSSSTSTV
FT                   QVLAHQAASEYVDPVALARHPVSVGSVQVVRDAPSDVGGRSTHGSAVKTGE"
FT   gene            complement(577457..577549)
FT                   /locus_tag="BURPS1710b_A0412"
FT   CDS_pept        complement(577457..577549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51355"
FT                   /db_xref="InterPro:IPR015042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI1"
FT                   /protein_id="ABA51355.1"
FT                   /translation="MKNIENPVQAQAQAQAQAQAQAWRRQDRRL"
FT   gene            579497..581431
FT                   /locus_tag="BURPS1710b_A0415"
FT   CDS_pept        579497..581431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0415"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53201"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLI0"
FT                   /protein_id="ABA53201.1"
FT                   /translation="MKIRINISSTPSRRSACVDTFISLRMYRSENAVDASGQLDPQRLD
FT                   ILAAQESAFGLQHSIQDEIRSIARARAHHPFPHKSEMFVQPLRFMIVGAHKARYPIAAQ
FT                   HLERISKHCADERRRSKMARSVEREVHQHVGPAVALIDDPRDNTTIPLEADRRIIVVAA
FT                   FSSPVGNEAHDFIATIQQHSAHCMLLRLASSCRQRNAELIECGIDVLCKCLPILRLFHG
FT                   FHDRQDDTCDAGNRGTHRKHRRCRSHSSRDGPHHALGNAGTGLRADHRSFGAGQCAFHA
FT                   FRNARHRAVGRFHAVCDARYRTFGSVDRACGRPAHLLHAALHRAVRRGFRAVRDALRSI
FT                   RRLPGSFVAQLAQSLGDLLRFVQCVFRLIDDVPGGNPVRVVRNRHIAGRAGISLKAARL
FT                   LERRVEVSHLRRHHLMQIGVRLGIVCQHHDVLLQRGHRCSDIAQLVGAACLHVDQRLHQ
FT                   LDHHGGFLLRGIVLRIGEDILIELADVGAGRDVLEARFLQERMLGRIAGRRVLRNEVVQ
FT                   VVGRKYLVDLLGRLVVAGAIEVIERAACRPRFRGAFQRRTEASVILQIGNLLLRREAAA
FT                   VVLAPGGIAVVLSARLMPRRLADDRFIGFQQGSRTNRIERIPIGVRMIVQIGLHVFIRF
FT                   REIRLDLFQ"
FT   gene            complement(579566..580051)
FT                   /locus_tag="BURPS1710b_A0414"
FT   CDS_pept        complement(579566..580051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0414"
FT                   /product="gp68"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52077"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH9"
FT                   /protein_id="ABA52077.1"
FT                   /translation="MRRVLLDRSDEVMRFVADRTGESRYDDYATIGLERDGRIVAGVVY
FT                   QGHGGPNVLMHFALDGSRHLATPAFVCAVFTYPFKVLRCNRVTGLVRTDNHEAQRLDEH
FT                   LGFVREGVMRAGASDGTDFILYGMLKAECRFLSGKYVEALRVELAGSIDGVLASVHS"
FT   gene            complement(580076..581734)
FT                   /locus_tag="BURPS1710b_A0416"
FT   CDS_pept        complement(580076..581734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53777"
FT                   /db_xref="GOA:Q3JLH8"
FT                   /db_xref="InterPro:IPR031613"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH8"
FT                   /protein_id="ABA53777.1"
FT                   /translation="MAQRQGSDIRAAQYAPLDDYTRMYDQADRDRWADLAALGQGVSLE
FT                   RPLAAMQILSGERQPSAAQTAAALQFVNDNPSLKTAMQNTGGLKPDGSVDPGKVADLLK
FT                   EVEANLAKADEDVKAYLNDHPDADRDALDTVRAAALLEAYEPIVGQSAGHQSSGKNHSY
FT                   STGGKNNGGGLTTKQQVADLQNNGGFSAALKSAAKAWSTSGAFDNLDRAGDDKATEKVD
FT                   QIFSANNLHHFITKDAPTSDAAEHAFLEKASLENITAGTDISKLNQDIFANPQDYSPQQ
FT                   KAAVMVKLMETLVDVQAGGADKLRDVTATVSALKQDIMMLANDPETNAYLHQMVPPEMR
FT                   DLNATFEQAGGLEGDTGAAGDMSVADNANRVSARNIVDQTKDALDEAEKVAKRLGKLGN
FT                   EGAGEATDATQSIADGAETAADGAVQGGVEEVGGAATSAVDGAEGAITGVADGVEAADG
FT                   AVTGVAEGVEGALAGAEGAVVGAEAGAGVAEGVMGAVAGGMAAAAPVLAVGAAIAGIAG
FT                   IVLAIVEAVKKAQNRKAFAENVNPTLNQFGIPLPT"
FT   gene            complement(582162..583547)
FT                   /locus_tag="BURPS1710b_A0417"
FT   CDS_pept        complement(582162..583547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0417"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH7"
FT                   /protein_id="ABA52875.1"
FT                   /translation="MSVGVVNRNCVVVELGGRPDGADARSQIAGLDQQIMGLLRQQLQK
FT                   RDGGTGGGAHDAMTAQSAAGALGSYMSQNGISTVDPDKLYQLAMNPSSGTPEDVSKAAK
FT                   FMLDHPDIFRKLETHDVAGADGISGVGNFQWAAQGGLDSDSAAPTDGTGSAEKVGLRGD
FT                   AQGEAAPMTAQSAAGALGSYMSQNGISTVDPNRLYQLAMNPPSGTPEDVSKAAKFMLAN
FT                   PDVFRQLETHDVAGADGISGVANFQWAAQGGLDSSSAAQSGDTGSTANAELGGKAESSG
FT                   GADAAGGDAQINDAPMSAQSAAGALGSYMSQNGISTVDPNRLYQLAMNPPSGTPEDVSK
FT                   AAKFMLADPDVFRQLETHDAAGADGISGVANFQWAAQGGLDSFATADAKPTAGATSAGA
FT                   SSGAAGPTLTAGAKAEAGAQSDGLQGAIAAMNGVVESAMKAQAAASTISVPDSTDSASN
FT                   ADA"
FT   gene            complement(583962..585854)
FT                   /locus_tag="BURPS1710b_A0418"
FT   CDS_pept        complement(583962..585854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0418"
FT                   /product="type III secretion outer membrane pore, YscC/HrcC
FT                   family"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02516"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51392"
FT                   /db_xref="GOA:Q3JLH6"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH6"
FT                   /protein_id="ABA51392.1"
FT                   /translation="MGCPEWFDTRDRLSEGVRRNPFGNARALIQDDSPALTQFQRTMKA
FT                   KALLCAAWCVAIFGTIGIGAANAMPVRWRSTVVHVVLEGKDLKDVLRDFAASQGVATSI
FT                   AGNVQGTVTGRFDLSPQRFLDTLAATFGFVWFYDGNILSITNANDMTRQVLPLDHASIG
FT                   ELRSALRQIGMDDKRFPIFYDEVSGTVLVSGPAQYVQIVTDIAQRLDTLSGRRNGSTIR
FT                   IFKLKHAWAADRNVQIDGNTVTMPGIATVLANLYRVRGRAGTGQSSAAPGVQRVQPMGD
FT                   VSGSAYGGNRLMPPLPPSMMGGGRGDAFAKGASIDGESGGAASAAPGGAPRTEEASAER
FT                   DELPIIQPDPMTNSVLIRDLPDRLAQYAPLIQQLDIRPRLIEIQAHIMEIDNDLLREIG
FT                   VDWRAHNSHGDIQTGTGNTAQNDYSGGQINPFFGTTTLAGNAVVNAAPAGVSVTAVVGD
FT                   AARHLMARVSALQSTSKVKIDASPLVATLDNSEAVMDNTTRFFVKVSGYASAELYSVST
FT                   GVSLRVLPMIVQDGSETRIKMNVHVTDGQLTGDQVDNLPVITSSEINTQAFVGQGQSLL
FT                   IAGYSTDKRANGVAGVPWLSKIPLLGALFRYHSDSQNHMERVFLLSPRIIDPGT"
FT   gene            complement(585770..587197)
FT                   /gene="hrpB"
FT                   /locus_tag="BURPS1710b_A0419"
FT   CDS_pept        complement(585770..587197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="BURPS1710b_A0419"
FT                   /product="HrpB"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53528"
FT                   /db_xref="GOA:Q3JLH5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH5"
FT                   /protein_id="ABA53528.1"
FT                   /translation="MVSALSLLGADAPTHLHSHLKLILGGEFNAALERSSEWAETTVAS
FT                   ERTSWDLQLHADLQLVLGFEVEAEENYRRAQRKIRGSNSKIRIATCRNAAWQALFRYRV
FT                   TTALACFSRICDEPGIEAGGLVEARFGIACALYEMGRIDDAFDAIDSMEKIAEQQSDEM
FT                   RAHWKDLIAVLRFDLVVQSELRRAAAFVDHVYWQSAQSMSRVDRAHGVSEAAVSVETPL
FT                   LRGRVAYLLQLRCAAAGNRDAVAELARCLDAAGEQGFVDFRYTLRLEIALALLAGDAPN
FT                   LAQFVLEPISDTLHGAESSRRYREYFYCAAKVHLAQDHTQESLALYRRYALIAMRCLRE
FT                   DALIGRQFLVGQELKQLPQSDDVTVRLPLKYRRAYHYILQNLNRSDLSVREIAAEIGVT
FT                   ERALQNAFKIYLGLSPRELIRSRRMERIRTELVDFTLTGERNVKEAARKWGVQNGSTLV
FT                   IAYRKEYDETPSETLAR"
FT   gene            complement(587396..588214)
FT                   /locus_tag="BURPS1710b_A0420"
FT   CDS_pept        complement(587396..588214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0420"
FT                   /product="type III secretion protein SpaR/YscT/HrcT"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01401"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52969"
FT                   /db_xref="GOA:Q3JLH4"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH4"
FT                   /protein_id="ABA52969.1"
FT                   /translation="MTPALFALQGWAGALLDDVTLLAICSVRLYIVMSVFPPTADGLSQ
FT                   GVVRNALVILFGSYVAYGQPAGFVQTLHGTPLIVTGLREAVIGVVLGIAASTVFWAIEG
FT                   AGCYIDDLTGYNNVQMTNPARGEQSTPTATLLTQVATVAFWTFGGMTFLLGTLYESYRW
FT                   WPITLTFPRMPALIEAFAVSQTDSLMQMVTKLAAPMMLVLLLIDFAFGFAAKSASKLDL
FT                   MGLSQPVKGAVTVLMLALFVGTFVDQAREQVTLSTLSKQLREWSHAMSRG"
FT   gene            complement(588211..588738)
FT                   /locus_tag="BURPS1710b_A0421"
FT   CDS_pept        complement(588211..588738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0421"
FT                   /product="type III secretion protein HrpB7"
FT                   /note="identified by match to protein family HMM TIGR02559"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52897"
FT                   /db_xref="InterPro:IPR013392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH3"
FT                   /protein_id="ABA52897.1"
FT                   /translation="MAGLSKSMMRERRAMAFARALERRRRLDAVLREELAERRTRLQSL
FT                   DRVLKEKVSQVELKADDVHRHAARIDTLMTGTASFSLDELTACRAYLDVAVAHLRALES
FT                   EEARLRAEFDALAAAIEEKKLEIGRNLSRIDACDARIEQIRRHGERAADEALDEEMEEA
FT                   ALGARMRNRGAA"
FT   gene            complement(588738..590087)
FT                   /locus_tag="BURPS1710b_A0422"
FT   CDS_pept        complement(588738..590087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0422"
FT                   /product="type III secretion apparatus H+-transporting
FT                   two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF02874; match to protein
FT                   family HMM TIGR01026; match to protein family HMM
FT                   TIGR02546"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52324"
FT                   /db_xref="GOA:Q3JLH2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH2"
FT                   /protein_id="ABA52324.1"
FT                   /translation="MSADEPLRTAEFSHLADAIEREILAVSGVVRTGRVLEVIGTLIKV
FT                   SGLDVALGELCELRTREGRLLQRAEVVGFTRDVALLSPFSQLEQISRTTQVIGLGRPLS
FT                   IPVGDALLGRVIDGLGEPLDGGPPLASETLQPLIAAPPEPMSRRMIDAAMPTGVRVVDA
FT                   MMALGEGQRMGIFAPAGVGKSTLLGMFARGAACDVNVIALIGERGREVREFIELILGQA
FT                   GMARSVVVCATSDRSSMERAKAAYAATAIAEYFRDRGRRVLLMMDSLTRFARAGREIGL
FT                   AAGEPPARRGFPPSVFAELPRLLERAGMGRTGSITALYTVLAEDESGSDPVAEEVRGIL
FT                   DGHMILSREVAAKNQYPAIDVLGSLSRVMPLVVDDGHMRAAARVRELLAKHREVEVLLQ
FT                   IGEYKAGANPLADEAIAKADAIRSFFSQRTDDYAAAEDTIARLYALSGAN"
FT   gene            complement(590084..590953)
FT                   /gene="sctL"
FT                   /locus_tag="BURPS1710b_A0423"
FT   CDS_pept        complement(590084..590953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctL"
FT                   /locus_tag="BURPS1710b_A0423"
FT                   /product="HrpF"
FT                   /note="identified by match to protein family HMM TIGR02499"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53205"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH1"
FT                   /protein_id="ABA53205.1"
FT                   /translation="MAIWLRRPRIAEMGPITPNSCARLGFSGDVVPRECFGELMTIESA
FT                   YAALDADRDAVLAAARQEADRVMAEAVARTEEMIAAAQSEYDAAAERGYRDGYDQAFGK
FT                   WMDRLADVADAQNRLQLRMRERLADIVASAVEQIVRAESRETLFKRALASVERIVDGAT
FT                   YLRVVVHENDLDQARAIFGTLEARWREFGRPIAMSVVADKRLAPGSCVCESDFGAIDAS
FT                   LDTQLRAMRGAVARALKRSIEEAGANECDATRRDESIGIETDRDGERDARNAEQDAGDA
FT                   GASAGGRA"
FT   gene            complement(591720..592508)
FT                   /gene="sctJ"
FT                   /locus_tag="BURPS1710b_A0424"
FT   CDS_pept        complement(591720..592508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctJ"
FT                   /locus_tag="BURPS1710b_A0424"
FT                   /product="lipoprotein transmembrane protein"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM TIGR02544"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52646"
FT                   /db_xref="GOA:Q3JLH0"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLH0"
FT                   /protein_id="ABA52646.1"
FT                   /translation="MRLLGVLALSVLLAGCKKELYTGLSEQDVNEMMVALLENGVDASK
FT                   DSADGGKSWKLNVDGDQLVHAMEVLRTRGLPRSKFDDLGNLFKKDGLVSTPTEERIRFI
FT                   YGMSQELSSTLSKIDGVLVARVQIVLPNNDPLAQTAKPSSAAVFIKYRPSADITALIPQ
FT                   IKTLVMHSVEGLTYDQVSVTAVAADAVDLARSRPAAVIMPPWLVGLLAFGAMSIAAAGL
FT                   FVVSRRPWTRAGAHEAGSAAPWRKRVAELAAHLRRRQRAN"
FT   gene            complement(592582..592962)
FT                   /locus_tag="BURPS1710b_A0425"
FT   CDS_pept        complement(592582..592962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0425"
FT                   /product="type III secretion protein HrpB2"
FT                   /note="identified by match to protein family HMM TIGR02558"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51448"
FT                   /db_xref="InterPro:IPR013391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG9"
FT                   /protein_id="ABA51448.1"
FT                   /translation="MDVSRTALQLSLEQLTNGTAGNTPAHLAEKFSALMRKAPMEPVQA
FT                   PRSAGLETVSRLAAAQDMELQRSVSDVADVERRAPMLSLSEVNVETIRLTYEIASTQLD
FT                   MEAKMSVVNASKTAIETLMKNQ"
FT   gene            complement(593005..593574)
FT                   /locus_tag="BURPS1710b_A0426"
FT   CDS_pept        complement(593005..593574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0426"
FT                   /product="type III secretion protein HrpB1/HrpK"
FT                   /note="identified by match to protein family HMM TIGR02561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53521"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG8"
FT                   /protein_id="ABA53521.1"
FT                   /translation="MKADTPDYMQCRPEIVGGLIETVSTALLRTFPKVTADPYDIELIL
FT                   DALRVMRPNVVEIQMLDGVLYMACGRWDDAIRILSEVCATAPHFGYGKALLAFCLSTKG
FT                   DDAWKQHAAEALESSPNDDTLVLVKALQAREDMVKAVQANRNGGPFVPPQSVCELNAEL
FT                   ERSAPQAEQPIAERVEVAQYGATLRA"
FT   gene            593861..594919
FT                   /gene="sctU"
FT                   /locus_tag="BURPS1710b_A0427"
FT   CDS_pept        593861..594919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctU"
FT                   /locus_tag="BURPS1710b_A0427"
FT                   /product="SctU"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR01404"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52956"
FT                   /db_xref="GOA:Q3JLG7"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG7"
FT                   /protein_id="ABA52956.1"
FT                   /translation="MSDEKTEEPTDKKLRDARRDGEVSRSTDLSDAVSMSAAILLLVAA
FT                   ADHFGDAMRALVNGALAFVSADHSLVEMTARLYQFGGIALSAVMPLLFVAALAGIGGSV
FT                   LQVGLQISLKPVMPNLGALNPAEGLKKLFSPRSAIESIKMIVKAVIVFCVAWKTIVWLF
FT                   PLIAGALYQSPPELSRIFREILAKWLMVVAGLCLLMGAADVKLQRFMFMQKMKMTKDEV
FT                   KRESKNDEGDPLLKGERKRLARELAAAPPQHQVAHANFVVVNPTHYAVAVRYAPDEHPL
FT                   PRVIAKGLDEAAIALRRAAQDANIPIIGNPPVARALFRIGVEEPVPEELFEIVAAILRW
FT                   IDAIGPRRNERA"
FT   gene            594935..597052
FT                   /gene="sctV"
FT                   /locus_tag="BURPS1710b_A0428"
FT   CDS_pept        594935..597052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctV"
FT                   /locus_tag="BURPS1710b_A0428"
FT                   /product="SctV"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01399"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52142"
FT                   /db_xref="GOA:Q3JLG6"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG6"
FT                   /protein_id="ABA52142.1"
FT                   /translation="MFKSLKLPAGGEIGIVALVIAIISLMILPLPPVAIDLLLGINITI
FT                   SVTLLMVTMYVPDIAALSAFPSLLLFTTLFRLSLNIASTKSILLHAEAGNIIESFGQLV
FT                   VGGNLVVGLVVFAIITTVQFIVIAKGSERVAEVGARFTLDALPGKQMSIDADLRSGLLS
FT                   TEEARKKRATLAVESQLHGGMDGAMKFVKGDAIAGLIITMINIVAGIAVGVAYHGMSAG
FT                   DAANRFSVLSVGDAMVSQIPSLLLSVAAGVMITRVTDERAPKRRSLGDEISHQLGSSAR
FT                   ALYFAAFLLLGFAAVPGFPAALFVLLAAALAFAGYRLSRKGSPSSGAARGQEQEALRAM
FT                   QRSGAKADVPPILPRAPQFACAVGVRIAPDLASGLALPRLDEALDLERARLQDELGLPF
FT                   PGVTMWIHPTLSAATFEVLIHDVPHLSVTLPARKAMLPQQRHLSPAHAALTDEQKARHR
FT                   DLIERSEAGPPIDASGQATHWIDEPAVTAKDSVWRAEQIIAYASVAAIRTHAPLFVGIQ
FT                   EVQWILDQLGADSPGLVAEVLKILPSTRIADVLRRLLEEQISIRNVRTIMESLVAWGAK
FT                   EKDMLMLTEYVRGDLSRFLAHRAAQGERVLSAVLFDLQAEQHIRQAIKQTPTGNFLALP
FT                   PDDASRLVDRIQSLVGANARTDIALVTSMDIRRYVRRMIERRIDWLAVYSYQELGEHVE
FT                   LRPVGRVSLQG"
FT   gene            597729..599036
FT                   /gene="sctQ"
FT                   /locus_tag="BURPS1710b_A0429"
FT   CDS_pept        597729..599036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctQ"
FT                   /locus_tag="BURPS1710b_A0429"
FT                   /product="SctQ"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53434"
FT                   /db_xref="GOA:Q3JLG5"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG5"
FT                   /protein_id="ABA53434.1"
FT                   /translation="MVIRSQRMASPFSVDPNADPPCGVATRQPGNRSNAFDGPANRSAP
FT                   PQSTARQNAATGIAPLSPVRVEPAVARASRTVFDARLEALAASVSGLASWHVSVVDNAH
FT                   VFIDRLVDAAVIELSIGPSGGMGGFPLFIAIDLDAHPDLGIAAYPERDAVCAHREASES
FT                   VALRQAVSGILLEPLVKCLDRFGLCSPSVVSITRPRPVDRAGDWRDQPAVELTLALDER
FT                   RVACAISLPMRGYDIVDALLRTQPTPRKPAMSIPGALIIGARPLAVDTLNVLEAGDVLL
FT                   RGLFPHFNATLLSTGTRATESLRAVAAWGARGHVRLHAAVQVDVRSFVISKELSMSEEV
FT                   DQASAGLGVVTTDEPTRIGELELPVQFEIDTVSLPIDQLSALEPGYVIELPVAVTDARL
FT                   RLVVHGQTVGYGELVAVGEHLGVRIIRMAHRHGTVQ"
FT   gene            599020..599670
FT                   /gene="yscR"
FT                   /locus_tag="BURPS1710b_A0430"
FT   CDS_pept        599020..599670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yscR"
FT                   /locus_tag="BURPS1710b_A0430"
FT                   /product="type III secretion apparatus protein, YscR/HrcR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01102"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52703"
FT                   /db_xref="GOA:Q3JLG4"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG4"
FT                   /protein_id="ABA52703.1"
FT                   /translation="MVQFSDITGLLLVVIAISLLPFIAMVVTSYAKIVVVLGLLRNALG
FT                   VQQVPPNMVLNGIAILVSLYVMAPIGMQAAKALDEQQLASQSSQAIIQALGSAREPFRS
FT                   FLEKHTPEREKRFFIRSASVIWPKEEASLLNERDLIVLAPAFALSELTDAFKIGFLLYI
FT                   VFIIVDLVIANVLLALGLNQITPTNVAIPFKLLLFVAMDGWSTLIHGLVMTYK"
FT   gene            599693..599956
FT                   /gene="sctS"
FT                   /locus_tag="BURPS1710b_A0431"
FT   CDS_pept        599693..599956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctS"
FT                   /locus_tag="BURPS1710b_A0431"
FT                   /product="type III secretion inner membrane protein SctS"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01403"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51960"
FT                   /db_xref="GOA:Q3JLG3"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG3"
FT                   /protein_id="ABA51960.1"
FT                   /translation="MEIDSLIRFCTQAMLLCLSVSLPPVIVAALVGLGVSFVQAITSLQ
FT                   DQTLPQVLKLIAVTITIMVAAPTGCAAILHFANQMMQLAVPQ"
FT   gene            600862..602106
FT                   /gene="sctD"
FT                   /locus_tag="BURPS1710b_A0432"
FT   CDS_pept        600862..602106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctD"
FT                   /locus_tag="BURPS1710b_A0432"
FT                   /product="secretion-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51229"
FT                   /db_xref="GOA:Q3JLG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG2"
FT                   /protein_id="ABA51229.1"
FT                   /translation="MTRKRNRHRHLPPHRANDGCILSHTPGRFRIYGKRADTRLYTVEQ
FT                   SADIRNLDHHHFPSLPWNETMKLLRILTGVHAGAQLQLAPGTHRIGSDDGADIRLTDWH
FT                   AADLLLHVKDDVVRAQFVETDAERAPSASDSSETVLFVDLAPMQFDATVLCVGPDSSAW
FT                   PSDFDLLSTLILRRAPQPLWRHRYARTATACIALGSVMLAVAAISTSQTSRAAPAPNVG
FT                   YRAQRIVDALAAAHIDGLQARPIGDAVVVTGMVAHAADAATVRTLLASIASSGIVSRYD
FT                   IAQQVSHNIEDSLGVPGAQVEYAGKGRFVVKGPPGRHEALEAAVARVRSDLDPNVTGVT
FT                   VAAPESAAETAAENSASYAEMVAADGVQYAQTSDGVKHIYVADTPAQAGDNVPMRGNAR
FT                   SATRDVPPLPPNMPD"
FT   gene            602807..603394
FT                   /gene="hpaB"
FT                   /locus_tag="BURPS1710b_A0433"
FT   CDS_pept        602807..603394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaB"
FT                   /locus_tag="BURPS1710b_A0433"
FT                   /product="HpaB"
FT                   /note="identified by match to protein family HMM PF05932"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51442"
FT                   /db_xref="GOA:Q3JLG1"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG1"
FT                   /protein_id="ABA51442.1"
FT                   /translation="MRHKAANRCLFRIPALSGRGKPASFQDTGRFFFRRTHWLSIFHSM
FT                   SSERYIQLIQDLCATVGLANVDNVLEARTIEVEGFDVRLDCFDSDAEAMYANFHFGTVT
FT                   AGRTLTVFRLMLEANLLVYAQDQAQLGIDTNTGGVILIIRLPFSLGIDGQGLADLLAHY
FT                   AEHGRYWRQSIIESSDEMFEGIASGEYFWLRA"
FT   gene            603731..604846
FT                   /gene="sepC"
FT                   /locus_tag="BURPS1710b_A0434"
FT   CDS_pept        603731..604846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sepC"
FT                   /locus_tag="BURPS1710b_A0434"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52183"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLG0"
FT                   /protein_id="ABA52183.1"
FT                   /translation="MRANRNNGLTAGALPPNSAAPDDAAKAAPPVAQSDRGAGPLAGLT
FT                   ALKADRAQCMSARPSIRSTTKAPAVMSHARADTSRELTPVEARIAQTFVRPEHLRAIAA
FT                   AARAGSFAVSFRASGQLSLKRLANGAPAKGHDILEKTIKPGSVQEVYGADSERRLAQIE
FT                   RADIDGYVGHWGRDKLLGLYMGPAANERDTPMLFGALRTTPSGHRYYPVDHDDLEGSLA
FT                   LLKRTQGPSGTAGSFWRSLPYTGDYDTHDMINMAGHRAPVPSGSRDEHRIMRSLNVAIE
FT                   AIDPIRKASSGSHRLIQHGPQHNYVAHMRTNEQGAVIDEAVARASFPLAMCDRGTWSVI
FT                   ETPEALAAFYRQHGVVLKEKWREKRANTFTA"
FT   gene            complement(605273..605755)
FT                   /locus_tag="BURPS1710b_A0435"
FT   CDS_pept        complement(605273..605755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0435"
FT                   /product="Cupin domain protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52900"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF9"
FT                   /protein_id="ABA52900.1"
FT                   /translation="MSNTPPELLKAADIEAMEAVRSVHVLNANAVRLKKPLSEKTGITQ
FT                   FGFLIVTLMPGHESSECHRHLYEEECVYILSGYGEATLGERAYPVGPGDFLGFARRGPA
FT                   HVLKNTGDVPLVFIAAGQRLEHDVCEYPRVGKRLFVAGEMEGYVDWEEGPREMLGD"
FT   gene            complement(605850..606656)
FT                   /locus_tag="BURPS1710b_A0436"
FT   CDS_pept        complement(605850..606656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0436"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53628"
FT                   /db_xref="GOA:Q3JLF8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF8"
FT                   /protein_id="ABA53628.1"
FT                   /translation="MAEALSCDVVIIQLGDRVSIRDNPWGRILAKRLRGGQNRSFPSSG
FT                   TSRPLAVRRLPGASREAERMTQPIKLVLFDMEGVLSDYDRAARTARLADLTGRPPEAVR
FT                   YAIWESGLEARADAGRIGVDQYLRELAQLLGAPVSRDDWLIARKASITPNLEVVALAER
FT                   VARCSRIAVLTNNCRLVTDYIDYLNPPVARVFGAHVYPSATFGAAKPDAQAYLGCVGWL
FT                   GVTAQETLFIDDADANVAGAVSAGLLGCKFVGAGALAQELARRRLA"
FT   gene            606655..607359
FT                   /locus_tag="BURPS1710b_A0437"
FT   CDS_pept        606655..607359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0437"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53625"
FT                   /db_xref="GOA:Q3JLF7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF7"
FT                   /protein_id="ABA53625.1"
FT                   /translation="MFEKIPTRAMSDTVAQQLLKQIEIGGFAGTGKLPTEAVLAQEFGV
FT                   SRTVIREAISRLKNEGVVEPRQGSGVYIARHAAIRPLRIDYAEAVEASSLPHLLAVRRA
FT                   IEAEVAAEAALCRTDEDMEDIDAALAKIDDAVAEGRDGVAEDVAFHRTIASVTGNPYFL
FT                   KTLSFLNQYLEAGVKVTRGNEATREDFSRQVREEHAAIADAIRARDPSAAGNAARAHMY
FT                   NAARRLEQAGIC"
FT   gene            607519..608328
FT                   /locus_tag="BURPS1710b_A0438"
FT   CDS_pept        607519..608328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0438"
FT                   /product="NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase family"
FT                   /note="identified by match to protein family HMM PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52786"
FT                   /db_xref="GOA:Q3JLF6"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF6"
FT                   /protein_id="ABA52786.1"
FT                   /translation="MHACDVREDVLAAFAAEGGVRCATPAELGALCGVVVTLVVNAQQT
FT                   DAVLFGEQGAAAAMPRGGVVISSATVAPDFAAQLGARLAAAGLLMLDAPVSGGAARAAS
FT                   GEMTMMTSGPAAAYEACGDVLAAIAGKVYRLGDAHGAGSKVKIINQLLAGVHIAAAAEA
FT                   MALGLREGVDPDALYDVITHSAGNSWMFENRVPHILNGDYTPLSAVDIFVKDLGLVLDT
FT                   ARRSQFPLPLSATAHQMFMSASSAGHGGEDDSAVIKTFPGIALPARR"
FT   gene            608351..609718
FT                   /locus_tag="BURPS1710b_A0439"
FT   CDS_pept        608351..609718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0439"
FT                   /product="candidate type III effector Hop protein"
FT                   /note="identified by match to protein family HMM PF07005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51549"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF5"
FT                   /protein_id="ABA51549.1"
FT                   /translation="MSTDQALRPLLGCIADDFTGATDLANMLVKSGMRTVQTIGVPAAG
FT                   AAVPADAIVVALKSRTIPAADAVAQSLAALDWLRAQGCRQFFFKYCSTFDSTDAGNIGP
FT                   VADALLDALGGERAFTIACPAFPENGRTVYRGHLFVGDALLGESGMENHPLTPMKDANL
FT                   VRVLQRQTPSKVGLIRHDAIALGTCAVRETIDTLRREGVRIAIADALTDRDLYVLGEAC
FT                   ADLPLITGGSGVALGLPSNFRLGGLLPERGDAAALPAIGGASAVLAGSASKATHAQVAA
FT                   WRAERPALRIDPFAAARGEPVVDQALAFARAHLPQPVLIYASAAPDEVKQVQQALGIEA
FT                   AGHLVEATLAAIARGLREMGVRKFVVAGGETSGAVVQALGVKALRIGAQIDPGVPATAT
FT                   TEGSPCGTTEGSPCGATEGSPRGTPDAQPLGLALKSGNFGSVDFFEKALRALEGAA"
FT   gene            609715..610356
FT                   /locus_tag="BURPS1710b_A0440"
FT   CDS_pept        609715..610356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0440"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /EC_number="4.1.2.17"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53604"
FT                   /db_xref="GOA:Q3JLF4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF4"
FT                   /protein_id="ABA53604.1"
FT                   /translation="MSPIETKLREEICEIGASLYARGHAVGSAGNISAKLDDGWLITPT
FT                   DACLGRLDPAGIAKVDPAGNAVSGGKPSKTLALHRGIYARNAEARGIVHTHSTHLVALT
FT                   LAGVWSEADVLPPITPYYVMKVGHIPLIRYRRPGDPAVAAEVAALADRVRGVLLERLGP
FT                   VVWGPSVAHASYALEELEETARLWLITHPKPEPLGEPALAELRDAFGARW"
FT   gene            610460..611782
FT                   /locus_tag="BURPS1710b_A0441"
FT   CDS_pept        610460..611782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0441"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53702"
FT                   /db_xref="GOA:Q3JLF3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF3"
FT                   /protein_id="ABA53702.1"
FT                   /translation="MIPSQAAAARPLEAAGQAELDLTYRKVFWRIVPFLMLCYVVAYLD
FT                   RVNVGFAKLQMSQDLAFSETVFGLGAGIFFLGYFLFELPSNMLMHRIGARIWIARIMIT
FT                   WGLLSALFAFVKTPTQFYVLRFLLGLAEAGFYPGVILYLTYWFPTHRRAKIIAVFMSAI
FT                   PVSGIFGNPLSGWIMERFHGGSGFHGWQWMFVIEAVPAIAIGIATILYLDNNIRGAKWL
FT                   TEREKKLLADEIEAQPHERDKHAHSLSTVLRDPRTWWMSLIYFTFVTGQYGLTFWMPTL
FT                   VKSTGITDTLRIGLLSAIPFAFAIVAMNLFGRSADKRRERRWHLIVPALMGTVGFSVAA
FT                   AYSHNTTVSILFLSIAAGGVLTCAPLFWSLPTAFLAGTGAAAGIAIINSIGNLAGFASP
FT                   YLIGYLKDATSSTSAGMYVLAAMLVIGALAVWLTPAKLVNR"
FT   gene            complement(611837..614044)
FT                   /locus_tag="BURPS1710b_A0443"
FT   CDS_pept        complement(611837..614044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF2"
FT                   /protein_id="ABA53116.1"
FT                   /translation="MFGSPARAPDSACQLGSLGQIADMRRRLAPSTRAVDSNRRSEPPI
FT                   RTTDPNHRSEPPIRTTDPNHRSEPPIRTADPNRRSEPPTRTADANRRREPPTRTANSNR
FT                   QLEPPTRLEPILGAPVRLRRNARAIAGAERRLSPLVFEIAADHVDEARVAREAERFGAR
FT                   RVPASRPTADDLHDALVLGAPDQLHRFDAGDFAQRVDHVVDRHREPRQVDRAPVAERRA
FT                   VELAAGDERVDRAARRQQPQPRAARHRAYGLLAVQRLADDPARERRSRRVRPARPHADR
FT                   RQPQHAPVDEAAARVIGQQQLGDCLLRAVRRLRFERGVVPHEFGQRAAVHRHRAREHHA
FT                   RPVPARAAHVEQQARRIEVDPHPEVEIGFRLAAHDRREMEDRVRARVDRGLEHGAIGDV
FT                   ADARRHARIIEVVGLDDVEQHELVDAPRRAVRAGQLAAREQLFRETLAEKAGAAGDENL
FT                   HRNVPRENVGLQIRCEPAEALGGAGLRPILAADPAVVAEHVDQLEQVRIVDFADVRLVT
FT                   LRHARDLDVADARDVALQFHRQIAFDDLAVIAVELHQQVRRADFAADRLRVVLAVQEEA
FT                   RHVARVDRLDHDRHVLRARRFGRVREVAQIHVAMPRAILRRRDQARHHVERVVADHARV
FT                   VERGVDRAPELVLAARQRRDSALARRPVAGRRVEQRLHEAMRVEARLELGGGELVREQV
FT                   LDRLEAVACRGGEALEERVLVVHHREIGGEARHGVGSRSGG"
FT   gene            611864..612640
FT                   /gene="hyi"
FT                   /locus_tag="BURPS1710b_A0442"
FT   CDS_pept        611864..612640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="BURPS1710b_A0442"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52074"
FT                   /db_xref="GOA:Q3JLF1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF1"
FT                   /protein_id="ABA52074.1"
FT                   /translation="MPRFAANLTMMYNEHAFLERFAAAARDGFKAVEYLFPYEFPAAEL
FT                   KARLDAHGLVQALFNAPPGDWAAGERGIASLPGREDEFRRAIDTALDYARVIGNDTLHV
FT                   MAGLIAPTQDRARHRDVYLRNLAHAAEAARAQNVTIVIEPINPRDMPGFFLNRQDDAQA
FT                   ICREVGAPNLLVQFDCYHCQIVEGDLAMKLKRDIAGIGHIQIAGVPQRHEPDVGEIHYP
FT                   YLFELIDVLGYDGWIGCEYRPKAGTSEGLGWLAPYL"
FT   gene            612668..613639
FT                   /locus_tag="BURPS1710b_A0444"
FT   CDS_pept        612668..613639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0444"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51667"
FT                   /db_xref="GOA:Q3JLF0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLF0"
FT                   /protein_id="ABA51667.1"
FT                   /translation="MKVLITGGAGFLGQRLAKQLLARGELTGPNGAPRRIDELVLLDVV
FT                   QAHDFDDARVTARVGDIADRAVLEAAIDARTHAVFHLAAIVSGQAEADFDLGMRINLDA
FT                   SRLLLDVCRARGHRPRVVFTSSVAVYGGALPELVRDDTALEPQSSYGAQKAIAELLLSD
FT                   YTRRGFVDGRVLRLPTISVRPGRPNAAASSFASGIVREPLNGEQAVCPVPGGTRLWLLS
FT                   PRRAIDALIAGCELDGAALGNRRAINLPGLSVTVDDMIDALREVAGIEAVKLIRRAEDE
FT                   RVVKIVGSWPGRWDTSRAEALGLAGDASFVDVIRGYLEDERR"
FT   gene            614274..615281
FT                   /locus_tag="BURPS1710b_A0445"
FT   CDS_pept        614274..615281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0445"
FT                   /product="Aspartyl/Asparaginyl beta-hydroxylase family"
FT                   /note="identified by match to protein family HMM PF05118"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51192"
FT                   /db_xref="GOA:Q3JLE9"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="InterPro:IPR039038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE9"
FT                   /protein_id="ABA51192.1"
FT                   /translation="MRRATLPGRSTRTTAAAARRKAARQSDKTRNARAPPRSRHGCPAR
FT                   SEASARHARPTNAQPIAFATIVIRTRSLISPPCADGRANGRPNRRPNDRPRDASATNAW
FT                   DMAAFYDFGARKLRDLYDRRLHCGAVLDTATLFPDAARFTHAWRAIRDEALAVSRDLNR
FT                   IPRFHEIMREQAAISANDARDWRMFIMQAYGVRFAQNLGRCPTLASIVAASPDVLSASF
FT                   SFLAPGKHIPPHRGPFRGILRGYLVLSMPMRANGTPAAVLKIDGRDHRLRDGQFLLWDD
FT                   TFEHEVWNESDAVRIVLLLDIRRRDLPPALALLSGALIRLVRVAIRLRGGAIPV"
FT   gene            complement(616175..617074)
FT                   /locus_tag="BURPS1710b_A0446"
FT   CDS_pept        complement(616175..617074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0446"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05118"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53382"
FT                   /db_xref="GOA:Q3JLE8"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE8"
FT                   /protein_id="ABA53382.1"
FT                   /translation="MRWAILFIFVACAAFTHRRGKVRHGFFRQLSDHSTFTAPLNCFAY
FT                   AFSNVPNTPYIDDAHFPELAILKREWRTFRDEALALRDASRIKASGEYNDIGFNSFFRK
FT                   GWKRFYLKWYDRPHPSALAHCPRSLAILSKLPSVKAAMFAQLPPGGKLGLHRDPYAGSL
FT                   RYHLGLSTPNDDECAIVVDGDPYAWRDGEAVMFDETYLHWAENRTGHDRIILFCDIERP
FT                   MKYRWAQAVNGAIGGVLMRAAASPNETGDRTGGLNRLFRYLYAVRRVGKRLKAWNRTVY
FT                   YALKWALFGGILIAILWR"
FT   gene            complement(617456..618406)
FT                   /locus_tag="BURPS1710b_A0447"
FT   CDS_pept        complement(617456..618406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0447"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   periplasmic glycine betaine/L-proline-binding protein"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52512"
FT                   /db_xref="GOA:Q3JLE7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE7"
FT                   /protein_id="ABA52512.1"
FT                   /translation="MKRNLIAAACGLAIAAAPFASARAGDAPTCKAVRFADVGWTDIAA
FT                   TTGLASTMLAGLGYAPTKTIASVPITFAGIKSKQIDVFLGYWSPTMDPMIAPFTKAGTI
FT                   KVLAAPNLTGAKYTLAVPDYVYQGGLKSFADIQKYADKLNGRIYGIEPGNDGNALIKKM
FT                   IDGNQFGLGKFKLVESSEAGMLVEVNRAIRDKQWIVFLGWEPHPMNVQMKIDYLSGGDD
FT                   VFGPNYGEAKVLTATPPDYAARCPNVAKFVSNLQFTTSIENHVMLPIMNKEDPNKAAAE
FT                   WLKANPQSLDKWLAGVTTFDGKPGLPAVKHYLGIQ"
FT   gene            complement(618507..619505)
FT                   /locus_tag="BURPS1710b_A0448"
FT   CDS_pept        complement(618507..619505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0448"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52377"
FT                   /db_xref="GOA:Q3JLE6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE6"
FT                   /protein_id="ABA52377.1"
FT                   /translation="MTSAAAAAPAACAEPVPSVAHFGFLTLPNFSMIAFTSAVEVLRMA
FT                   NYVARADHYRWSIFSLDGAPVRASNGIAVRPTQPLDVDDPPDVVIVCGGIRIREAVDER
FT                   VRDALGALAARDVPLGGICTGAYALMACGLLDGYRCAVHWENLSALHAEFPRVRFADEL
FT                   FAVDRDRLTCTGGTAPLDLMLNLVGARLGQPLAAQVSEQFILERIRGATDPQPIPVDAR
FT                   VGFSRAELIEVVRLMEANIEEPLSLEELARLVRLSQRHLQRMFKIYLNVSPTHYYLTLR
FT                   LKRARDLLRTTDASIARVTAVCGFHSPCHFSKAYRAQFGHAPSHERRVSAR"
FT   gene            complement(619627..620529)
FT                   /locus_tag="BURPS1710b_A0449"
FT   CDS_pept        complement(619627..620529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0449"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   permease protein"
FT                   /EC_number="3.6.3.32"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51407"
FT                   /db_xref="GOA:Q3JLE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE5"
FT                   /protein_id="ABA51407.1"
FT                   /translation="MSELIPLGSWVDQSVHYLLDHDAKTFDAIGRAIEGLAALVEHGLQ
FT                   AVPMWLMMACFIGVGLWRVGWRFAFFTAASLFLIFATGFWDQTVVTLGLTLSSTIVSLV
FT                   LGIPLGIWAAKSKWVAAIVRPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMP
FT                   PAVRLTSLGIRHVNREIVEAGQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMV
FT                   IIASMVGAGGLGNDVLASIQRLDIGLGFESGLSVVLLAIILDRITESFGRAPGTARAPL
FT                   FSGLRQLFGPRSRSPVVQA"
FT   gene            complement(620522..621691)
FT                   /gene="proV"
FT                   /locus_tag="BURPS1710b_A0450"
FT   CDS_pept        complement(620522..621691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proV"
FT                   /locus_tag="BURPS1710b_A0450"
FT                   /product="glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01186"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53613"
FT                   /db_xref="GOA:Q3JLE4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE4"
FT                   /protein_id="ABA53613.1"
FT                   /translation="MDAPKVVVEGLCKVFGSNPRQALDMLAAGATKDEVFARTGQVVGV
FT                   HNVSFDVREGEIFVLMGLSGSGKSTLIRLVNRLVEPSAGKVMIDGRDVAAVRRAELTAL
FT                   RRTDMSMVFQSFALMPQRTVLSNAAFGLEVAGMGRKDRERRAMDVLEQVGLAQFAHKLP
FT                   AELSGGMQQRVGLARALAVNPSLMIMDEAFSALDPLKRKEMQNVLLQLQKEQRRTIMFV
FT                   SHDLEEALRIGSRIAIMEGGRLVQVGTPQEIIANPADDYVRAFFEGIDTSRYLTAGDLM
FT                   LTGAVPTLSKLDAKHVAASLNGSAEYAFVLDEARKIRGFVTRDALNGATPNVRQVESIP
FT                   RDASLDHVVERCVAHPHALPVVDDDGCYCGSVDRAVLLKAITRSRGSHV"
FT   gene            622471..623133
FT                   /locus_tag="BURPS1710b_A0451"
FT   CDS_pept        622471..623133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0451"
FT                   /product="NADPH-dependent FMN reductase family protein"
FT                   /note="identified by match to protein family HMM PF02525;
FT                   match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52084"
FT                   /db_xref="GOA:Q3JLE3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE3"
FT                   /protein_id="ABA52084.1"
FT                   /translation="MERTLTAFDPHRRPFIVGIGGTTRAASSTERALGFALRGAQAAGA
FT                   RTRLFDGPFLHTLPHYAPERRALTDAQRELIDAVRAADALVIATPGYHGGVSGLVKNAL
FT                   DTLEELRADERPYLDARAVGCIVTAYGWQAAGTVLTSLRAIVHALRGWPTPFGATVNTL
FT                   ETRFETAGSCSDSKVAAQLETVGAQAAEFALAFASHRAATRVAGGETLAPVLEAAAG"
FT   gene            623642..623941
FT                   /locus_tag="BURPS1710b_A0452"
FT   CDS_pept        623642..623941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52470"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE2"
FT                   /protein_id="ABA52470.1"
FT                   /translation="MICLRIKIGSRACIDCLRCNLVPPFAKAMNRSIRYKGYEVAPAAA
FT                   RLPNGLFAANLTIEKAGPAPARAYSFDAIDFFFDEEHALAYAFRWGRLWVDSHC"
FT   gene            624082..624939
FT                   /locus_tag="BURPS1710b_A0453"
FT   CDS_pept        624082..624939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53234"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE1"
FT                   /protein_id="ABA53234.1"
FT                   /translation="MRHWVHQSRGPVPIGSDAHKQMFCNMLLDTHNPYKPAVIDWPALR
FT                   PDALRRLTSLPIWDIAVQTEGRASVRVATFASTVRDPLLRAALELDAAEEARHKVVLSK
FT                   LVQAYGIRLAPEPAYPAPKDAEWAWMVTGFSECIDSFFAFGLFRSAQRSGYFPPELVET
FT                   FEPVIQEEGRHILFFANWFGWYWRNLSWWRRPWLFARVAAVWAYLIWERIGIARGIDAD
FT                   GVARDANFPANTAATVGNALNPRELIELCLVENARRMAGYDTRLLRPTIVPRLARFALR
FT                   FIRK"
FT   gene            625003..625737
FT                   /gene="arsR"
FT                   /locus_tag="BURPS1710b_A0454"
FT   CDS_pept        625003..625737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="BURPS1710b_A0454"
FT                   /product="arsenical resistance transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53605"
FT                   /db_xref="GOA:Q3JLE0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLE0"
FT                   /protein_id="ABA53605.1"
FT                   /translation="MSPHMSPTPSPTVAYRDVSSLVVTCRRLSSRTRERAAIGTGAPSR
FT                   RATGMHAFLRLPPRRRRPHEPSSNRRATRERNEVRADARRVRHVRSRIGAPFAASLRRN
FT                   GGLPKRSSGPASPPIERLPKFPCFDYYRNMEIDQTVAALAALAHTSRLAVFRTLVQAGP
FT                   QGLPAGRIAALLDVPPSSLSFHLKELAHAQLVTSRQEGRFVFYCANFATMNGLLAYLTE
FT                   NCCGGNPCSPAAACSTARGHRS"
FT   gene            625734..626213
FT                   /locus_tag="BURPS1710b_A0455"
FT   CDS_pept        625734..626213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0455"
FT                   /product="glyoxalase family protein family"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52885"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD9"
FT                   /protein_id="ABA52885.1"
FT                   /translation="MKRFHVHVSVANLADSIRFYSALFAAEPTVVKEDYAKWMLEDPRV
FT                   NFAISQRGAAPGLDHLGVQTEDDAELAEMRARLDHAALPVDAQIGAACCYARSDKYWSV
FT                   DPQGIAWEAYRTLGEAPTFGVSRAARAAGPNAGAPACCAPAHGQPAGAPTQSACC"
FT   gene            626248..626742
FT                   /gene="arsC"
FT                   /locus_tag="BURPS1710b_A0456"
FT   CDS_pept        626248..626742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="BURPS1710b_A0456"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52065"
FT                   /db_xref="GOA:Q3JLD8"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD8"
FT                   /protein_id="ABA52065.1"
FT                   /translation="MTTNILILCTHNSARSVLAEGMLDHWAEKLGKDVRAHSAGSAPSG
FT                   RLNPFALEALRGAGVDVGGYRSKSWDEFVGDGAPVMRAVITVCDAAASETCPYWPGSPV
FT                   KVHWGYADPSNAPGGDAGKRLAFELTRQAIGYRMLQLLALPIDRMSDAELQTALTDISR
FT                   N"
FT   gene            626805..627875
FT                   /gene="arsB"
FT                   /locus_tag="BURPS1710b_A0457"
FT   CDS_pept        626805..627875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="BURPS1710b_A0457"
FT                   /product="sodium bile acid symporter family protein"
FT                   /note="identified by match to protein family HMM PF01758"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53584"
FT                   /db_xref="GOA:Q3JLD7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD7"
FT                   /protein_id="ABA53584.1"
FT                   /translation="MNPSNVAPPENAAAQPAINFFERYLTVWVALCIVAGIALGQARPD
FT                   LFRQIGRMEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRRHVKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIKQFFAPMLPAAQLDSYLAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVILAQLWRKRLLANG
FT                   QAALDAAMAKIGPWSIAALLATLVLLFAFQGEAILAQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHDIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNRTKGWYERT"
FT   gene            628976..637249
FT                   /gene="xadA"
FT                   /locus_tag="BURPS1710b_A0459"
FT   CDS_pept        628976..637249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xadA"
FT                   /locus_tag="BURPS1710b_A0459"
FT                   /product="haemagluttinin family protein"
FT                   /note="identified by match to protein family HMM PF05658;
FT                   match to protein family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51851"
FT                   /db_xref="GOA:Q3JLD6"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="PDB:3LA9"
FT                   /db_xref="PDB:3LAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD6"
FT                   /protein_id="ABA51851.1"
FT                   /translation="MNRSYRSIWNEALGAWVAASEISSARGKPNKSAVAKVVTAAVLAV
FT                   VVQAAHASTIGVGTGSLPGGSACGGIGGTGIGPDGTTNYTNRAITDGSGFYSTVAGCSA
FT                   NGSNALGVTLYGAFTTVTGDGGTAMGFAAYAAKWASAVGLQASATGQSSSAFGFNALAS
FT                   GANSLALGSSSTAAYANSVAIGQGSVTGAAAPTGTGYLTGSAAPSSEVSVGSSTNLRRI
FT                   TNVADGSAANDAVTVAQLSTGMSTTTSAIASLSTSTSTGLSSARSSIASLSTSTSTGLS
FT                   SATSSIASLSTSTSTGIGSLSTGLSTTNSNVASLSSGLSSTNSSLTSLSTSASSGISTA
FT                   QSGVNSLSTGLSTTNSTVASLSTSTSTGLSSANSSIASLSTSASSGISTAQSGVNSLST
FT                   GLSTTNSTVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSTGLSTTNSNVASLSSGL
FT                   SSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTTNSTVASLSTSTSTGLSSATSSIAS
FT                   LSTSTSTGIGSLSTGLSTTNSNVASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNSLS
FT                   TGLSTTNSTVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSSGLSTTNSNVASLSSG
FT                   LSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTANSTVASLSTSTSTGLSSATSSIA
FT                   SLSTSTSTGIGSLSTGLSTTNSNVASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNSL
FT                   STGLSTTNSTVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSTGLSTTNSNVASLSS
FT                   GLSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTANSTVASLSTSTSTGLSSATSSI
FT                   ASLSTSTSTGIGSLSTGLSTTNSNVASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNS
FT                   LSTGLSTTNSTVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSTGLSTVATTTNNLG
FT                   SSTAAALGGGATYNPATGTISAPSYTTYNANGTTTANTSVGSAIDSINANGIKYFHANS
FT                   TGPDSVATGADAVAIGTGATAATANSVALGANSVTAAAVPTSSATVGSTTLGTFAGSAP
FT                   VGVVSVGAPSAERQITNVAAGQVTASSTDAINGSQLYAVASKLDSTSSSISSLSTGLSS
FT                   ATSSITSLSTSTSTGLSSANSSIASLSTSTSTGIGSLSTGLSTTDSAVASLSTSTSTGL
FT                   SSATSSITSLSTSTSTGIGSLSTGLSTTNSNVASLSTSTSTGLSSATSSIASLSTSTST
FT                   GIGSLSTGLSTTNSTVASLSTSTSTGLSSANSSIASLSTSTSTGIGSLSTGLSTTNSNV
FT                   ASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTTNSTVASLSTSTSTGLSS
FT                   ATSSIASLSTSTSTGIGSLSTGLSTTDSTVASLSTSTSTGLSSATSSIASLSTSTSTGI
FT                   GSLSTGLSTTNSNVASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTANST
FT                   VASLSTSTSTGLSSANSSIASLSTSTSTGIGSLSTGLSTTDSTVASLSTSTSTGLSSAN
FT                   SSIASLSTSTSTGIGSLSTGLSTTDSTVASLSTSTSTGLSSANSSIASLSTSTSTGIGS
FT                   LSTGLSTTNSNVASLSTSTSTGLSSANSSIASLSTSTSTGIGSLSTGLSTTNSNVASLS
FT                   TSTSTGLNLANSSIASLSTSTSTSIDSLSTGLSTTNSNVASLSTSTSTGLSSANSSIAS
FT                   LSTSTSTGIGSLSTGLSTTNSNVASLSTSTSTGLNLANSSIASLSTSTSTGIGSLSTGL
FT                   STTNSNVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSTGLSTTDSTVASLSTSTST
FT                   GLSSANSSIASLSTSTSTGIGSLSTGLSTTDSTVASLSTSTSTGLSSATSSITSLSTST
FT                   STGIGSLSTGLSTTNSNVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSTGLSTTNS
FT                   TVASLSTSTSTGLSSATSSIASLSTSTSTSIGSLSTGLSTTDSTVASLSTSTSTGLSSA
FT                   NSSIASLSTSTSTGIGSLSTGLSTTDSTVASLSTSTSTGLSSATSSIASLSTSTSNGIG
FT                   SLSTGLSTTNSTVASLSTSTSTGLSSATSSIASLSTSTSTGIGSLSTGLSTTNSTVASL
FT                   STSTSTGIGSLSTGLSTTNSTVASLSTSTSTGIGSLSTGLSSTNSNLVSLSTSASTGIG
FT                   SLSTSIDTTNSNLASLSTSSSTGIGSLSTSINATNSNLASLSTSASTGIGSLSTSISSI
FT                   TTNTTNLGNSTAAALGGGATYDPATGAISAPSYTTYNANGTTATNTSVGAAIDNINANG
FT                   IKYFHANSTDPDSVATGTNSVAIGPNAVANVDYSVAIGSGATTSAAVPVASASVGGLTF
FT                   GGFAGSAPIGVFSVGAPGAERQITNVAAGRISAASTDAVNGSQLYATNSNVASLSTGLN
FT                   ATNSNLASLSTSTSTAVGSLSTGLSTTNSTVASLSTSTSTSIGSLSTGLSTANSNLASL
FT                   STSTSTGIGSLSTGLATTNSNVASLSTSVTNINTQLTSLSTSITNNVIRSLPASTGVAA
FT                   DMSAPKATSPSVTAGSNSVALGAGSNDGGRSNVVSVGSDTQQRQITNVAAGTEGTDAVN
FT                   VNQLNTLSTSMSQSLSNQQTQLNNLGSQLNQTQQQLQQTDTMARQGIAAVAAMASIPHM
FT                   DRDSNFAMGVGTSSFLGQKAIAVGMQARITENLKASLNGGFAGNQKVIGAGMLYQWK"
FT   gene            complement(629572..632391)
FT                   /locus_tag="BURPS1710b_A0458"
FT   CDS_pept        complement(629572..632391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0458"
FT                   /product="Tash protein PEST motif family"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD5"
FT                   /protein_id="ABA51721.1"
FT                   /translation="MIASVLLAVTWPAATFVIWRSALGAPTLTTPTGALPANVPSVVEP
FT                   TVALLVGTAAAVTEFAPSATEFAVAAVAPVPIATASAPVATLSGPVEFAWKYLMPFALM
FT                   LSIAEPTLVLAVVVPFALYVVYDGAEIVPVAGLYVAPPPSAAAVLLPRLLVVVATVDRP
FT                   VESEPMPVDVEVDSEAIELVAELKPVEVDVDSEATVLLVVDSPVDNELTPLCAVLMPDE
FT                   AEVDSEVSELFVLLSPLDSEATLLLVVDRPVESEPMPVDVEVDSEAIELVAELRPVEVD
FT                   VDSEATVLFAVDSPVDNELTPLCAVLMPDEADVDSEVSELFVLLRPLDSEATLLLVVDR
FT                   PVESEPIPVDVEVDSEAIELVAELRPVEVDVDSEATVLLVVDSPVDNELTPLCAVLMPD
FT                   EAEVDSEVSELFVLLSPLDSEATLLLVVDRPVESEPIPVDVEVDSEAIELVAELRPVEV
FT                   DVDSEATVLFAVDSPVDNELTPLCAVLMPDEADVDSEVSELFVLLRPLDSEATLLLVVD
FT                   RPLESEPIPVEVEVDSEAIELVAELKPVEVDVDSEATVLLVVDSPVDNELTPLCAVLMP
FT                   DEAEVDSEVSELFVLLSPLDSEATLLLVVDRPVESEPMPVDVEVDSEAIELVAELRPVE
FT                   VDVDSEATVLLVVDSPVDNELTPLCAVLMPDEADVDSEVSELFVLLRPLDSEATLLLVV
FT                   DRPVESEPIPVDVEVDSEAIELVAELRPVEVDVDSEATVLLVVDSPVDNELTPLCAVLM
FT                   PDEAEVESEAIELFAELKPVEVDVDSEATVLLVVDSPVDNELTPLCAVLMPDEAEVDSE
FT                   VSELFVLLRPLDSEATLLLVVDSPVESEPMPVDVEVDSEAIELVAELRPVEVDVDSDAI
FT                   ELLADESPVDVEVDKLAIALVVVLMPVLSWATVTASFAAEPSATLVMRRKLVEEPTDTS
FT                   EDGAALPVK"
FT   gene            complement(632404..636066)
FT                   /locus_tag="BURPS1710b_A0460"
FT   CDS_pept        complement(632404..636066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52419"
FT                   /db_xref="GOA:Q3JLD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD4"
FT                   /protein_id="ABA52419.1"
FT                   /translation="MPVATLSGSVEFAWKYLMPFALMLSIAAPTLVLVAVVPFALYVVY
FT                   DGAEIAPVAGSYVAPPPSAAAVLLPRFVVFVVIELMLVDSEPMPVEADVESDARLLLVA
FT                   LMLVDSEPMPVELDVESDARLLLVVSMLVDSEPMPVEADVESDTRLLLVDDRPVDSEPM
FT                   PVEVDVDSEATVLLVVDRPVESEPMPVEVDVDSEATVLLVVDRPVESEPMPVDVEVDSE
FT                   AIELVAELRPVEVEVDSEATVLLVVDRPVESEPIPFDVEVDSEAIELVAELRPVEVDVD
FT                   SEATVLSVVDRPVDSEPMPVDVEVDSEAIELFAELRPVEVDVDSEATVLSVVDRPVESE
FT                   PILVDVEVDSEAIELVAELRPVEVEVDSEATVLLVVDRPVESEPMPVDVEVDSEAIELV
FT                   AELRPVEVEVDSEATLLLVVDRPVESEPMPVDVEVDSEVIELVAELRPVEVDVDSEATV
FT                   LSVVDRPVDSEPMPVDVEVDSEAIELFAELRPVEVDVDSEATVLSVVDRPVESEPMPVD
FT                   VEVDSEAIELVAELRPVEVEVDSEATLLLVVDRPVESEPIPVDVEVDSEAIELFAKFRP
FT                   VEVEVDSEATLLLVVDRPVESEPIPVDVEVDSEAIELFAELRPVEVEVDSEATLLLVVD
FT                   RPVESESILVDVEVDSEAIELFAKFRPVEVEVDSEATLLLVVDRPVESEPIPVDVEVDS
FT                   EAIELFAELRPVEVEVDSEATLLLVVDRPVDSEPIPVDVEVDSEAIELFAELRPVEVDV
FT                   DSEATVLSVVDRPVESEPMPVDVEVDSEAIELFAELRPVEVDVDSEATVLSVVDRPVES
FT                   EPMPVDVEVDSEAIELFAELRPVEVDVDSEATVLFAVDSPVDNELTPLCAVLMPDEADV
FT                   DSEVSELFVLLRPLDSEATLLLVVDRPVESEPIPVDVEVDSEAIELVAELRPVEVDVDS
FT                   DATVLSVVDRPVESEPMPVDVEVDSEAIELVAELKPVEVEVDSEATVLLVVDSPVDNEL
FT                   TPLCAVLMPDEAEVESEVSELFVLLRPLDSEATLLLVVDRPVESEPMPVDVEVDSEAIE
FT                   LFAELRPVEVDVDSEATVLLVVDRPVESEPMPVDVEVDSEAIELVAELRPVEVEVDSEA
FT                   TLLLVVDRPVESEPMPVDVEVDSEVIELVAELRPVEVEVDSEATALSVVDRPVESEPIP
FT                   VDVEVDSEAIELFAELRPVEVEVESEVIELVADDSPVDSDEIELEVESSFDATA"
FT   gene            637240..637725
FT                   /locus_tag="BURPS1710b_A0461"
FT   CDS_pept        637240..637725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0461"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52705"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD3"
FT                   /protein_id="ABA52705.1"
FT                   /translation="MEVTTTAGAAAANVRRRGRPAPPAPRSPRAPAQAASQRRARPIRG
FT                   RRLRIAWRIMMKHIAAMGLATLAALAALAGCSASSGPTYTVTQTSLPGHPDAYRVACGG
FT                   VFGKYDTCTKIAARVCGDRPVDALERSADRRGDGGRGEPSSLTFDCAATRNVAPSDQ"
FT   gene            637908..640043
FT                   /locus_tag="BURPS1710b_A0462"
FT   CDS_pept        637908..640043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0462"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53420"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD2"
FT                   /protein_id="ABA53420.1"
FT                   /translation="MFVAFVTSGVRPAGPRRPHPTPDPARIRSASRRDSIQRSPPTGLG
FT                   PHPVAIVPWAGANRPAPAQPGSDSPAGAACRPFGPAKNCDIVQISKRPAPTASRTVVGR
FT                   SSSLFRTHDMSVHSDRFAAIQMQLKQGDLIAAADAIDAWRAAEPASADALACRAHWLRL
FT                   LGRFDEAAAALEPALAATPPCAAAWAERARLDRLAGQAERAHAAFDAAHRADPAATAWL
FT                   AEWIELLHPLHRPALALPVAQALCEHAPDSAQSWFLLGLTHHYAGDYAAAAAAYRRADA
FT                   LDPAYPMLRNNLAALRYQTGMTAEALALAEAAIRAEPDNQMAWCNCSNAWLALREPARA
FT                   LIAGERACALGPNYAIAQLARANALKELQRWPDALAAAAHAHRSAPDDPVMQWSLAMLQ
FT                   LLHGDYANGWANHEARWNGSRELGDRPRPSPQQQWRGEPLAGKTLMLWGEQGFGDALQF
FT                   ARFAPIIAEQATRAGAQVVFACFAGLEPLFARSFAGAPMRIVRHDAPQLPAFDHHLPVG
FT                   SAPLLLGVRPDTIPAAGGYLRADPARAAQWAARRPADGRLRVGLVWSGSRTHQRNPLRA
FT                   IDPAACARAWRDLTGVAFHSLQIDGAADVATMRAAGLDVIDHTAELPSFDDTAAYLSSL
FT                   DLVVTVCTSVAHLAGALGRPTRLLLDVNPHWVWMIDREDSPWYGSLRLYRQPRYRDWTT
FT                   VLDRVRDELAALAAARA"
FT   gene            640898..645748
FT                   /gene="emaA"
FT                   /locus_tag="BURPS1710b_A0463"
FT   CDS_pept        640898..645748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emaA"
FT                   /locus_tag="BURPS1710b_A0463"
FT                   /product="putative membrane-anchored cell surface protein"
FT                   /note="identified by match to protein family HMM PF03895;
FT                   match to protein family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52218"
FT                   /db_xref="GOA:Q3JLD1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD1"
FT                   /protein_id="ABA52218.1"
FT                   /translation="MNKIYKTIWCETTRSWVAVSEHANGKRGGATAAATTSARPIWTRL
FT                   RGISLAALAAFGLGLFASPAAFAQSNSVMCANYNNGILPTYTGYGASPSLTSPCTTGIG
FT                   SWAGGVTPGSTTNWIGLSADDTQIVLNGSTGNIYFRAGGTNGNTLTMSNVAGSGPTGGV
FT                   LLSGVAAGAVTATSSQAINGSQLYSLSTSASTGIGSLSSSMSTFNSSISSLSTGLSSTN
FT                   SGLTSLSTSASTGLSSANSSIASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNSLSTG
FT                   LSTTNSTVASLSTSTSTGIGSLSTGLSSTNSSLTSLSTSASSGISSANSSVASLSTSTS
FT                   TGIGSLSTGLSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTTNSTVASLSTSTSTG
FT                   IGSLSTGLSSTNSSLTSLSTSASSGISSANSSVASLSTSTSTGIGSLSTGLSSTNSSLT
FT                   SLSTSASSGISSANSSVASLSTSTSTGIGSLSTGLSTTNSNLTSLSTSTSTGLSSANSS
FT                   ITSLSSGLSTTNSNVASLSTGLSSTNSSLTSLSTSTSSGISSANSSVASLSTSTSTGIG
FT                   SLSTGLSTTNSNLTSLSTSTSTGLSSATSSIASLSTSTSTGISSLSTGLSTTDSNLTSL
FT                   STSTSTGLSSATSSIASLSTSTSTGISSLSTGLSTTDSNLTSLSTSTSTGLSSATSSIA
FT                   SLSTSTSTGISSLSTGLSTTNSSLTSLSTSASSGISSANSSVASLSTSTSTGIGSLSTG
FT                   LSTTNSSLTSLSTSTSTGLSSANSSITSLSSGLSTTNSNVASLSTGLSSTNSSLTSLST
FT                   SASSGISSANSSVASLSTSTSTGISSLSTGLSTTNSNLTSLSTSTSTGLSSANSSITSL
FT                   SSGLSTTNSNVASLSTGLSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTTNSTVAS
FT                   LSTSTSTGIGSLSTGLSTIDSNLASLSTSTSTGLSSATSSIASLSTSTSTGISSLSTGL
FT                   STTDSNLASLSTSTSTGLSSANSSITSLSSGLSTTNSNVASLSTGLSSTNSSLTSLSTS
FT                   ASSGISSANSSVASLSTSTSTGIGSLSTGLSTTNSNLTSLSTSTSTGLSSANSSITSLS
FT                   SGLSTTNSNVASLSTGLSTTNSSLTSLSTSASSGISSANSSVASLSTSTSTGIGSLSTG
FT                   LSTTNSNLTSLSTSTSTGLSSANSSITSLSSGLSTTNSNVDSLSTGLSTTNSSVASLST
FT                   GLSTTDSNLASLSTSTSTGLSSTTSSIASLSTSTSTSFSSALSSIGSLSTGLATTNSNL
FT                   ASLSTSTLTSVSSLSTGLSATNSSVASLSTSASTGLAATNSTVASLSTSTSTAVGSLST
FT                   GLSTTNSNVASLSTSTSTAVGSLSTSLSTTNSNVASLSTSTSTSVNSLSTGLSTTNTSV
FT                   ASLSTSVTNLNTQLTSLSTTIVNSTNNVIRALPASTGIAADMSAPNAAAPSVTAGSNSV
FT                   ALGANSTDGGRSNVVSVGSATQQRQITNVAAGTEGTDAVNVNQLNALSTSMSQSLAGQQ
FT                   GQINNLGSQLTQTQQALQQTDTMARQGIAAATALTMLPQVEPGKTINVAVGVARFAGQS
FT                   GMAFGASAHVTTNGILKLGIGVSGQNKTFGAGYGYSW"
FT   gene            complement(641455..645360)
FT                   /locus_tag="BURPS1710b_A0464"
FT   CDS_pept        complement(641455..645360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0464"
FT                   /product="gene 11-1 protein precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLD0"
FT                   /protein_id="ABA51587.1"
FT                   /translation="MICRCCVALPTETTFERPPSVEFAPSATEFEPAVTDGAAAFGALM
FT                   SAAMPVLAGSARITLFVLLTIVVDSDVSCVLRLVTLVDSDATLVFVVDRPVDSEFTLVE
FT                   VDVDSDATLLLVVDKLVDSEPTAVEVDVDSEATLLLVVDRPVDSEPTAVEVDVDSEATV
FT                   LLVAARPVEADVDSDATLLLVALRPVDSELTEVSVDVDSDARLLLVVARPVDSEPIELS
FT                   ADEKLVEVDVESEAIELVVDERPVDVEVDSEARLLSVVLRPVESDATLLLVVLKPVDSE
FT                   STLLLVVLSPLEREVIELLADESPVDVEVDSDVRLLLVVLRPVESEPMPVEVDVDSEAT
FT                   ELLAELMPDEADVESEVSELLVVLKPVDSEATLLLVVLSPLEREVIELLADESPVDVEV
FT                   DSDVRLLLVVLKPVESEPIPVEVDVDSEATELLAELMPDEADVESEVSELFVLLKPVDS
FT                   EATLLLVVLSPLEREVIELLADERPVDVEVDSEARLLSVVLKPVDSELMPVEVDVDNEA
FT                   IELVADERPVDVEVDSEARLLSMVLKPVDSEPMPVEVDVDNEATVLLVVDSPVDSELTP
FT                   LCAVLMPEEADVESEVNELFVLLRPVDSEATLLLVVLSPLEREVIELLADESPVDVEVD
FT                   SDVRLLLVVLRPVDSELMPVEVDVDSEATELLAELMPDEADVESEVSELLVLLRPVDSE
FT                   ATLLLVVLSPLEREVIELLADERPVDVEVDSDVRLLLVVLRPVESEPMPVEVDVDSEAT
FT                   ELLAELMPDEADVESEVSELLVVLKPVDSELMPVEVDVDSEAIELVADERPVDVEVDSD
FT                   VRLLSVVLKPVDNELMPVEVDVDSEAIELVADERPVDVEVDSDVRLLSVVLKPVDNELM
FT                   PVEVDVDSEAIELVADERPVEVEVDSDVRLLLVVLRPVESEPMPVEVDVDNEATELLAE
FT                   LMPDEVDVESEVNELFVLLRPVDSEATLLLVVLSPLEREVIELLADESPVDVEVDSDVR
FT                   LLLVVLRPVESEPMPVEVDVDSEATELLAELMPDEADVESEVSELLVLLRPVESEPMPV
FT                   EVDVDSEATELLAELMPDEADVESEVNELFVLLRPVESEPMPVEVDVDNEATVLLVVDS
FT                   PVDSELTPLCAVLMPEEADVESEVSELLVLLRPVESEPMPVEVDVDSEATELLAELMPD
FT                   EADVESEVNELFVLLRPVESEPMPVEVDVDNEATVLLVVDSPVDSELTPLCAVLMPEEA
FT                   DVESEVSELFVLLSPLDSEAIELFADDRPVDAEVESEVRPLFVDDSPVDSDEIELLNVD
FT                   MLLDNEPMPVDAEVDSE"
FT   gene            645745..646899
FT                   /locus_tag="BURPS1710b_A0465"
FT   CDS_pept        645745..646899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53112"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC9"
FT                   /protein_id="ABA53112.1"
FT                   /translation="MIDSIRSSSTGPRDAPGKRLAVGISLFARDGQAIWENGIHQNIAF
FT                   LAMMLKQSDRIGPVYFLNGGDAKALPAGLDLGGLDVPLVQPRDVSHALDVVIEMGAQLP
FT                   VDWLKHMKALGKKLVVCFVGHTYSGLTETPMFNRPSGHIFNGGPFDEVWILPKSEKIDA
FT                   PLLRTLTRAPVHVVPHIWSPYFIERRARELEAAGLRFGYAPGRAKWRLSILEPNISVVK
FT                   TCHYPMLAADEFHRAQPDAVEHLFVVNSLHMKEHPTFVHFANSLDLVREHKATFEPRID
FT                   LPSFLAQHGDAVISHQWENPQNYLYYDVLYGGYPLVHNSPMLGDAGYYYPEFDSAAGSR
FT                   ALQHAWRHHDAHLDDYRRHADALLQGVSIDNRRNLDAYVARLFA"
FT   gene            646921..648069
FT                   /locus_tag="BURPS1710b_A0466"
FT   CDS_pept        646921..648069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52572"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC8"
FT                   /protein_id="ABA52572.1"
FT                   /translation="MSETTARDVPNGGKRLVVGVSLFVRGAGQSLWENGIFQNCLLLVL
FT                   LLRQSPLVAEAVMVNGGTSDADPQLMLGEWNVPLVSMDEAMTRCDVLIEMSAQFNAGWL
FT                   AEYQRRGGKVVTMRVGNDYVIDIERAIFDKPSGFLFSGARYDGVWTIPEFENSCGHYLE
FT                   SGLRSPVTIVPHIWHPLLFDKARATLGPGLEFGYKPGRPRWRVTMFEPNICMVKTSIVP
FT                   MLVAEEAYRAQPDFVEFVRVCNTLHMKEHTTFVHFARSLDIVDHGLTTFEGRFAVYEFM
FT                   AAYGDAVVSHTWENAQNYLYYELLYGDYPLVHNSPYLGRAGYFYPDFDCQEGGRQLLKA
FT                   FREHDANLDAYREQSRHVLDSVSIYNAQNVAAYTEAIAALYR"
FT   gene            complement(648415..649557)
FT                   /locus_tag="BURPS1710b_A0467"
FT   CDS_pept        complement(648415..649557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51987"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC7"
FT                   /protein_id="ABA51987.1"
FT                   /translation="MTPPVDLNGLRIGITIGLREPNESLWINGIKQNALFLAKLLMKSS
FT                   RGYRVTIVNTTDVPITDALPWDRRIFDTRSFVDVKDSLDVLIELGGQIDGEQTAYLKAR
FT                   GVKLVSYCCGFEYIHATQSILFGRRMWDTLFINRGYDEIWAIPQIAPSSLPFLQSLRRS
FT                   PGRVVPFVWDPMFLGERTRLLPERGEYRPSGKRAKRLTVMEPNHDVVKFCVYPMLIIDE
FT                   AYRREPDAIAFAHVTNAERLAHDSPEFVMLMNYLEIVRASKASFVGRFDTPTFLAEHTD
FT                   VVVSHQWENPLNYFYFDVCWQGYPLVHNAHLVPDIGYYYPDNDVQTGAEVLMRVLREHD
FT                   DDWEGYAARQRSLLRRYTSKNPTLVAEYDTLLANLVNDRR"
FT   gene            complement(649698..651698)
FT                   /gene="accA"
FT                   /locus_tag="BURPS1710b_A0468"
FT   CDS_pept        complement(649698..651698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="BURPS1710b_A0468"
FT                   /product="biotin carboxylase subunit of acetyl-CoA
FT                   carboxylase"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02785; match to protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52536"
FT                   /db_xref="GOA:Q3JLC6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC6"
FT                   /protein_id="ABA52536.1"
FT                   /translation="MFDKILIANRGEIACRVAATCRRLGIASVAVYSDADAHAKHVAAC
FT                   DEAVHIGGAAAADSYLRIERIIDAARATGAQAIHPGYGFLSENEDFARACEDAGIVFVG
FT                   PPVEAIAAMGSKAAAKALMHAAAVPLVPGYHGDDQSPELLQREADRIGYPVLLKASAGG
FT                   GGKGMRVVERAADFAAALASCQREAAASFGNDRVLIEKYLQRPRHVEVQVFGDTYGNAV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLADALRQAMGEAAVAAARAVGYVGAGTVEFIMTGD
FT                   AFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLRQPELHVRGHAIEARLYA
FT                   EHPARGFLPSTGRLKHLRFPAGAEFAAGAAVRIDSGVREGDAITPFYDPMIAKLIVHAD
FT                   TRAQALATLGRALRECEVVGLHTNAEFLQRIVASRPFADADLDTGLIERHRDALFAPRP
FT                   APAAALGLACAALFAREQAGAGAGGVASPWAALPNWRLNAGYRRTIEWRALDDDTALEV
FT                   RYLEHGGAQSLEIGGVAQPFAWSRGAGPLDFDVTLGGVRASGRVHVDGDTFHVFCQGVA
FT                   RAFEWRNLLAHAADSTEGEGRLTAPMPGKVIAVLVEPGRKVEQGDPLIVMEAMKMEHTI
FT                   GAPAAGVVAEVLYAVGDQVADGAQLLVMGPA"
FT   gene            complement(651859..652644)
FT                   /locus_tag="BURPS1710b_A0469"
FT   CDS_pept        complement(651859..652644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0469"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /EC_number="4.2.1.17"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53654"
FT                   /db_xref="GOA:Q3JLC5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC5"
FT                   /protein_id="ABA53654.1"
FT                   /translation="MRYETIEVTDDGRVATVTLARPDVRNAFNETMIAELTTAFDRIDA
FT                   QPSLRAVVLAARGPAFCAGADLNWMKKMAGFSDDENRADARRLARMLDAIYRCAKPVIA
FT                   RVHGDAYAGGVGLVAACDIALAAEDVKFCLSEARLGLIPATIAPYVVRAMGERAARRYF
FT                   ATAEAFDCAKAAQLGFVHERVPADALDASVAKLADALCANGPQAVRACKALVRDVAGRA
FT                   LDAALIEQTADWIAKARAGAEAREGVASFLEKRTPSWRA"
FT   gene            complement(652665..654272)
FT                   /gene="accB"
FT                   /locus_tag="BURPS1710b_A0470"
FT   CDS_pept        complement(652665..654272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="BURPS1710b_A0470"
FT                   /product="carboxyl transferase domain protein"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51622"
FT                   /db_xref="GOA:Q3JLC4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC4"
FT                   /protein_id="ABA51622.1"
FT                   /translation="MPIIESKLNPRSDEFRANAAALEALVADLREKIDRLALGGGQAAR
FT                   DKHLSRGKLLPRDRIAQLLDPGTPFLELSQLAAYGMYNDDAPGAGLITGIGRIAGRECV
FT                   IVCNDATVKGGTYYPVTVKKHVRAQEIAAENRLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFFNQANLSAAGIAQIAVVMGSCTAGGAYVPAMSDESIIVRNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVADHLAQNDAHALAIARAIVGNLGARGGAAPAMREPLP
FT                   PRYDARSVYGVIPVDTRKPFDVREVIARIVDDSAFDEFKARYGTTLVTGFAHIWGQPVG
FT                   IVANNGILFSESATKGAHFIELCCQRKIALVFLQNITGFMVGRKYENEGIARHGAKMVT
FT                   AVSTAKVPKFTVIIGGSFGAGNYGMCGRAFGPRFLWMWPNARISVMGGEQAASVLATVR
FT                   REGIEAKGGEWSAQDEEAFKQPIRDQYERQGHPYYASARLWDDGVIDPAQTRDVLGLAL
FT                   AAARNAPIEDTRFGVFRM"
FT   gene            complement(654295..655476)
FT                   /locus_tag="BURPS1710b_A0471"
FT   CDS_pept        complement(654295..655476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0471"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52291"
FT                   /db_xref="GOA:Q3JLC3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC3"
FT                   /protein_id="ABA52291.1"
FT                   /translation="MSNLPGVNFMLGEDIEMLRDSIAHFAAKEIAPRAAEIDRTDQFPM
FT                   DLWRKFGELGVLGMTVAEEYGGANLGYTAHMVAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTDAQKRRYLPKLISGEHIGALAMSEPNAGSDVVGMKLRAEPRGARYVLNGTKMWI
FT                   TNGPDCDTLVVYAKTEPEAGARGITAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFED
FT                   VEVPEENILGELNGGVKVLMSGLDYERAVLAGGPTGIMAACLDAVVPYVHDRKQFGQPI
FT                   GEFQLIQGKIADMYTTFQACRAYLYAVGRHLDAGGSAHPRQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEYPVGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETA"
FT   gene            655684..656448
FT                   /locus_tag="BURPS1710b_A0472"
FT   CDS_pept        655684..656448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0472"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53333"
FT                   /db_xref="GOA:Q3JLC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC2"
FT                   /protein_id="ABA53333.1"
FT                   /translation="MTATQKADRADAPRAPAGRKSQQRVQDILRAGREVFAEKGYEHAT
FT                   AAEIAQRVGVSEATVFSYFRGKRELCARVIADWYDEIVDAFETGMPRDGSVRQQFAFVV
FT                   RTHLRLMLVNGTGLCALVLSEGRAKQHALADELTALQRRYTAPLMDVLARGQATGQVRA
FT                   DMPLSLLRSMVFGPIEHVLWDAILGHRKLDTETTAEQLIDLLWTGLQPPAPENAALVRF
FT                   RSDVADAMRRLDQACGRAPRKAAAGRDAQKPA"
FT   gene            complement(656568..656894)
FT                   /locus_tag="BURPS1710b_A0473"
FT   CDS_pept        complement(656568..656894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51444"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC1"
FT                   /protein_id="ABA51444.1"
FT                   /translation="MVDAPTAVRALAAFFGRGAIGMRATRVFPGARGRILRAMSDERRI
FT                   LQAQVRLAFDNLNACLSAAGSTFDDVVDVTIVVVDPPSISTRSGRARPATGATRRIRRR
FT                   PASA"
FT   gene            657388..659439
FT                   /gene="norB"
FT                   /locus_tag="BURPS1710b_A0474"
FT   CDS_pept        657388..659439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="BURPS1710b_A0474"
FT                   /product="nitric oxide reductase"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53057"
FT                   /db_xref="GOA:Q3JLC0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLC0"
FT                   /protein_id="ABA53057.1"
FT                   /translation="MDTSETVLRRRQDDRVSDVLKWTLLVVAVLTFALLAWATVVTYRS
FT                   APPQPARLVAPDGSVVMTARDITDGKASFQRADLMDYGSIYGMGSYFGEDYTAEYLLRL
FT                   GQLTNDNIALSRFGQPFAALDQDSRNSVQAAMRQQLKGIDLSRTDALVPAEVARAIRSL
FT                   RVEISRALTHHDFIKGWTQAYSLDERHAAKTADFLLYAALTTVARRPGSDVSWTQNWPY
FT                   EPLVGNAPTTNTFGWTWASYCFTFLCFGIVLFVYHRYIRVDDLGTMDPTLVRFRALTRS
FT                   QRKVGKYFLVVAAVLLLQIAAGAILGHYYTDRTSFYGIHFDDVLPFNFWRSIHIQAPIV
FT                   WIGLSWIGAGLFLAPAISGREARGQGPLVDGLFWATVVIVAGALIGDYLGIMGVIENGW
FT                   FWFGNQGLSYLELGRFWQIGFFIGLVFWSALILRGLWPGLAAIKQAARQFWTGRIRLEH
FT                   LIWASTTNIALLYAFGMIPLFGVNPSFTITDFWRWWVVHLWVEQSFEFFAAAISAYLLM
FT                   GLGLVSRQLAERSVYLELILIFLGGVLGTGHHIYWCRRPRHVGSRRQHVLVHRGAAARA
FT                   AHPRRDGAPQPDPETAAVPLRSRVHVCAGLRVLELRRSGRVRRRHAQRAARQLLRARHL
FT                   PHAEPRAHVAVRRVRPARDRIDLFLPAACRRRAIEIQRETRPPGVLAV"
FT   gene            659060..659176
FT                   /gene="norB"
FT                   /locus_tag="BURPS1710b_A0475"
FT   CDS_pept        659060..659176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="BURPS1710b_A0475"
FT                   /product="nitric oxide reductase"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51827"
FT                   /db_xref="GOA:Q3JLB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB9"
FT                   /protein_id="ABA51827.1"
FT                   /translation="MWVPVGSMFSFIEVLPLVLLILDAMEHHSLIRKQQRFR"
FT   gene            659234..659710
FT                   /gene="norB"
FT                   /locus_tag="BURPS1710b_A0476"
FT   CDS_pept        659234..659710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="BURPS1710b_A0476"
FT                   /product="nitric oxide reductase"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53658"
FT                   /db_xref="GOA:Q3JLB8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB8"
FT                   /protein_id="ABA53658.1"
FT                   /translation="MFGGGTLNAPLVNYYEHGTFLTLNHAHTSLFGAFGLLAIGLIYFC
FT                   LRHAAAEQSRFSEKLGLRAFWLYNAGLVLWIALNFFPVGWPQLNAVYDRGLAYARSLEF
FT                   YDTTVLWQWLRFVGDVPFAIAALLMAFDFVLKLAPLFPAVVNRMSRQHGEKRSP"
FT   gene            659851..661314
FT                   /gene="aniA"
FT                   /locus_tag="BURPS1710b_A0477"
FT   CDS_pept        659851..661314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aniA"
FT                   /locus_tag="BURPS1710b_A0477"
FT                   /product="mulitcopper oxidase domain protein"
FT                   /EC_number="1.7.2.1"
FT                   /note="identified by match to protein family HMM PF00394;
FT                   match to protein family HMM PF07731; match to protein
FT                   family HMM PF07732"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53560"
FT                   /db_xref="GOA:Q3JLB7"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB7"
FT                   /protein_id="ABA53560.1"
FT                   /translation="MNSAVDPSPLSRAAQALALASIGGALALGACTSRPSGERYAPSRM
FT                   DFNPGPAIVTQTRHTGPFASGSALSFDAALQPLDAARDQAIRLDTTHTVIRIAPGIAFA
FT                   AWTFGNQVPGPTVHVKVGDRVRLSMTNRSDEPAPGGLQLTAPMMHSMDFHAAMVSPTDK
FT                   YRSIAPGQTMHFEFTPNYPGVFMYRCGTPMVLEHIASGMYGVVVVAPRDGYPTRADREY
FT                   VIVQSEFYTKPDPQHRSVGTDALHVLDGERLRRKAPTYTVFNGRYNGMVTQPLIAKPGE
FT                   RVRLYVLNAGPSDTSSFHVVGAIFDRVWLDGNPDNQLRGMQTVLLGSSGSAIVAFVVPE
FT                   AGAYVMVDHQFANASQGAVGVIDAGAHEESTIEHHNIPASATPTDAEAIQGKLDFESKC
FT                   LACHTLGHGAKLGPALLGVTQRRSDAWLRRWLASPEAMVASDADARALRAHYPITMPDQ
FT                   NLSDSEIRRYVRYFHWADEASKQRDHAMP"
FT   gene            661707..661820
FT                   /locus_tag="BURPS1710b_A0478"
FT   CDS_pept        661707..661820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52003"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB6"
FT                   /protein_id="ABA52003.1"
FT                   /translation="MKTTTLPLSGSSLVVAFLCEGTRKWTTPTQIKNTKDN"
FT   gene            661934..665164
FT                   /gene="nspC"
FT                   /locus_tag="BURPS1710b_A0479"
FT   CDS_pept        661934..665164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nspC"
FT                   /locus_tag="BURPS1710b_A0479"
FT                   /product="iron-sulfur cluster-binding protein, rieske
FT                   family/carboxynorspermidine decarboxylase"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52403"
FT                   /db_xref="GOA:Q3JLB5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB5"
FT                   /protein_id="ABA52403.1"
FT                   /translation="MHAHFDHAAARYAARTGEPLTLDHARAFCAATMLRAVEHPAGTDD
FT                   WHLLCRLDEIPDIGDYVTGYAFQESMTAVRASEHEVRVFLNVCPHRQTQLFQAAGSFDP
FT                   HRHVRCPYHGWTFDVDGRCVNAPGARRCEFGADFREQDFSLSRVPARIEDGGILVRKAV
FT                   SRVGRRMAALYERVYFAFPDVKRPFVPDRFRVLLRIGFLAADIRHARDSSILSALRAEL
FT                   RQHLLTYPDLPVRYASLAKRHGEPTVDAVDAVDAVDAVDAVDAVNAVDAVDAVDLGPRL
FT                   AGGPLRETVATWVYGDAELHALERDTLVLPAWHFVGHVAELRGGERTLTLDVSGERAYV
FT                   CRARDGTIHAGRLVDIDRRTDDPARLRADGALAPIDVDVWQGLIFVRLAAGRGGVADIW
FT                   EHARMLEPYRIGQMAPLAGKGWYDFAVEADAKILWENFLEMYHFPAAHQAMIRLFELSS
FT                   RSDLLTLREPASTRLSPIEARYRDALKRGATHGADEEARQRAMADGDAALARPLQLTVF
FT                   GSIPETAQTATMLGITVFPDHIQAMSFIPVGPRECRVKIRSYGHAAEGALDIARQCNVE
FT                   QLQIELVEEDIQLNHRSQIAASTRSYERRGVLHDMEVSVADFQQLLRRVLPVTRCVRRP
FT                   PVGALARANQALRLRDRDERGAPRRACADAARRARAPAAASAFAAPPPVSRQRNAETLE
FT                   ALDTPAFVYDERTLRDALSSMHTLLGDSGCRLLYPLKPFSHAGALECIGPHVDGFAASS
FT                   PFEAAFSRMLLGRAGSVHLATPALRDRDLGTIVDNCDYVALNSLSQWRRLHDALAGRLS
FT                   CGLRINPQYSVVADARYDPCRPHSKLGVPLDAIERVVASDPRALHGLQGIHFHTNCDST
FT                   DFSRLAETIEHLEKRLARTLDGLAWINLGGGYIADGARYVDRFRACAKRLREHFGVALF
FT                   IEPGAAIVRAAGTIIASVVDLFDSGGMPIAVLDTTVNHYPEVFEYQFQPDVDGHHPAHA
FT                   HAYLLAGASCLAGDVFGTYRFDAPLRVGSRVAFVNAGAYTLVKAHRFNGINLPSVYRRG
FT                   EDGALAAVQRFSYEDFLRQNGGLDHAYP"
FT   gene            665151..666515
FT                   /locus_tag="BURPS1710b_A0480"
FT   CDS_pept        665151..666515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52961"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB4"
FT                   /protein_id="ABA52961.1"
FT                   /translation="MHIHEKAFSVSGPLASASLDHLRELTRQQLGPDETPVRFVVTRSD
FT                   EHGFDCEIGVLSDGEMPESMRADGLFRCERRTRGGGGEFNAVLIVPTGVGAEIGGHDGD
FT                   AGPVAMLLSSICDRLITHPNVVNAADINELPANGLYVEGSVICRLLLGQIGLQPVRANR
FT                   VLAVVGSNECPTFVNAAINAVNAARAAYGLDCPRVLHLDPGIHLTSTYASSGRAAGTVE
FT                   NLDALVALLAEHRDTFDAVAIASHIHVPDACRTGYYAGTLGLVNPWGGVEAMLTHTLST
FT                   LFSVPSAHSPMYEDPRFAVRDYGIVDPRIAPEVVSLTFLQCILKGLRRAPRIVELARAG
FT                   NAAGTLSVSDVSCIVIPHGCVGLPVLAALAQRIPVIAVRENRNVMRNDLRSLPWAPGQL
FT                   RIVDNYWEAAGVLASMRAGLNPDSVRRPLASVDVVRASAARAHGASSIATAANIA"
FT   gene            666517..667308
FT                   /locus_tag="BURPS1710b_A0481"
FT   CDS_pept        666517..667308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0481"
FT                   /product="jmjC domain protein"
FT                   /note="identified by match to protein family HMM PF02373"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51774"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB3"
FT                   /protein_id="ABA51774.1"
FT                   /translation="MNDAAQADFLPIDRRDALSYEAFVEQYALPGKPVVLTGLMRDWEA
FT                   ARVWNFEYFRRRHGHVTIVARRSDDYDRTITLPLADYLDRLDDPDAHFYLKDWVFENDI
FT                   PELRAQYRVPRHFANWATRVPGKWQPKWRWLYIGPASSASHLHVDFLLTSAWNALFVGA
FT                   KRWLAYSPDQARRMYRGAVDAFHPDLERFPGFAHARAHMHVQRPGEIMYMPATWWHAVR
FT                   NEEPSLALSENFINAVNARYFLKPRVIARFLRYADHPLWVK"
FT   gene            complement(667301..667669)
FT                   /locus_tag="BURPS1710b_A0482"
FT   CDS_pept        complement(667301..667669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53164"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB2"
FT                   /protein_id="ABA53164.1"
FT                   /translation="MKNLTSGGSSHGAPGRVDRIRVEICLGANERPTGAPRRTHPRGWA
FT                   TRAPADRARSRGAARAYRRRTQPARGGRDARHVAVAMRAGRRRGGSRRARVAHGRARCP
FT                   RRAAAPIGEPHANGACAT"
FT   gene            667684..668316
FT                   /locus_tag="BURPS1710b_A0483"
FT   CDS_pept        667684..668316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0483"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52117"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB1"
FT                   /protein_id="ABA52117.1"
FT                   /translation="MNVPMLRAAPAALLLAVCAGTQAQPLAGSPSSAATANPAAQAPTR
FT                   SRTPPDARSPALPAGSLASQTLSQHAPPDAKPQYTAPLQRNFAFAQDQSRQEECDELAA
FT                   TIDNLARHTQAATRSAPPALLAPSTANSQTPWKIPAPPVYEPPPSRPPPSANGHARPNY
FT                   APLPFDYRSRPWAQPYPATEQDAKEQRARSAQQIELETRYRQLHCRP"
FT   gene            668457..669470
FT                   /locus_tag="BURPS1710b_A0484"
FT   CDS_pept        668457..669470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52910"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLB0"
FT                   /protein_id="ABA52910.1"
FT                   /translation="MTARQLTPALASRFANLALSHLTREYPNKLTHSLAGPQDVLGPRA
FT                   LHPIFYGSYDWHSCVHGYWLVTRLLDRFPDLPEGPRIVATVDAHFTAGNVAGEAAYLNL
FT                   PHNRGFERPYGWGWLLALSAQLASMKSDAGRRWSATLAPLTDLFVERFAEFLPKATYPL
FT                   RVGTHFNTAFALSLALDFARQTGHAALEALIVDTARRWHLRDANCQAWEPSGDEFLSPA
FT                   LMEAELMRRVLPAAEFLAWFDAFLPSLAAREPATLFTPATVTDRTDGKIAHLDGLNLSR
FT                   AWCQRALARALPDGDPRRAALADAADAHLASALEHVAGDYMGEHWLASFALLALEA"
FT   gene            complement(668820..670547)
FT                   /locus_tag="BURPS1710b_A0485"
FT   CDS_pept        complement(668820..670547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0485"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA9"
FT                   /protein_id="ABA52722.1"
FT                   /translation="MGAAVPQAHGDDDDLQRVSDGGLLRLRELGADAADQAGDHRHDEP
FT                   HVFERDRARRADRAVDRPCDRRPLRAQDGDRRDGGRGDDRGAAVQPRVGRVAARRARRM
FT                   PHAREQHHVVQLPCLSGRAVSDRDSRARGRLRLFVEPLFGDLHVVRDRGRAEGIRHARR
FT                   VRVHRGRDGDRDGVDRADGAAHERRRARSDIALTRARALACAGYRRAGRRAPRNGLEHC
FT                   RAAHVRAARASLALRRLHRSPGSRAAGARRARMRRINRCAWRVREPSCRDAILPPCCPR
FT                   LAPRASRLAPRASRLAPRASRLAPRASRLAPRASRLAPRASRLAPRASRLAPRASRLAP
FT                   RASRLGPPRGAVVHPARRDSSLQRKQRERREPVLAHVVARDMFERARQMRVGRVGERRP
FT                   TRIAVRQRPRERALAPRAAQVQAVEVRDLAVGAVGDGGGREERRRLARGERRQERVEPR
FT                   EKLGRRQHAPHQLRLHQRRRQEFVAARLPRLTVRVAQMPAPRGVDDQRLERRMPGLPSE
FT                   IERERQRERGVEVRADAQRIGCLRQEFGEALDEEIRERRERRRPAAARVGFHRRQLRG"
FT   gene            complement(669959..671377)
FT                   /locus_tag="BURPS1710b_A0486"
FT   CDS_pept        complement(669959..671377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0486"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53472"
FT                   /db_xref="GOA:Q3JLA8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042471"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA8"
FT                   /protein_id="ABA53472.1"
FT                   /translation="MASTQSAPRATVPATTIDAGVISARLDRLPPTRSVWKLVALLSLG
FT                   FFFELYDLLYSGYVAPGLVKGGILSATTRGLFGTTGVASFIAALFAGLFIGTIACGFLA
FT                   DRFGRRAVFTWSLLWYTAANVVMAFQDTAGGLNFWRFVVGLGLGVEMVTIGTYISELVP
FT                   KQIRGRAFACEQAVGFVAVPVVALLAYLLVPHAPFGLDGWRWVVLIGAHGAIFVWWIRR
FT                   QLPESPRWLAQQGRLDEAERVLAALEAKVEAEYGRPLPPPAPAEPIAPRGRFADMWVPP
FT                   YRRRTVMMTIFNVFQTVGFYGFANWVPTLLIKQGITVTTSLMYSSVIALAAPIGPLIGL
FT                   AIADRFERKTVIVAMAGAAMIAGLLFSHASAAWLLVALGVCLTLANNIMSYSFHAYQAE
FT                   LFPTAIRARAVGFVYSWSRFSAIFTSFAIAAVLKGFGTPGVFVFIAGAMAIVMASIGLM
FT                   GPRTKGVALEAISR"
FT   gene            complement(670665..672302)
FT                   /locus_tag="BURPS1710b_A0487"
FT   CDS_pept        complement(670665..672302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51435"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA7"
FT                   /protein_id="ABA51435.1"
FT                   /translation="MRRRARGRARPARHAGFLAGRRSIHRFGNPFRERQRIHQRIRPAD
FT                   RRAGARLAAAPRAAAHAGAGPLLPYRARRSGPPRGRSACGVRDGRRRSRLDVHERRPVR
FT                   RRRELPRVPAQGGRDRRSAASRDRRSGHGQGGRHLRADARRSRERRDRSRIRRVFAAAA
FT                   EDLRGHGGVVPADAARVRRTRLSPLRMEVRQPERAVARGGASLRLHVRGAVPAGGRLQG
FT                   ALARHRVVFDRRRRMAGAALGVRAVARGREFRRARPSAAVAVDVDRGGARALTRDARRG
FT                   ARPVKCPNPGGHARPPSDDNDIRRHFGHGFNAKRAARNGAGDDDRRRRHLGAPRSPAAH
FT                   AQRLETRRAAESRLLLRALRSAVQRLRRARPREGRHPERDDARAVRHDGRRELHRRAVR
FT                   GALHRHDRVRLSRRPLRPPRGVYVVAAVVHGRERRDGVPGYRRGPQFLALRRRAGARRR
FT                   NGDDRHIYLGVGPETDSRPRVRVRAGGRLRRGARGGAARVSAGAACAVRPRRLALGRAD
FT                   RRARRDLRLVDSPPVAGKPALARAAGPA"
FT   gene            complement(671480..672262)
FT                   /locus_tag="BURPS1710b_A0488"
FT   CDS_pept        complement(671480..672262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0488"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51991"
FT                   /db_xref="GOA:Q3JLA6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA6"
FT                   /protein_id="ABA51991.1"
FT                   /translation="MRAFSPAGAPFIVSGILFVSDNAYTNAFGQPIGAPVPGWQPRPAP
FT                   PRTPAQGRFCRIEPVDPGRHADDLHAAYATAADGRDWTYMSAGPFADAESYRAYLRKAA
FT                   ETDDPLHHAIVDLATGKAVGTFALMRADRANGAIEVGFVVYSPLLQKTCAGTEALFLLM
FT                   RRVFDELGYRRFEWKCDSLNAPSRAAALRYGFTYEGLFRQAVVYKGRSRDTAWYSIVDG
FT                   EWPALRSAFEQWLAAGNFDAHGRQRQSLSTLIAAARGR"
FT   gene            complement(672876..675044)
FT                   /locus_tag="BURPS1710b_A0489"
FT   CDS_pept        complement(672876..675044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0489"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53073"
FT                   /db_xref="GOA:Q3JLA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA5"
FT                   /protein_id="ABA53073.1"
FT                   /translation="MRDLSCSDRWVLQCARYLKRSLRTRRFFFMFASGSRGRVAPRHSP
FT                   GHAHESASRRRRSVARRGRPRPDREGRASDRLRREPRARAAARRGRALRSDPARSAAAR
FT                   RAWARFPARAARGRLDGARHHPDRARSGREPDRGAERRRRRLSDQAVRPVRVVRARERG
FT                   RAPLFGQSESAREARRARGRHRRAQRDARRRAGRPDRERMGAARNADPASGDDPVEAAA
FT                   RGAAVFVQRRSRQQYDRSACEPPAQEARRRADRDRARPRLSPEAGLAMLRSLQGRLSAA
FT                   LVAGLVALSAAGGAAAFYVLRAEVEQMSDSALQETAQRLLPLAVMDIVGRDSDGDDGDG
FT                   GGGRIAAVRPHDELLTYIVRDETGKLLLRSHDANARLFPKNLKAGFARTATHRVYAETV
FT                   LQGTVTLLIAEPLATRRRAEVQAAFAVVRPLALFLPVGLLGIWLIVRSGLTPIRRFCGA
FT                   IAARGRNDLTPLDKGGLPAEIAPVADAVTELMARLDRALAAERSFTANSAHELRTPIAA
FT                   ALAQTQRLIAEAPAEPLRERARRVEGALHTLSRVSEQLMQLAKAEDGRVLADTPQDLRP
FT                   VLALVVDDFRRGARDRAIALELPDTAVTSRIDPDAFAIVVRNLVENALKHGAAAEPVRV
FT                   ALSAAGALSVTNRGPVLAAAELERLTKPFERGATAAKGSGLGLAIVDAIAKGAGASFTL
FT                   RSPAPGVTDGVQARVDGLACGGGPAAKG"
FT   gene            complement(674240..674899)
FT                   /locus_tag="BURPS1710b_A0490"
FT   CDS_pept        complement(674240..674899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0490"
FT                   /product="two component response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53600"
FT                   /db_xref="GOA:Q3JLA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA4"
FT                   /protein_id="ABA53600.1"
FT                   /translation="MRVLLVEDDPWLGEAVRAQIEKDGHPTDCVASLAHARRHVAVAPY
FT                   DLILLDLLLPDGRGLDFLRELRAGGSTVPVIILTALDQVANRIAGLNAGADDYLIKPFD
FT                   LSELSARVSAVARRYSGNPNPLVKLGELAVDIAARSVTRAGARVDLTASEWALLETLIQ
FT                   HPGMILSKPQLEERLYSFSDEVGSNTIEVHVSRLRKKLGAELIETVRGLGYRLRRD"
FT   gene            675044..675487
FT                   /locus_tag="BURPS1710b_A0491"
FT   CDS_pept        675044..675487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53287"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA3"
FT                   /protein_id="ABA53287.1"
FT                   /translation="MKTSRLIKAVALAALASLVLGGALGIRAAMADDGDDCRAPLADWK
FT                   PRDAVRALAQQKSWRVDKLKADDGCYEIKGHDADGKRFKAKLDPVTLDVVRMKREGERK
FT                   RDHDDDDDHGRAPDARAPAGGPPAGAPPGGVLKPGSKPDVQIR"
FT   gene            675915..676748
FT                   /locus_tag="BURPS1710b_A0492"
FT   CDS_pept        675915..676748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0492"
FT                   /product="Tat (twin-arginine translocation) pathway signal
FT                   sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51267"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA2"
FT                   /protein_id="ABA51267.1"
FT                   /translation="MAGAARAGGSIDCRLPTSGRPRSAHSARPRMLGSESSVARRHAAA
FT                   KGRDSNAYIADRHRDTWPGMRGTGARDAGRTPGCGVRCRRTPTQRPPGRPTAGPPGDAR
FT                   PRLVAARAAALTQTRRTQMKHALPIAALAGALAAPSLAHARQVTFETQLADYGGDGAYV
FT                   VLYVTDRAGRYQGTLWMAGRQTKYYRHLRDWYRATGGSARLDGITGASVGAGRTLRATL
FT                   DVADALLDAGYEIHIDTAVEDMNENASEVVVPLNAAGAGKAVKGRGYVKSFRYSL"
FT   gene            676770..679109
FT                   /locus_tag="BURPS1710b_A0493"
FT   CDS_pept        676770..679109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0493"
FT                   /product="sulfite reductase (NADPH) flavoprotein
FT                   alpha-component"
FT                   /EC_number="1.8.1.2"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00258; match to protein
FT                   family HMM PF00970; match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53091"
FT                   /db_xref="GOA:Q3JLA1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA1"
FT                   /protein_id="ABA53091.1"
FT                   /translation="MLRQLHSIPGLIAAALLIVVTLTGAALSIQPALERAAVAGPPRAP
FT                   LDVATLAGRVSAQVPGVEKLVRRPSGEIVAYYAGTDGPRASIVDPSTGAPLADYRPSPV
FT                   VRWLTNLHRKFLLGDAGRIATGVTAAAMLFIALSGLALLAHRMGGWRRLAGPIRGDGLQ
FT                   RLHNETARVALAGLVLSALTGLVLSLSTFGVIPERGAASALALDARPGIAAAAKAPIPI
FT                   AQMAALRATDWSTLRQLSFPAPDEPRGLIELKTTDGAGFVDPATGAALAYQPADGWQRL
FT                   HALVKMLHTGEGLWWLGLVLGASSLATPLLAVTGVMLWARRRRAQPKRAGDAPARDADT
FT                   VLLVGSEGNSTWGFASALQAALAQAGRRVHVAPMNDGARGYPAARHVLVLSATYGDGDA
FT                   PGNAQSFLPKLARLSAGQGASFAVLGFGDRQFPRFCGYARSVHDALVAKGLTPLLDLGT
FT                   VDRQSEPEFRAWCARLGDALGLALDVRHAPTLPRTMPLTLVERDDYGGDPRAMTSVLRF
FT                   APAGRDGRTGRADRAGRDEHDERDGRERRQEREERLEDAGRRAAWWTAFARRRLPSFET
FT                   GDLLGVVPPGEASPRYYSLASASSDGIVEICVRRHPHGVCSRYLTGLQPGDTIEAFVRP
FT                   HARLRPHAGAAPVILIGAGTGIGPLIGFIRHNAARRPMHLYFGARNANDGFPYRDELDG
FT                   LVRDRRLRALTTAFSRAERGAYVQDRLVADARNLRELVAHGAQIMVCGGRAMADGVARA
FT                   WERILADSGSSVAQLKQQGRYVEDVY"
FT   gene            679090..680274
FT                   /locus_tag="BURPS1710b_A0494"
FT   CDS_pept        679090..680274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0494"
FT                   /product="ApbE family protein"
FT                   /note="identified by match to protein family HMM PF02424"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53694"
FT                   /db_xref="GOA:Q3JLA0"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JLA0"
FT                   /protein_id="ABA53694.1"
FT                   /translation="MSKTSIEWSPGARLNRCRASGATMGTRYGAQFYAPPTADARAIAA
FT                   ALDAAVRAVDAQMSNWKADSDLSRLNRATPGSWTPICANLAAVLVRAREIGRETDNAFN
FT                   IGVGTLVDRWGFGPGAAANRQADNEWAANRQAAGRHTVDRRTVDRHTADRHTADRQTKD
FT                   GRTPDRQPARPADPANGLSGAIDARRRASILRGPVPSPCRPIDELLEVDVARGRARRLA
FT                   DVAFDLCGIAKGFGVDELARVLDRHGIGAWLVGIDGELRARGCKPDGSPWAIALEAPDY
FT                   GRRGAMGAIDLVDAAVATSGDYRHWADFGGERLSHTMDPRAGAPLRGDIASVTVVAPTC
FT                   TDADAYATALMVLGAQAGCAHAERHGLDALFVVRDGDALRTIGCGAFADAGPAG"
FT   gene            complement(680289..681896)
FT                   /locus_tag="BURPS1710b_A0495"
FT   CDS_pept        complement(680289..681896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0495"
FT                   /product="piperideine-6-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53553"
FT                   /db_xref="GOA:Q3JL99"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL99"
FT                   /protein_id="ABA53553.1"
FT                   /translation="MRLHAARERGPIDSFAAATPHRSTRFCSEEEAMQFNDILAALDVD
FT                   LSRWQGRALTARSPVDGATLATLAADAPADAERKIDAAHQAFLKWRTVPAPVRGELVRV
FT                   FGNVLREHKAALGRLVTLEAGKIASEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPG
FT                   HRMMETWHPLGVCGVISAFNFPVAVWSWNAALAFVCGDPVVWKPSEKTPLTAIACHTLF
FT                   AKAVREFDKTHPGVVPEGLHQLVLGGRDVGEALCASPKVPLVSATGSVRMGIEVAQVLS
FT                   RRLARSILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSVADQL
FT                   LPRLEKAFASVKVGDPLEAGTLVGPLIDRASFDAMQKALGDAREQGGEVKGGERVELGR
FT                   ADAYYVRPALVRMPRQTAVVTRETFAPILYVLVYDDFDEALAIHNGVPQGLSSAIFTND
FT                   MREAERFMSAAGSDCGIVNVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKSYMRRATN
FT                   TINYSRELPLAQGVKFDV"
FT   gene            681827..684379
FT                   /locus_tag="BURPS1710b_A0497"
FT   CDS_pept        681827..684379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52708"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL98"
FT                   /protein_id="ABA52708.1"
FT                   /translation="MIGAASPPRMNRLDRVRAPHASAPAIRPIGGLACPARGAPAARAS
FT                   RASRALAARRERRAQPAHALENLRFARRGERQPQAARIRVARVERRARHVHHVVLERAL
FT                   EHLGRVAAAAEARPHEHAARRLAPFDIVRHELRERAHERAATAAVSLRDRAQMRGKPAA
FT                   RQVAADRFLRDRRGAQIARLLRHGHPAQNRGGRDRPADPQARRDDFRQAAEIDGPVRRA
FT                   VMREHGLHGLAGETQVRVRIVLDEHEPRVGRDCREPRAARRRQRRAGRIRERRHRIQQL
FT                   RTALGRGPRGKLRGERVGVDAVGIGAHRHELRAREPQRLQRGRIRGRLDERDVARLDQR
FT                   AHEQIEALLRARRDEHLRSVARDAARARHPVGERGAQAGLAGGVAILQAGHRIVAGRVG
FT                   ERRRDALAVEQLGGRIAARERDHPRLADVLEQLADRRALRIGERRGERIIDGGGERHGG
FT                   SGAMEVGQQANRGRCESGRGRHLEDAGRIARVEAQVERAAAGLRVGHRVARDEFVERAR
FT                   HLAFDERARRVDERARDRIRAERGLPHAARARHLDGRLDRPAERALRGGERIDIGHPVG
FT                   RVVERIAFGRDPRHLRRFGEQRVVVGERRRRVLAAEAAHEHGQERARVGKRQRRVALEL
FT                   RERRDGLRRQRVGRRAEHVRHGRLERGAEALRMELAHEELRDLVRRVEMRVRAARHFQA
FT                   LERIGAVQPIAERPQDPRERGLARRQRAARRPAHGAQRAVIERHAAAVARDVARIGAAR
FT                   RHPFEQIREQRHVQRLRKLGARDDAGLAALETRRDMHEPHQFVDGRLIGNGGEQGGEIR
FT                   VHRFFRGFSSFRPRARRASARTLTGPEWILGARNSPGN"
FT   gene            complement(681968..683194)
FT                   /locus_tag="BURPS1710b_A0496"
FT   CDS_pept        complement(681968..683194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0496"
FT                   /product="aminotransferase family protein"
FT                   /EC_number="2.6.1.66"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51677"
FT                   /db_xref="GOA:Q3JL97"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL97"
FT                   /protein_id="ABA51677.1"
FT                   /translation="MTLAAAVDYPFAAPFADPQGSPIRELFKHVGKPGMISFAGGYPSA
FT                   ELFDREGIAAAFADAARDDPVACLQYGDTAGQPGLRAALADWMTRARGVACDASQVLVT
FT                   TGSQQGFDLLVRALIEPGDVALVEAPAYPAALQALRLAGAKLVPVRTDADGVDPDALAA
FT                   QLAAWPAAERRPKLLYTVPTFANPTGATLPPARRARLAAVAADARLVLVEDDPYADLRF
FT                   AGEPVKPVLAHDGASDWTVYLGSLSKIVAPGLRIGWAVAPAAVLRRMTVAKQTSDLCTA
FT                   PIAQEAIRRYLASGRLAAHLRTIAQTYGSRCRALVSALAQFVPDDVEWREPSGGMFVWA
FT                   RLGGGRDASEVLKRALEHNVMYVPGAAFYARDADAGSLRLSFAAPGEAEIFEGVRRLRA
FT                   ALAACRQRT"
FT   gene            complement(683249..684196)
FT                   /locus_tag="BURPS1710b_A0498"
FT   CDS_pept        complement(683249..684196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53147"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL96"
FT                   /protein_id="ABA53147.1"
FT                   /translation="MHVPTCFERCEPGVVTRAELAQALNMALFADLLERVPTGRAYTRD
FT                   VARDGGRVTFDHGALRTVRWPSCGALPPGEAAFTRILRPLGYRLNGTYALERLKMTGRS
FT                   YAHLDAPDQIAQFFVSELHPERFSAAFQAAVTNVLGTSADPLTPQAVATLAELERDASL
FT                   PLADACALLPVLVRCFGRQHATPALADYDTLLAESAEMAWIATEGNAFNHATDRVPDVD
FT                   ALAAAQRALGRPIKPAVEVSRSGRVRQTAFRADPVARTFVDASGALVEREVPGSFYEFI
FT                   TRDAVADAQTGRRALDLSFDAGNATGIFKMTAAA"
FT   gene            684443..685351
FT                   /locus_tag="BURPS1710b_A0499"
FT   CDS_pept        684443..685351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0499"
FT                   /product="Transcriptional regulator, lysR family"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52339"
FT                   /db_xref="GOA:Q3JL95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL95"
FT                   /protein_id="ABA52339.1"
FT                   /translation="MRKGIPNLAALQVFEAAARHESFTRAADELALTQSAVSRQITSLE
FT                   ERLGVALFLRIKKRVVLTPHGRHYAALVRRNLERIERDTLELMAQRGIGATLELAVVPT
FT                   FASQWLIPRLPQFRALRPDITVNLSVRTGPFLFSDSTFDAAIYFGHALWPGTQGRLLFL
FT                   EGDMLPVCSPALLGANGRRITRDALLDLPLLHLSTRADAWRDWFRAQGLDNDLRAVRGP
FT                   RYELFTMLTAAAHAGMGVALMPALLVADELASGRLCAPLDLRLPSDAGYYLVAPDAAAD
FT                   SEPFVALAEWLGSVSPARPIS"
FT   gene            685412..685900
FT                   /locus_tag="BURPS1710b_A0500"
FT   CDS_pept        685412..685900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0500"
FT                   /product="prevent-host-death family protein subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51733"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL94"
FT                   /protein_id="ABA51733.1"
FT                   /translation="MTIRIDDIVPLSIARARFSELADDARDGGEKIITKNGAAYVALID
FT                   ARRLDHYHRLERERAECACAALLHGGGDDGRDSDDRGNGGDAAGDAARSGGRDSPDGRG
FT                   AAIAAGRETGAANATDATGAPGTMGAMAAPCDSDGADALAPDALAPDAPSAERRAGPD"
FT   gene            686142..687443
FT                   /gene="ordL3"
FT                   /locus_tag="BURPS1710b_A0501"
FT   CDS_pept        686142..687443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ordL3"
FT                   /locus_tag="BURPS1710b_A0501"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53491"
FT                   /db_xref="GOA:Q3JL93"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL93"
FT                   /protein_id="ABA53491.1"
FT                   /translation="MQNYYEATVTRTPYPALAERIDTDVCIVGGGLAGLSTALGLVERG
FT                   VRDIALLDAQTVGFGASGRNGGFVFGGYSLDNADLLRTLGPESARALYRLTIDAVELIR
FT                   ARAARYGIDCELVDGGVILANWFDDPARLCAPRKLMKEAFGVDWEPLDERALRTRLKTD
FT                   RYRGGLFERNAFHFHPLKYVLGVAAAAAQGGARIHEHSAARAIRRDGAGFVVATDGGAV
FT                   RARRVVFAGGGYARGVYPRIERAVLPIATYVIATEPLGARLADAIACEAAVYDTRFAFD
FT                   YYRPLADTRILWGGRISVLERGPEAIARLLRRDLLRVYPQLRDVAVQFAWGGLMSYARH
FT                   KMPQIGRDAHGVWHAVGFGGHGMAPTTVAGEVLAAALAGERPVPDGFARFGLARTFGLA
FT                   GLAAAQLTYSAYEARDALAARRCARAGQPFRQRL"
FT   gene            687520..688194
FT                   /locus_tag="BURPS1710b_A0502"
FT   CDS_pept        687520..688194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0502"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52903"
FT                   /db_xref="GOA:Q3JL92"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL92"
FT                   /protein_id="ABA52903.1"
FT                   /translation="MKQGSKAAAPDAEARRDEARRKYDPEQTKRNILDVATQEFSAMGL
FT                   SGARVDAIAERTNTTKRMLYYYFDSKEGLYEAVLEKVYGDIRTLERELNVGELEPREGL
FT                   SRLVEFTFDYHDRHRDFVRLVTIENIHGAKYIEQLKSFKNRNVSIIKTLEELLARGVES
FT                   GVFRDDVDPFDLHLLISSFCFHRVANRYTFGTAFGRDPSSPRLRARHRAMITDTVLRYV
FT                   AR"
FT   gene            complement(688656..690461)
FT                   /locus_tag="BURPS1710b_A0503"
FT   CDS_pept        complement(688656..690461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0503"
FT                   /product="Phospholipase D. Active site motif domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51507"
FT                   /db_xref="GOA:Q3JL91"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL91"
FT                   /protein_id="ABA51507.1"
FT                   /translation="MSVSVRSYLSPTLVLLAFDWPDAQRRDDFLGFAIKRTPGFWSADG
FT                   KTRAATSWLPNRLTFDGPAAHTQGDAPTDQAPIQKFMWWDARIDPPDRGRSFRYDVYPV
FT                   VGTPASLQVLEAEAGVCAITLPAHVEDGVGTWFNRAVVSSQAFAKQVRALHLADGGAPS
FT                   PDAALRLRTWLANDLQETFGLMLGADARRAVSAVYHLTDPLWAIPAFDAFGRAHGANAL
FT                   AIVYDAHETKRGSGEPPLPSPNQPAVERLTGVATLAPRDKTRIMHDKFIVAGDETGPAR
FT                   VLTGSANFTAEGIAEQANVLHTFESAALAELYNARARALASNPGIAETARLAPGWSEPV
FT                   EIGSARVRVSFSPEPRGVRTQIDTIVEAVRGAQHSVAFCLFMPTDAALRDACFAAGERG
FT                   LMMFGLVNAISARGAQQADADRRDGKTLDAARLANLELYHRSRSNRDVIDAAYFSPATV
FT                   PDGFETELRLFPGEPAPPYPPVVVHHKFVVIDAEGANPIVYSGSANMSANSEHYNDENL
FT                   LEIRDARIAGIYLAEFLRLYEHYRARALAIASRRGDGGGSTAGNAGAHGGLALQPDSRW
FT                   AKKYFVAGSPEEKARIALAAPVAAR"
FT   gene            complement(690510..690854)
FT                   /locus_tag="BURPS1710b_A0504"
FT   CDS_pept        complement(690510..690854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL90"
FT                   /protein_id="ABA53185.1"
FT                   /translation="MHMMLGDADRCSSAATGPGDAHVARCGANRRKPDHRADARRRARR
FT                   TSRPRRARLSARIAHRATRNATRDTRHAAAHGLVARHADCPPASASGAPHIARATRKLH
FT                   RSVTRTASAC"
FT   gene            complement(691183..692406)
FT                   /locus_tag="BURPS1710b_A0505"
FT   CDS_pept        complement(691183..692406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0505"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52613"
FT                   /db_xref="GOA:Q3JL89"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL89"
FT                   /protein_id="ABA52613.1"
FT                   /translation="MTGRNGGGSRSAAGAVDACGCLPILGREAMKCAPPTAGGGPRTTP
FT                   GTHGRLRDGRCATGRRCSVASRRQGPGWLSAAGCPRSVLHGRLRTAGGGRPVSDGPCRM
FT                   ADGGRIAAAPPPAKHGGRRAIGGRREPLAPYYNSPPFALHAPTRGPAAPRAMLAEQRHR
FT                   YILSELGRAGALSVAQLVNALNVSRETIRRDLNALAARGLVITTHGGALAADRHEPSVS
FT                   ERDASHADAKRVIGRRAAEFVPDGASVLLDSGSTVHAVALALADRHRLSVYTNDWRIAG
FT                   VLGRRNGNRVTLLGGELSDDEDATFGLDTIHQLAQYHVDFAFVGAGGITPDGTLTDYSR
FT                   VVAEVRGRMLAAAAAPIVVADHSKFGRVTPVRINGSDAARFLVTERAPDKAMRRALTAR
FT                   GIELVVCG"
FT   gene            692152..695154
FT                   /locus_tag="BURPS1710b_A0507"
FT   CDS_pept        692152..695154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0507"
FT                   /product="RNA binding protein, putative"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53619"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL88"
FT                   /protein_id="ABA53619.1"
FT                   /translation="MQNRPGATGRRQPTGALPSTRNRTSTPRRASAVAQPAVRAGCRPR
FT                   PTAGGRRRAFHRLATEDRQTTARIDRPRSRSAATAVPTGHRNPSPATDSRHRSPGLRRR
FT                   TALVGGGACAGGLLGIQPPPAFAPKPHASHPRLQKRTFAQHTRIARTVAQEERGQHRAR
FT                   ERDRAGKHERGHERAAALDDESGDGGPDDARQASHAVQAAADRADAPRRDDVLNDRPVD
FT                   RARRVKEKERYRHQRDRALRRAHRARDRDADPRAEQAPDEHDPARQHRVAGELVDSVRD
FT                   HAAARETDRADEPRHDRRDAHLADVQVMRLHEIARKPAQEEEQHVVVAEERDARRQYAR
FT                   LLQVIAQRRHVGGLGGMGGIDGAAAAGARARRRRSARRRGGGARAAGRHRRRLRRGPVR
FT                   RRRDPHEHPREADRAYDPERRPPAELRGEHPDDRPGERAAERRAGAQQPHRRGRRFARQ
FT                   PVVDHLVRGRAERPLGHAEQQAHDQQADEADRDRRHPAEDRPEAHGDHIDALRPEPVRR
FT                   ETADEVEQRIADEERAEDDAHLRGVDPEIPLHHRRDDRQRDAVEIIDAVHDEQQEYRDP
FT                   PHRSLMHACLLHADVSGVHVLGRRRSRTRRGSNVIRLARRIAGGAAAGPRVIARSRFAA
FT                   LSASRAAPASARLPSRADPPRPDRRARKHGRTLARRRRVQAPANAGILVGRPARSSVEQ
FT                   RPQQRVGAARAHRLQVRADARRQRLGPSRRIARRDQPERRAHRIGRARRAVQTCRQRLR
FT                   ARILEHERPAALVARDFHVMQPHRERALEKRPLDARRRALGQRRQPAQRHLLRAVRRDL
FT                   RGAVRERRVAKTLDQRRAIRTHVVAGRHVERREQLARHHAARERVDQRIGHRVGHRAPP
FT                   TQLAGIGDRRVRAVQQAQLHLLVRPHVGRDERARVLPARPRAREAVLEHPLRERLADDR
FT                   RLVAHADTRLHPVERFGRCGGHDPVDHRVRKRDVAPNPPRERAVGLLRVLREQRAQRVA
FT                   VRRHVVATENR"
FT   gene            complement(692560..693900)
FT                   /locus_tag="BURPS1710b_A0506"
FT   CDS_pept        complement(692560..693900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0506"
FT                   /product="membrane transport protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52357"
FT                   /db_xref="GOA:Q3JL87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL87"
FT                   /protein_id="ABA52357.1"
FT                   /translation="MHQRTMGWVTVFLLFVVYGINYLDRVALSIVAPMVQRDLGIDAAQ
FT                   MGIVFSTFFVGYALFNFIGGLASDRLGPKRVYVIAVGLWSIFCGMTAITVGFVSLLIVR
FT                   LLFGMAEGPLCSAANKMVNNWLPRESAATAMGLLSAGSPLGGALAGPIVGVLAAQLGWR
FT                   PAFWIVCAIGLAWVLVWIATTSDRPAPQASAMPAGGSGAAAAAARAAAAPRACASGGRT
FT                   VDAAHASETADVPPLRDYLKQPRILATGVAFFGYNYVLFFFLSWFPSYLVQAHHLNIRE
FT                   MSVATVVPWLVGTIGLACGGVISDGIYKLTGNAMLSRRIVLVGCLLGAGVCVAIAGSVR
FT                   STQSAIALMSVSLFFLYATGAIYWAIVQDIVAPGRVGAVSGCLHCMGSLSGVIGPAVTG
FT                   FIVERSGSFVSAFVLAGAIALAGAVLSALFLRNRACDARVLRESPLL"
FT   gene            complement(694219..695715)
FT                   /locus_tag="BURPS1710b_A0508"
FT   CDS_pept        complement(694219..695715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0508"
FT                   /product="mannitol dehydrogenase family protein"
FT                   /EC_number="1.1.1.57"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51367"
FT                   /db_xref="GOA:Q3JL86"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL86"
FT                   /protein_id="ABA51367.1"
FT                   /translation="MVQTGRFLVMPLLSSDHCRALPPEVSRPRYDRRALRTGIVHLGLG
FT                   AFHRAHQACYTETLVERGDLRWGIAGVELRRRHTVERLAAQDHLYSVTERAGDAARTRV
FT                   VGAVHRTLFAPQALATLLGLIADPSVSIVSLTVTEKGYYRRPGGGGLDLDDPAIRRDLA
FT                   QPHAPSTTLGVLAAGIRLRAAHAPLSVLSCDNMPSNGDTLRALLAQYAEQTDGALARRI
FT                   RCDVAFPNTMVDRIVPAATPESLDWVQSRIGVRDEAAIVCEPFAQWVFEDRFAGARPRW
FT                   EDAGALVAADVRPYEKMKLRLLNGSHSAIAYAGQLRGRRTVSDAMADPLIDALARGVMT
FT                   RELLATLDVPAGYDVRAYCASLIERFRNPALAHRTAQIATDGTQKVPLRWLPALAESAA
FT                   AGVERPFLERALAMWLHYVEVARDESGRPLVLEDPGAQALAARLHGAPGATDAVRAALG
FT                   LIASRDAARWPEALTARVGAHLETVRTRGTDALLRPLLDA"
FT   gene            695821..696588
FT                   /locus_tag="BURPS1710b_A0509"
FT   CDS_pept        695821..696588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0509"
FT                   /product="transcriptional regulator, GntRfamily"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52654"
FT                   /db_xref="GOA:Q3JL85"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL85"
FT                   /protein_id="ABA52654.1"
FT                   /translation="MNCTLPRPRMKSPLMSDKEPAEDVVVAALNGFVLDAERSYTQQVH
FT                   ALLRNAIVRGALPPRTALSEAVISATIDVSRTPVREALAQLADERLVQIYRKVGTLVAP
FT                   ISVSMLEEGRFARGTLECANHVDLAQKITPAQLAELARLVDAQRDAVAAHDVDTFFTLD
FT                   ETMHGRMFEFAGRPHVWAMLQPMKRQFDRVRWLLLDRVEDHARRALHEHEQILAHIAAR
FT                   NMALLGASVAVHVDRVNAHLPEVRERAPHYFVD"
FT   gene            complement(696148..698970)
FT                   /locus_tag="BURPS1710b_A0511"
FT   CDS_pept        complement(696148..698970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL84"
FT                   /protein_id="ABA53425.1"
FT                   /translation="MRIGIHLEAASGAPRRAPPPASRRSMRGEIQQDLAAFARVALGEL
FT                   ERARDIAKIERVRDDVLRMHAPVGDPFDDLREHRAVQARRAQRQFLLRQLGLHDRRRLR
FT                   REAEHTDARGGRREPHRLLEDRRMADRVEDQRRAAVDAASLERVRHRFRRRVDDFVGRR
FT                   AALARERETLVEAIGDERANAVDVLEHLQQREADGARAVDQRDVGRQHAGARGRVRGDR
FT                   ERLDDRSARVGDLGRNPVGVRGGHAGVLAEAAVAMHAEHGQAAAHVAPADRACVAAPAT
FT                   DDRVDCDDLADARRVDARADRFDSPDELVPDDARIRDERVLAVEDVQIRSADARIAHAH
FT                   AHFARGGLGRGHFAHAHAMRLVDDDAQHVLILLRVSSRRWGGARSPVPHRAVAQAGDGQ
FT                   VGALVRIVRGERLVDVDAEAGHVVHHEIAVVEAIVVREHLVGQRRVRHQLLDAEVRRPQ
FT                   SEVHRGRHAHGRQVGRAVKARADLVHRRVIGDAAHVRDAARVHDRRADVVDQLIADQVL
FT                   AIPDRIEDLADRERRRRVAADQPECVLVLGGRRVLEPEQPVRLEIAAEARRLDRREPVM
FT                   RVVQQVRRVAERVAHLAEQLGRMAQVERGVPRLLGRQAFFGGLVRARRLADAVHLRQPR
FT                   HARLHADRAVARGDVPVRGVDRLVVIAPVRVAIDHQPFAALAAEQLIDGHAGELALDVP
FT                   ERHVDRGDRRHRHGPAPPVRAAIQVLPDVLDVARVPADQAREHVILQIRAHRELAPVER
FT                   RVAEAVDAFVGDDLDRHEIPAGAGDDDVQPFDFHAVSPVRGSVDKVVGRALAHLGQVGV
FT                   HAVDVHRDRCAEQRHVARRDVREDLLVLVQRAARVVFDAIEQQPAHAVELPFHRLQHGP
FT                   HVRAAGEFEHPAVHRLVEREERVDVVRGHRVALRVDEAGELRELRRRDLLREIDVVRAF
FT                   ERAAREAAFL"
FT   gene            696610..697818
FT                   /gene="rspA"
FT                   /locus_tag="BURPS1710b_A0510"
FT   CDS_pept        696610..697818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspA"
FT                   /locus_tag="BURPS1710b_A0510"
FT                   /product="starvation sensing protein RspA"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52000"
FT                   /db_xref="GOA:Q3JL83"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL83"
FT                   /protein_id="ABA52000.1"
FT                   /translation="MKIERLNIIVTCPGRNFVTVKIVTDEGVHGLGDATLNGRELAVRA
FT                   YLEDHVFPCLIGRDPRDIEDIWQYLYRGAYWRRGPVTMTAIAAIDMALWDIKGKLAGMP
FT                   VYQLLGGKSREGLMVYGHANGRDHDEAIDAAHRHIAAGYRAIRVQSGVPGLAKVYGVGK
FT                   TAGAYEPAEKGLPPEEPWDTALYLRHTPELFRKVRDALGDAPHLLHDAHHRLTPIEAAR
FT                   LGRDLEPYRLFWLEDATPAENQDAFRLIRSHTTTPLAVGEVFNSIWDCKDLIRDQLIDY
FT                   IRATIVHAGGITHVRRIADYAAMYQVRTGFHGATDLSPVCMAAAVNFGLWAPNFGIQEL
FT                   MPHTALTDEVFPHNYRFDDGYLVMDDVPGLGVDIDETLAANYPYERAYLPVARLRDGSM
FT                   WNW"
FT   gene            697867..698898
FT                   /gene="rspB"
FT                   /locus_tag="BURPS1710b_A0512"
FT   CDS_pept        697867..698898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspB"
FT                   /locus_tag="BURPS1710b_A0512"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51509"
FT                   /db_xref="GOA:Q3JL82"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL82"
FT                   /protein_id="ABA51509.1"
FT                   /translation="MLSVVVDQPHSMGVREMPTPEPAAGEVRVRVRYAGICGSDLHIFH
FT                   GKNPFVSYPRVIGHEFVGRIESVGAGVDASRIGEIVAVDPVISCGRCHACAIGRRNVCR
FT                   SLTVLGVHRDGGFSEYACVPAANAHRIAPEIADTCAAIVEPFAVAANATARTGVLPSDV
FT                   ALIYGAGTVGLTLLQVLKHVYGIRAFIADRLDERLALARKCGAAADEVIHAATETVPDA
FT                   LERRGVDGGPTLIFDAVCHPSILEEAVRLAAPAARIGVLGFSSEPSSIVQAELTKKELT
FT                   LCASRLNCAMFPQVIEWIADGRVHPEHIVTHTLDFRDVARAFELAERNPRESCKILLDF
FT                   AAH"
FT   gene            699834..700019
FT                   /locus_tag="BURPS1710b_A0513"
FT   CDS_pept        699834..700019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL81"
FT                   /protein_id="ABA51996.1"
FT                   /translation="MYRKGIVLEIQFPPQRLNDAAGDPYWIDLTLDEARRLHRQLSARL
FT                   ATEAGANQPLDTFSLD"
FT   gene            700105..701010
FT                   /locus_tag="BURPS1710b_A0514"
FT   CDS_pept        700105..701010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0514"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51440"
FT                   /db_xref="GOA:Q3JL80"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL80"
FT                   /protein_id="ABA51440.1"
FT                   /translation="MPASSGPLRMLRSASAAAAAAFVALWSTGFIVARAIKPYADPNLY
FT                   LLARFCGTALLYAGIALAARAPWPAPREWGRHLLAGALLQGFYLSASYWAVAHGLSAGV
FT                   MALLGALQPLATAALAAPLFGERLAARGWFGMALGVAGVALVLAPKLGDAPAAAGGAPA
FT                   WAVVAIAIAAVGSITAGSLYQKTSLAKADLRIAVALQNLGAALVAGAAAVALGETRWHG
FT                   APALWFSLAWGIGMLSGVAVMLLMAMLRRGEAARATSLLFLAPPLAALQGYALFGETLV
FT                   PLQLAGFALALAGVTLARRN"
FT   gene            701603..702457
FT                   /gene="nadE"
FT                   /locus_tag="BURPS1710b_A0515"
FT   CDS_pept        701603..702457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BURPS1710b_A0515"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53106"
FT                   /db_xref="GOA:Q3JL79"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="PDB:3DPI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL79"
FT                   /protein_id="ABA53106.1"
FT                   /translation="MSRPDQAARRRAIAAELHVSPTFDARDEAERRIGFVADYLRTAGL
FT                   RACVLGISGGIDSSTAGRLAQLAVERLRASGYDARFVAMRLPYGAQHDEADARRALAFV
FT                   RADETLTVDVKPAADAMLAALAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNG
FT                   VVIGTDHAAESVMGFFTKFGDGGADVLPLAGLTKRRVRALARMLGADEPLVLKTPTADL
FT                   ETLRPQRPDEHAYGITYEQIDDFLEGKPMDDAVAETVLRFYDATRHKRALPYTMFDWPG
FT                   HPA"
FT   gene            complement(702712..703848)
FT                   /gene="acrR6"
FT                   /locus_tag="BURPS1710b_A0516"
FT   CDS_pept        complement(702712..703848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR6"
FT                   /locus_tag="BURPS1710b_A0516"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52429"
FT                   /db_xref="GOA:Q3JL78"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL78"
FT                   /protein_id="ABA52429.1"
FT                   /translation="MVSFANRSFVARCTAIRFHGNFNTDETAVSAVVLTGHMPTTVSAP
FT                   ETLSETRTQTRELLLQTALSMLEQGWFPSITELANASGVSRATAYRYFPSQAALVSTVV
FT                   DESLGPVLQWQPTSTSVEARVNELLDFAYPRMEQHEGALRAALQVALHQWANERARRAQ
FT                   DEPKYRRGNRRRLLTLAVEPMVRAGVDPAVAERLAQALSLLYGTEAMVVLKDIWGLDFR
FT                   QFMNVIKWMSSALVRATLAQAGGAAGAGGGAEAGAGGAGVAEGAAQGAAEGTAEGTAAA
FT                   GGGAAREQVARDAGAAQHASPDGDPAAAGRAAASDGPAAGHGDAPAAGAADAADPAGDA
FT                   AGERPEDRASASPTSSITPSSSSTPSASPASGDDGRDA"
FT   gene            703849..705066
FT                   /locus_tag="BURPS1710b_A0517"
FT   CDS_pept        703849..705066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06792"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53264"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL77"
FT                   /protein_id="ABA53264.1"
FT                   /translation="MVPHRTRIYVAATVDTKGAEAHFVKDRIADAGLAAVVVDLSTRVP
FT                   GRAADIGADAVAAHHPDGAAAVFCGDRGRAIAAMAVAFEHYIKSRDDVAALIGIGGSGG
FT                   TALVTPAMQALPIGMPKLMISTMASGDVSAYIGSSDIAMLYSVADIAGLNRISRQVLAN
FT                   GAHMIAGAVRDMQPPHADLKPALGLTMFGVTTPCIQAVTSRLDARFDCIVFHATGKGGP
FT                   AMEKLADSGLLDGVLDLTTTEVCDLLMGGVLACGADRFDLIARSRVPYVGSCGALDMVN
FT                   FGHIDTVPPRYAQRLLYKHNPQVTLMRTTPDENRRIGEWIGAKLNACDGPVRFLIPEGG
FT                   VSALDAPGQAFWNPQADEALFDALEATVVQTERRRLVRVPAHINDARFADAAVEHFLSL
FT                   HAAHRN"
FT   gene            705069..705911
FT                   /locus_tag="BURPS1710b_A0518"
FT   CDS_pept        705069..705911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53016"
FT                   /db_xref="GOA:Q3JL76"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL76"
FT                   /protein_id="ABA53016.1"
FT                   /translation="MKRLSRVEILEKLRATIARGEPIVGGGAGTGLSAKCEEAGGIDLI
FT                   VIYNSGRYRMAGRGSLAGLLAYGNANEIVVDMAREVLPVVKSTPVLAGVNGTDPFCNFD
FT                   AFLDELTRLGFSGVQNFPTVGLIDGNFRANLEETGMGYALEVDMIRLAHRKGLLTTPYV
FT                   FSEADAIAMTEAGADIVVAHLGLTTGGTIGANTARTLADCVPLVRSWADAAKSVRDDVI
FT                   VLCHGGPIASPEDAAYILRACPQCHGFYGASSMERLPAETALTDMTRRFKEIDRHAAS"
FT   gene            705957..706397
FT                   /locus_tag="BURPS1710b_A0519"
FT   CDS_pept        705957..706397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52462"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL75"
FT                   /protein_id="ABA52462.1"
FT                   /translation="MNHTSFASSVIDAPIERVWAFFRDFDGLPAFHPAIVESRLEPGPD
FT                   AYTVGAVRYLTLADGYVREKLLKLDEPNHALEYAIVESTMPVRDYVAGVQLVPVTDSGK
FT                   TFAQWWANFTTQGIELQPVAESISEHVFAAGFRALADKLRAR"
FT   gene            706804..708366
FT                   /locus_tag="BURPS1710b_A0520"
FT   CDS_pept        706804..708366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0520"
FT                   /product="putative anaerobically induced outer membrane
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00034;
FT                   match to protein family HMM PF00127; match to protein
FT                   family HMM PF00394; match to protein family HMM PF07731;
FT                   match to protein family HMM PF07732; match to protein
FT                   family HMM TIGR02376"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51557"
FT                   /db_xref="GOA:Q3JL74"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL74"
FT                   /protein_id="ABA51557.1"
FT                   /translation="MKDLQSIRGQLRATFLSVLLGAVIAASAQAGAATGKVPGDFGPPQ
FT                   GEPLHATLVSPPNVPPPITRRYPAKVIVDLEVVEKVLPIADGVNYTFWTFGGAVPGNFI
FT                   RVRQGDTVEFHLKNRPDSKMPHNIDLHAVTGPGGGATSSFTAPGHESRFTFKALNEGLF
FT                   VYHCATAPVGMHVANGMYGLILVEPPEGLPKVDREYYVMQGDFYTNGKYREKGLQSFDM
FT                   DKAIDERPTYVVFNGAEGALTGERAMRARTDETVRLFVGNGGPNLVSSFHVIGAVFDKV
FT                   RADGSNVTQNDVQTTLIPAGGAATIEFHTRVPGNYTFVDHSIFRAFNKGALAILKVDGP
FT                   ENKAIYSGKELDAPYSGDAVTAAAGSGPAGAPGAAAGVKGGVKGGASPVRTSAAASAAP
FT                   LSLPAQVKAGGTVFASTCAVCHQSAGTGLPGVFPPLAGSDFLAANPKRAIGILLHGLNG
FT                   KVTVNGHDYDSAMPPMAQLTDDEVANVLTYVLNSWNNPGGRISADEVSKARAKAPAVAE
FT                   AAH"
FT   gene            708391..709227
FT                   /locus_tag="BURPS1710b_A0521"
FT   CDS_pept        708391..709227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0521"
FT                   /product="putative exported protein"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51616"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL73"
FT                   /protein_id="ABA51616.1"
FT                   /translation="MHAPSFRHACRAASAVRLARVAIVALTLAFAATGAHAARFVRLPG
FT                   GDFESALPQDVPGRSTPVHIDAFELQDTPVTVRAFAGFLRAHPEWRRDRVAHVFAGPAY
FT                   LADRADPLHPASPTPPDAPVTGVSWFAARAYCASEGARLPTWLEWEYAAAADATRPDAR
FT                   NDPLWRRQILSWYEQPAARVLPSVGGAPNVYGLRNLHGLIWEWVDDFNALFISGDSRTQ
FT                   GDPDQQRFCGAGAISIVRRDSYAVLMRVALLSSLTGADSTGSLGFRCARSISGDRP"
FT   gene            709224..709838
FT                   /gene="mnxC"
FT                   /locus_tag="BURPS1710b_A0522"
FT   CDS_pept        709224..709838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnxC"
FT                   /locus_tag="BURPS1710b_A0522"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52760"
FT                   /db_xref="GOA:Q3JL72"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL72"
FT                   /protein_id="ABA52760.1"
FT                   /translation="MKLDYFTARGALALLAAACVATAAHGADAPAAAATPPAATATDSL
FT                   YQANATLTDQDGKTFRLADLRGTPTLVSMFYTSCKMVCPMLFETIGLTLDAGGEPARKR
FT                   IKVVAVTVDPDRDSVAVLRKTANAHGLDARWRLVRTDRDSTRTVAALLGIQYRKLASGE
FT                   FNHSSTIVLLDADGRIVAHTNTLGETDPAFVDAMRKQLAAQ"
FT   gene            complement(710622..710798)
FT                   /locus_tag="BURPS1710b_A0523"
FT   CDS_pept        complement(710622..710798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL71"
FT                   /protein_id="ABA51831.1"
FT                   /translation="MAPIVRSIIQEGDYFKRPAFGRRGNNRYWTIPAGRFGRDWNAPER
FT                   KIRVNGIDAAGEA"
FT   gene            710900..711925
FT                   /locus_tag="BURPS1710b_A0524"
FT   CDS_pept        710900..711925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0524"
FT                   /product="N-acetylmuramoyl-L-alanine amidase domain
FT                   protein"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51302"
FT                   /db_xref="GOA:Q3JL70"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL70"
FT                   /protein_id="ABA51302.1"
FT                   /translation="MSQSRQTRRDDIANAKRRRFIARASACTAGALASPYAAHAARAAG
FT                   GKPRDASGAQDVAIDASIASPNQDSRVRTLVLHYTAQTLARSVALLTDPARPVSAHYLV
FT                   PDAADAGTLFRVYALVPETNRAWHAGVSYWQGERLLNASSIGVEIVNTGFPDADENAPL
FT                   MRRRWAPFPDAQMAVVGRLAADIAARHEIPPQKVVGHSDIAPGRNLDPGPLFPWRMLHE
FT                   QYGVGAWPDAIAVEYYRACRPFRGDIAELQAKLLAYGYDTPQTGVLDLRTTDVIAAFQM
FT                   HFRPARYDGVPDAETVAILDALLDKYIERDRQRLRDGQAALPEKDDRAPAAGSTAAKPL
FT                   A"
FT   gene            complement(711922..712035)
FT                   /locus_tag="BURPS1710b_A0525"
FT   CDS_pept        complement(711922..712035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51345"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL69"
FT                   /protein_id="ABA51345.1"
FT                   /translation="MARREAGVRGARAFARNRARGGGASPLAARRAFVTFD"
FT   gene            712053..713453
FT                   /gene="tibC"
FT                   /locus_tag="BURPS1710b_A0526"
FT   CDS_pept        712053..713453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tibC"
FT                   /locus_tag="BURPS1710b_A0526"
FT                   /product="unknown"
FT                   /EC_number="2.4.1.-"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53321"
FT                   /db_xref="GOA:Q3JL68"
FT                   /db_xref="InterPro:IPR030929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL68"
FT                   /protein_id="ABA53321.1"
FT                   /translation="MPPSPSYSDANARRSAHEPPKVTFCGSPQTLDAHAPPAFAPRSRA
FT                   PQVPAAPTGTHAGSPAHIQAPTHARGFAPPADIPTWSGTEGVRFDFNDGCRVLLPDGDW
FT                   TVRLSDMHTDTPLFDAQIGAGIVTSTRRHFVPFQIEIDSGEKRVFKHQFDAHGKPVLIQ
FT                   FEAGRLGEALGWFGYAVKFQRRHRCRLTCAMPAPLIALLKPGYPDIEFVTPELVKPECY
FT                   YATYRLGRFTGDEARAYQPSAPQLVGVHRSAAYMLGVDPREAPPRIELADDSRPLAGRY
FT                   VCIAAQSALRCARWERPGGWRQVQRFLTAAGYRIVCVDSPSPDVADESSALAQVAHVLP
FT                   PDTPWTERARWLRHAACLIGVPGDLAWLAWAVGAPVVLISGFTHPVSEFDTPYRVINFH
FT                   ACNSCWNDASANFDDADASACPRHAGTLRQFECARLVSYAQVKHAAVRLLEACAPPRSP
FT                   DQAHAFLD"
FT   gene            complement(712227..713705)
FT                   /locus_tag="BURPS1710b_A0527"
FT   CDS_pept        complement(712227..713705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL67"
FT                   /protein_id="ABA53682.1"
FT                   /translation="MFAPPPGIGGGTGMFAPPPGIGGGTGMLVPPGGSGGLASASIDKP
FT                   RERDASARQSVVAMELGLGASGAWLEEALACISIGSDVGLVEEGMGLIRRARRRARLQQ
FT                   SNGSVFDLRVAHEPRTFELPQRSRVTRACRCIGIVEVRARVVPAAIARMEIDHAVRRVE
FT                   FADRMRESADQHDGRADRPRKPREIAGHADQARRMPQPPCAFCPRRVGWKNVRDLRERA
FT                   AFVGDIGRRRIDADDPIAGRRQKSLHLPPAAGSLPARAAQRALRGDADIAARERPAVVG
FT                   ELDARRRLARIDAEHVRGAAMHADELRRARLVRARFVAGKAPEPVCRVIALGLDELGRH
FT                   EFDVRIARLQQRDQRRRHRAREPATMSPLEFHGIAEPAERFAEPARLELNQHRLAVRVE
FT                   LVLEDALLARVDFDLERHEVPARARDDARADLRVEQRRIGVHVAQADRPVAVGQQHAAA
FT                   VVEVEAHAFGAGPGRYVGGRCEASRMRWRLYVRR"
FT   gene            713890..715026
FT                   /locus_tag="BURPS1710b_A0528"
FT   CDS_pept        713890..715026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0528"
FT                   /product="Hep_Hag family"
FT                   /note="identified by match to protein family HMM PF05658;
FT                   match to protein family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52733"
FT                   /db_xref="GOA:Q3JL66"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL66"
FT                   /protein_id="ABA52733.1"
FT                   /translation="MDAVIRNAVNLAPDANGDFSGRSAMPIEMAANAALRSLKKNPGDA
FT                   GHAAPAYLPAERIGQLREKVRRTIEALESNRPPKPQPRSTPPQSTPPKPTQHPTAPNPN
FT                   VPDASTPDASTPDASTPDASTPDASTPSRPAPAPRAGTGAPAASAATRAPAFANRVRKP
FT                   NPAMPAASSHAIASDFASSNAFAIGDDSTAVGAQAIAFSEQSIAIGSRAIAAGARSIAV
FT                   GTDATAAAPDSVALGSGSIAEREGTVSVGRDGHERQITHVASGTEPTDAVNVTQLRAAM
FT                   SNANAYTNQRIGDLQQSITDTARDAYSGVAAATALTMIPDVDRDKRVSIGVGGAVYKGH
FT                   RAVALGGTARINENLKVRAGVAMSAGGNAVGIGMSWQW"
FT   gene            715106..715483
FT                   /locus_tag="BURPS1710b_A0529"
FT   CDS_pept        715106..715483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL65"
FT                   /protein_id="ABA52615.1"
FT                   /translation="MKLPILPPALAALALSIASLSGCTRDADPAPAAHVDAGASASQGR
FT                   ASYMDEFNESIRSMSGEHESGMHINRGWGVFNTIKAAPAAEPAASACAASSDASIVGDA
FT                   GGARRAHAHRPNPAAGDSRMS"
FT   gene            complement(715726..717609)
FT                   /locus_tag="BURPS1710b_A0530"
FT   CDS_pept        complement(715726..717609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0530"
FT                   /product="ImpA-related N-terminal family"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52359"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL64"
FT                   /protein_id="ABA52359.1"
FT                   /translation="MSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADA
FT                   RFDALHAELAKLASPGASGQVDWRAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAG
FT                   LRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQWLVDRVDAMHDAGAAACGGACSAEL
FT                   VAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEVADEADVAEATEATE
FT                   ATEATEAADVADVAETAETAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAAP
FT                   SAGTDTNANADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRV
FT                   ACWSSVCALPETDAENGRTRIAAPSASIVGAAKSIDGDGEPVAAVRFAEAHAQAFPLWL
FT                   DLQRIAARALARAGGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLG
FT                   ELGAPVVAADAVSPSSLPLSPRPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFA
FT                   ASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRH
FT                   DLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLST"
FT   gene            complement(717606..718343)
FT                   /gene="virG"
FT                   /locus_tag="BURPS1710b_A0531"
FT   CDS_pept        complement(717606..718343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virG"
FT                   /locus_tag="BURPS1710b_A0531"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51757"
FT                   /db_xref="GOA:Q3JL63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL63"
FT                   /protein_id="ABA51757.1"
FT                   /translation="MTNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAE
FT                   SVGRREYEMVLLDLGLPDGDGIDVLLRWRETQRFPLICVTGRSEEADRIMGLEFGADDY
FT                   VVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDAQEI
FT                   PLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHP
FT                   ELIRTERGVGYYFDAKEVETLWG"
FT   gene            complement(718340..720169)
FT                   /locus_tag="BURPS1710b_A0532"
FT   CDS_pept        complement(718340..720169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0532"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53459"
FT                   /db_xref="GOA:Q3JL62"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL62"
FT                   /protein_id="ABA53459.1"
FT                   /translation="MHGNSIDAGPPARARPARITRTARAAPRRDDRAFAPGGALNAAGL
FT                   LLLLFYANHLLSRPGACTSLNHTLSAVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATL
FT                   LAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYLIAGGGVDTLRGFAMFVLLLPLGM
FT                   AAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWNARACGAAWSRSR
FT                   NQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIAM
FT                   TLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGF
FT                   FAGGIVHDFSNVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAAR
FT                   RGEPVLTRVSVDEVVDEALAATRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQL
FT                   ARAVMNLVGNAVRAARATVVVRVGVNGGVNGGASDGASRGAPAARAFDVAIGEASMPGG
FT                   VWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGLAIVAGAALAHRGQIAVATDRG
FT                   VGSCFRFTLPAAWGTGAPGAMDAGAPGAVQERT"
FT   gene            720164..722446
FT                   /locus_tag="BURPS1710b_A0534"
FT   CDS_pept        720164..722446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0534"
FT                   /product="unknown"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF05943"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51527"
FT                   /db_xref="GOA:Q3JL61"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL61"
FT                   /protein_id="ABA51527.1"
FT                   /translation="MHRSQRSANTKPSLFRTSIDLSDAPHGSFHPQRRRHAATKNWNPA
FT                   ANAGSVFPSILAAPMRLLSVSCKTPRASAHDRRPRATTKRRTQHDNERIRRAQRAGQHR
FT                   LSPGDGRRTGGGRAAAQGARARRVLDGRRQAAARGALARERRQGRLQRRDEGAEPPARA
FT                   QRAEPAGRSGRRGRPAVRHARLRFGARFLARRDRRESARAQAADRAARRAESAEEPDRQ
FT                   HSRLSQAHPGDRRRQGRAQAVARRTRPRRTMNRDTEQTTMEGEHLQSPKHDDAPDATPP
FT                   ESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQATIDDMIAEI
FT                   DRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDS
FT                   PDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFI
FT                   AAAGPAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPY
FT                   GANTTPVKRFNYEERVDGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVT
FT                   DLPLYAYESMGEIQNKIPTDVLISERREFELAEQGFIALTMRKNSDNAAFFSANSTQKP
FT                   KFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSWKERGDLEQELNQW
FT                   IRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTLSL
FT                   VGKLEKR"
FT   gene            720429..720923
FT                   /locus_tag="BURPS1710b_A0533"
FT   CDS_pept        720429..720923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52260"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL60"
FT                   /protein_id="ABA52260.1"
FT                   /translation="MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAAD
FT                   KPPLEELSPVNVDKDDFNDVMRAQNLQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFS
FT                   PDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDE
FT                   Q"
FT   gene            722666..723175
FT                   /locus_tag="BURPS1710b_A0535"
FT   CDS_pept        722666..723175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53335"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL59"
FT                   /protein_id="ABA53335.1"
FT                   /translation="MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARL
FT                   QEGLTPAAAARGTITLTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTEL
FT                   LFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGYIEEIKFTYSGYSLEHAESGIAGA
FT                   ANWTNG"
FT   gene            complement(723102..723653)
FT                   /locus_tag="BURPS1710b_A0536"
FT   CDS_pept        complement(723102..723653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL58"
FT                   /protein_id="ABA51479.1"
FT                   /translation="MRGEIARASGNRSDIDLSVAGDGRQKARRHVVRVDHEPRIEAEAQ
FT                   RRRIGPALGERDARRFQPRLVAGDHALDLRFDFAGGALREAAREIREIRHAEGGIDRHV
FT                   ALPRVQDAAQVVDDRVREHVGGRRAIVLAARRAVRDPLEQPALARARLAGPRRFAISHS
FT                   SSLRRPRCPIPRVPTSIPNT"
FT   gene            723168..723629
FT                   /locus_tag="BURPS1710b_A0537"
FT   CDS_pept        723168..723629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07025"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51755"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL57"
FT                   /protein_id="ABA51755.1"
FT                   /translation="MADRESSRAGEPRTRERRLLERIANRAAGGEHDRPPPADVLAHSI
FT                   IDHLRRILNTRQGHVPIDPAFGVPDFTNLAGGFAQGSAREIEAQIERVITCYEPRLKAP
FT                   RVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTTVTGNGKIDIRTIS"
FT   gene            723666..725408
FT                   /locus_tag="BURPS1710b_A0538"
FT   CDS_pept        723666..725408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52349"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL56"
FT                   /protein_id="ABA52349.1"
FT                   /translation="MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVE
FT                   RLLEGVAFLTGLARQKLDEGLPELVQALANLLFPHSLRPVPAATLIAFEPRGALRERAV
FT                   IAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCRFVPPAHGGPALRLDFEMLGLDAS
FT                   EWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCALGAHALRPAGFD
FT                   DALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPDW
FT                   LPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGY
FT                   RPGHAVDRHYVPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSI
FT                   GLSCTNGALPARLKIGDVCRATDSSPERFTFANIAPVSPPLDPPLGEPLLWRTIGHLAL
FT                   NFLSLGDADHLKRMLALHAFGERGDDARAQADRRRIDGIESVDVRAETRIIGERMLSGQ
FT                   RVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEIDASPDGVRFAWPPRMGA
FT                   QCLL"
FT   gene            725396..726418
FT                   /locus_tag="BURPS1710b_A0539"
FT   CDS_pept        725396..726418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06996"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52721"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL55"
FT                   /protein_id="ABA52721.1"
FT                   /translation="MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPI
FT                   HTRPNLSLSFPDTDVERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRH
FT                   AARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDEHALRPLYALAGVDARIARDAGLH
FT                   EHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVPQWLPIPDDQRTRVGARAH
FT                   RLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAVD
FT                   VVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
FT                   "
FT   gene            726405..729533
FT                   /locus_tag="BURPS1710b_A0540"
FT   CDS_pept        726405..729533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0540"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53295"
FT                   /db_xref="GOA:Q3JL54"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL54"
FT                   /protein_id="ABA53295.1"
FT                   /translation="MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARL
FT                   CDEPSADVALLLRACGADAARLRRQADAALDARPAGDGGRPAFAPSLLALLQDAWLIAS
FT                   LELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSLRKDALVARFASGACARSIESRAS
FT                   GALDAAPGEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIRQIVDILARRRKN
FT                   NPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQRL
FT                   KRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSE
FT                   YKKYFEKDAALARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELS
FT                   ARYITGRQLPDKAIDLLDTACARVKVRQQTKPAALEDAQRAIQALERERRALRDELAER
FT                   CAPDTPRVADIDRELAALSARAGALRDAWAAQRDAAQALVDARRACRAAADATAATDAA
FT                   GTTGTAHAGELADSADVSDIADVTKMADAADAAPADAETGSNARDADARMPAGTCARIA
FT                   PNPDARAWPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIADVVADW
FT                   TGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFL
FT                   LAGPSGTGKTETALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGM
FT                   LTEAVRQRPYSVVLLDEVEKAHPDVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNL
FT                   GADIIADIAARGARPDPDAMRAAVRPALSRHFKPALLARMTEIPYAPLAPDTLADIARL
FT                   KLERIATRVAAQHATRIVYDDAVVAHVAARCTEVESGARNVDFILQRHVLPALAQHVLV
FT                   CAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDAWDRSDASDASDASDAIDAIDAIDAVD
FT                   AVDAVDAVDAVDAVDAVDAVDAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAR"
FT   gene            729560..732583
FT                   /locus_tag="BURPS1710b_A0541"
FT   CDS_pept        729560..732583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0541"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52974"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL53"
FT                   /protein_id="ABA52974.1"
FT                   /translation="MPSSPRHDAPASRAHAAPSANARRFTFASDAYDPATFDVVDINGR
FT                   DAISQPYRFEITLVSRQLRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRF
FT                   RDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGGGYR
FT                   KRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYL
FT                   PVTSLDAGIESDRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSS
FT                   DEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLV
FT                   TALTHRGSQAHLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVS
FT                   AIVDGEGGGKLAELDEYGQYKVRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLK
FT                   RTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATW
FT                   LHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVR
FT                   NSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAGQDASA
FT                   LLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGA
FT                   TGVSTALMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVS
FT                   WSTHAKGPGAAGAAMSVGKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLR
FT                   RDLDECMKDIADLEADISENEVLSTDQNTFGVSALIPTPPSPAGALAAVAIKVKQAKLV
FT                   ELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSASDAQLGFKGNRLVATADGVTLAHAQ
FT                   GKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSATDVKLNGTNV
FT                   KLNGSASLKFDGQLIQLG"
FT   gene            732609..735251
FT                   /locus_tag="BURPS1710b_A0542"
FT   CDS_pept        732609..735251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0542"
FT                   /product="putative exported protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53526"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL52"
FT                   /protein_id="ABA53526.1"
FT                   /translation="MKIVKPETLALMCRTLRIERADRLSIGALACFALRAHAPDGPGDL
FT                   APEATLWQIAQQWLGAHAPLDEGWPKPAGEFLVYGDACAPAGREHAGGAPFAVRARIGA
FT                   ACKARLVDARDPAERVLADFRALPPSHPQRVRDLGPFDARWLAERWPHLPSGTRAEHFH
FT                   TAPRDQRIAGFWRGDEDIELVNLHAQHPIVAGALPRVRARCFVERSAGGATRVDACPMR
FT                   AETVWLFPGAACGIVLYRGLATIDDEDGDDVLRVIAGWEDAAAPPLPADAYLGRPASGG
FT                   AGSRPTPAPDAAPVASVVPAALTAEEAHADEHAPGGSASASQAHSPAAPEFPEAPHAPD
FT                   LSALEREAAALAEQTDALLAGLGITEADIARLLPARDAPAELNLDQLATLAAELDAQTA
FT                   QWQAQQAAAAVERGDAASATPAAPATPDAEAAHEASLADLLRQADAQMRALVEQHGLSR
FT                   ARMEAAARTLPELAPLAGSLDALDALDAPLDVDALTAGLAAAGGDAAAEPDTPAEPSPP
FT                   APANEFAAAVPAPASSTAAPPVDDAPPGPLTREQVIERHARGLGFAGLDLSGLDLSSAA
FT                   LERADFRRARLERTRFAGCRLAGASFERALLSHADFSNADLRDAVFAGASAPGASWRGA
FT                   VLERARLEHGDFSGGDFAQASLADSHCAHAQFDASAMTALVAARIDGTHASFAGCTLDA
FT                   ADFTSARLPRANFQHATLADAALACTHCDGAEWYGAQAPRVRLRAASLRGSRADASTSF
FT                   RQADLSSAALDDANWDGVDLRGTNLHEATLDGASLARANASGAQLTRARARRADLTQAD
FT                   LTHADARCSNLHGASLRRARLGGTQLQSSNLYGADCYGTALARPQLDGANIERTLLAVP
FT                   GRPELAASR"
FT   gene            735269..736333
FT                   /locus_tag="BURPS1710b_A0543"
FT   CDS_pept        735269..736333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51785"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL51"
FT                   /protein_id="ABA51785.1"
FT                   /translation="MSDLVHTALAALADTRTLTGIDLSDADLSGRDLSGCTFERVSLRG
FT                   ANLSAAQLDATRWLQCDLTGARLDGATLGESSWHAVALRAASLRATTGDAFAMTETDLA
FT                   GATLTDALWARATFERGDFSAAQCGRAKLLRCEAADCRFERTDFANAELERFVAMRAEL
FT                   SSARFDATRLTHAFFAEANLRGQRFERCDLTMTHFSRAALAGCDFSGASLMQTMFFDAD
FT                   LERATLAGARGRHVRFAGATLDGANLAHAAFDESDFARARLRAANARGLRARMSLFAHA
FT                   DCAEATLAGGHFVYCDFSHATLSHADCTGADFSHANLHGLADHAARWDGARKTGARATD
FT                   PALAHAERWTAPQR"
FT   gene            736312..737082
FT                   /locus_tag="BURPS1710b_A0544"
FT   CDS_pept        736312..737082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0544"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52293"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL50"
FT                   /protein_id="ABA52293.1"
FT                   /translation="MDRAPTMIHGSRTSMTPPPSSAPLGAAAPLPPVHARRADEAGAAL
FT                   RAARVTGRVGDWLLLDDHAGRARRADGCLLAPDIGDSVLIWTSAPAGALADDDDAAHAP
FT                   SAYVLAVLARAGAPQAALALPGGVVLETGADGLRIDAPHIALAARERIDARAPRVDVSA
FT                   HRAHVRAAHLDACARSIDGRAHDVRLVARRFTSTIGRALHTLGDCLRRVCGVDELHAAR
FT                   ARWRVDERAHLHARDVTLLADRHVGIDGERIDLG"
FT   gene            737140..739740
FT                   /locus_tag="BURPS1710b_A0545"
FT   CDS_pept        737140..739740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05936"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51876"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL49"
FT                   /protein_id="ABA51876.1"
FT                   /translation="MPEPRRRLQDPHAGRPRARPVSEHRPADDGRVDHDEGARLRHARA
FT                   HEEIDDPDDERRSAGQRRRRDVGEDHGQGRIHRGQRESEVRRRRGRAADDADEAQRRQR
FT                   DGRRAAAEPAESDGDELRRGHERTTHCPAGRDARAPADAARPAVMAVANVSRMRGSHMR
FT                   CRARRARRPRRLCGPRHRRAGARRRAMGLRARRAAHRYRRVGAVERIPERAAHAVARGV
FT                   PERGREGVPPARRRSGPAAHDARGGRPRRGLHSDDPLRRRARPACRAVDRSRAAGALRR
FT                   HRRRLLRRRRPTRGAPVRGAAAHRQARLVLLHLSRRAANARAEAQARRAEHHRRARSAA
FT                   EPAAAGRARMDGARQRREDPGAAERRRERRRQRQARQTRQRRRPCAAQAMTHDASRTGT
FT                   NDMDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVV
FT                   EIRSARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAA
FT                   APDALPDAPTRYATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPI
FT                   ARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRA
FT                   EFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVGELSVFSERFDMLG
FT                   ETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDAIAVGPDCVATFEPDGPQQPAQRSAQ
FT                   LPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPG
FT                   PPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ"
FT   gene            739737..740402
FT                   /locus_tag="BURPS1710b_A0546"
FT   CDS_pept        739737..740402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53126"
FT                   /db_xref="GOA:Q3JL48"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL48"
FT                   /protein_id="ABA53126.1"
FT                   /translation="MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAAC
FT                   AGAPAADVDDALFAVCAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGT
FT                   LDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFP
FT                   AAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ"
FT   gene            740509..744408
FT                   /locus_tag="BURPS1710b_A0549"
FT   CDS_pept        740509..744408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0549"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52208"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL47"
FT                   /protein_id="ABA52208.1"
FT                   /translation="MFCAALAGWLLCRVARRALRAVRARAQLARLDASERLPAADAPEL
FT                   RVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLVSPLRHA
FT                   RDDAAIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVN
FT                   GVVVAIDAPRLIEASRDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEW
FT                   AAQLAPEQRERAFGYLGDHDADAFVARALDSLDARLGALRVALAARGEPPSPRALMLPH
FT                   ELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGRQAGGAPSLTLPDWLDAAPARTP
FT                   GDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASIAAGLLMSASFV
FT                   GDMRTVELVRRDYPAHPRFTGEFAHDTATLERIGRVIADVERRDERRLVRPLAGATPVG
FT                   RLEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDVRAADDARLAARIRNLVRYVNLMQ
FT                   ARRRGADRETLAQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGVSGVSGVSG
FT                   GVGGVGGARAAEGAGRAVRASGGRRAGDARAARGMRGAAGNASAGAEIAPAADGVRDRD
FT                   EGFARVSALAVDLIAWSAPDDRALAARVAAAQAELERLAYRDPDGAWLLALPDASMPRD
FT                   VTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPKFAF
FT                   HRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADRRDPFAALLARVD
FT                   REFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALRE
FT                   ALGGAPEQGRLTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPS
FT                   VQASAMRAADSALRDVKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWER
FT                   DVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVGAARASALDTLGYRLPFTD
FT                   AFLPLIDDAAARRVAQARRDAERRAQQQAALELDERIASLGKQIDALRAQTVRFGIVAQ
FT                   PTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRISLGGVT
FT                   LVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLA
FT                   HVGRIDALERARRDDLARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCW
FT                   GDPAHDRPDGDGAQP"
FT   gene            742130..742243
FT                   /locus_tag="BURPS1710b_A0547"
FT   CDS_pept        742130..742243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53350"
FT                   /db_xref="GOA:Q3JL46"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL46"
FT                   /protein_id="ABA53350.1"
FT                   /translation="MAVALAEWTVWVFLVFLVFLVFLVFLVFLVFLVFLAV"
FT   gene            742256..742453
FT                   /locus_tag="BURPS1710b_A0548"
FT   CDS_pept        742256..742453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL45"
FT                   /protein_id="ABA52636.1"
FT                   /translation="MRAPRKARVAPSARAADGAQATRAPRAACAAPPATPAPALKSHPP
FT                   QTAFAIATKGLRASARSPST"
FT   gene            744424..746364
FT                   /locus_tag="BURPS1710b_A0550"
FT   CDS_pept        744424..746364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0550"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53736"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL44"
FT                   /protein_id="ABA53736.1"
FT                   /translation="MLDAARQRRRRRAVESSSHRVIESSSHRVIESSICRIHLRSLSID
FT                   VHLLSRNDESRFESRFGSSRSSQRAAFDTKRRRLRRTVFDSCSRRRRCAAADSHGTPFR
FT                   YAAISSTRTAPLAPQFTRGLPRRRAPLGIRRFSGRKERRPNAHRANRAVRESALAEARP
FT                   RMNARRPAFGLIASHASRRRAVESVRAHFPFMFTLCLAMKHTSNHSDPSGAPSSARRAA
FT                   SDSSRLVRGMRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSP
FT                   VAPAPTAHVSSGHTPPATAPAAMPTASPTATPTASPTATPTASPTATAAASPSAPSTAT
FT                   PNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPL
FT                   SWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPN
FT                   LDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAA
FT                   LRATPEVPDSGPGQTLEVMQALRMPLYDTSSANNAKNNADAIRHAPPNTKAFFLNSYPP
FT                   LSYADLPNHDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPAN
FT                   GSVSIEIAIYR"
FT   gene            complement(745242..745670)
FT                   /locus_tag="BURPS1710b_A0551"
FT   CDS_pept        complement(745242..745670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL43"
FT                   /protein_id="ABA51501.1"
FT                   /translation="MSGLRGANAIRRSLSHDNGPTATLVPSSARSTMCGTEPGSIARSN
FT                   SSSIVGRRNAACVGGTRVATTAGGAAGGALGVAVDGAEGEAAAVAVGEAVGVAVGEAVG
FT                   VAVGEAVGIAAGAVAGGVCPLDTCAVGAGATGEFGCVG"
FT   gene            746775..747458
FT                   /gene="folE"
FT                   /locus_tag="BURPS1710b_A0552"
FT   CDS_pept        746775..747458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BURPS1710b_A0552"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52954"
FT                   /db_xref="GOA:Q3JL42"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL42"
FT                   /protein_id="ABA52954.1"
FT                   /translation="MASVPEKCCGFFWRCDVMIDTQYNGACDVHHHSPAEIRRIRQFDP
FT                   AAFEMAVGSLLMACGIEIDAAHTSRTAQRVRELWQKRLLDGYDVDPAEALGVGFDDRKE
FT                   DMVIIRSIAVHGVCPHHLLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRFTYQEWIT
FT                   NEIATALVTHGKARGAACLIEAEQLCLLMGENRRGDERVITQCYVGEFDHNAQARNEFL
FT                   RAINR"
FT   gene            747572..747895
FT                   /locus_tag="BURPS1710b_A0553"
FT   CDS_pept        747572..747895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0553"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53757"
FT                   /db_xref="GOA:Q3JL41"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL41"
FT                   /protein_id="ABA53757.1"
FT                   /translation="MAFATLHDRKAPLPAADLLNDRVAPFFDSAGILLLHVLTDRGTEY
FT                   CGNPEHREYELYLALEDMDHARRRKPAGSSNGSTRPCSTSSIASPCARWYMRAGRHDQA
FT                   AGA"
FT   gene            complement(748519..750048)
FT                   /locus_tag="BURPS1710b_A0554"
FT   CDS_pept        complement(748519..750048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53017"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL40"
FT                   /protein_id="ABA53017.1"
FT                   /translation="MPSMTVTRTTSQEQYVPAAGPTTPSTSNVDGRTLTVRPSTLSTDD
FT                   LVKAPPEHRAKMAGVRLGIGSAGDRLNFLERNGVMPAEDKVLTAARYAHNVKIDHKNAS
FT                   NLEFQLNRMRIGEVSLPKQAKPDSMEIRNALDVIPLALPDRNEKHTIPTDKYLMNRLSS
FT                   GAVEQARHHGCEFFCGSGRDEMLNHYAHRGFDRAISISSNTSTKFDLLSNSSNGKSLLV
FT                   LSGMSSTTRIKHQLLQLHFADVDLNRVKLVGDINLLKAKSGDDLRKELSQLPPIPSKTL
FT                   FIGARWQIMESLGKQLFHVGDSAKEGTGYGKLGVKEHKVADFVFDTATLNLDGRQHLVA
FT                   ALRMPNGDLAYDAMKGFLDHGFNQVIMCGAGGRLAGDAQVGDYMLLERSQYGDQSISLA
FT                   RECIHVPGAKLFENAKPTSNVTVDSPLQETQRWLDENQETGNVDVETAHILRALTEAGP
FT                   DVKVLPGLFVSDVVGEHPLEGKISSDDAYRRLPEFVTASLGMIREQDTPLA"
FT   gene            751157..751795
FT                   /gene="tnpA"
FT                   /locus_tag="BURPS1710b_A0555"
FT   CDS_pept        751157..751795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="BURPS1710b_A0555"
FT                   /product="ISJP4 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52718"
FT                   /db_xref="GOA:Q3JL39"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL39"
FT                   /protein_id="ABA52718.1"
FT                   /translation="MKMIRVSLFAEHEREAVAPSGAYRLQMSPPCGTGPYGRQFRRRSS
FT                   RTCAATEANGTPIAAILTGANRNDVTQRIPVIEAIEPINGVRGRPLSRPKRVYADRGYG
FT                   RDEYRRIRHARGIPPSIARRGEPRGSGSGKIQWIVERTHAGMHRILRLRYTIRTSRRHS
FT                   RGISQTRVRLDLREQLAANSAAVTEPSPRRAASYRTSRRSRGETAAKLR"
FT   gene            complement(751879..753000)
FT                   /locus_tag="BURPS1710b_A0556"
FT   CDS_pept        complement(751879..753000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0556"
FT                   /product="transcriptional regulator, araC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51990"
FT                   /db_xref="GOA:Q3JL38"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL38"
FT                   /protein_id="ABA51990.1"
FT                   /translation="MTCCATFDCDCDCDCDCDCDMRHAFRTDSRPTRFPSHHSPALTMA
FT                   KMHAPRGGTLLQFFSTDDMPLARAAAFWSAHVFQCEDVRASSARAFHGHGFLCRCERGR
FT                   FVRFRGASLDTRIGAAWLSAAPADAYVTICALHAGECTVEAPGLPDVRFRANELFMLDG
FT                   GQPMRVRWSEPCFSALRLPRASVGRTLGQAAMDASPSAASLQEARLAPFLAAELALIGG
FT                   RGPTLSSDELDYMLARAAELGRTLLQAALSSRARRGAPARADRLQAAYRYIEQHLHLPT
FT                   LTPERIADAIHCSRTQLYRLFRHESQTVKAALREARLNRSLGYLEQPEVTLSIGEIAHA
FT                   CGFPDQSTFGKLFRRRFGRTPGEVRRAARGCSI"
FT   gene            753013..755058
FT                   /locus_tag="BURPS1710b_A0559"
FT   CDS_pept        753013..755058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52328"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL37"
FT                   /protein_id="ABA52328.1"
FT                   /translation="MRHAPSRLEHERRIASSIARRTAGDRPARRATPDLRRAACDTRRG
FT                   APMAATPRARRKRRRARSCNASAAGPCGAHRVPARATSGAPKCRARPTQAGTPAARRGR
FT                   GARSRRRALRPRRQDLELAILGPIADVPDDERVEPSQRAPVVIQAALRDAFDRLEHLAE
FT                   QPLPVDLLADLANVRGDPVALGEQHRCADRAVEADLLEHVHPDRLDLAFHRPAFAFVRD
FT                   TGGAPAVVLARRMPFDRAMTVLRLRGGHSIELHDVFPVVNIGERSFSDARRSGTFTNRS
FT                   PGPRAAYGAGVAACRGCVAYHVSYAARHESERRPHARHAAPRGGRVRVRARRALHARRA
FT                   LHRRRARVRISVSIRPVDHGRDVARAELLHQPLPMAIDRLRADVQQRRDFAIAHPVGDQ
FT                   LEHLLLAPRELVDGRGERAAAGRRRHPRLVERRIDMNAPRHHAANRLHDAVRAAPLQQI
FT                   AGGAEADRVRRARLRAERGEDDEPQARVRAQDLAHRRQRILARQHHVQQHEIRTIATAP
FT                   VARLGHVGRAVHVDSRIRLAEHDLDAVAHDRMAVDDEHPFTLSLYDHNRFLLLRCMLSC
FT                   ASARAAHRPNGARPPPRQRMPLNVARAHHRKISDPFRSFMRASSDARGRVPAGIARRDR
FT                   ARPPPRRLAASAAQRAGRGVRIRRQAPRVGVVRARLLERVDQAFDA"
FT   gene            753129..753362
FT                   /locus_tag="BURPS1710b_A0557"
FT   CDS_pept        753129..753362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51293"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL36"
FT                   /protein_id="ABA51293.1"
FT                   /translation="MRHTARRAHGRNTACTAQAPPRPLMQRIGGRPVRRASRTRPRNEW
FT                   RAEVPRPPDASRHAGRETRARRALTAPGAAPA"
FT   gene            complement(753334..753777)
FT                   /locus_tag="BURPS1710b_A0558"
FT   CDS_pept        complement(753334..753777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0558"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52120"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL35"
FT                   /protein_id="ABA52120.1"
FT                   /translation="MKLNGMTAAQAQHRHGAIERHAPGKDDGRRTAGVADEREGRTMKG
FT                   EIKAIRMDVLKEIRFNSAVSTPVLLAKRNRIAANIREVSEKIDRKGLFGKMFEAVKCVA
FT                   QRGLYYDRRALRRLDAFVVRHIGDRPEDRKFKVLPTRAQRPAP"
FT   gene            complement(754033..754704)
FT                   /gene="citB1"
FT                   /locus_tag="BURPS1710b_A0560"
FT   CDS_pept        complement(754033..754704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB1"
FT                   /locus_tag="BURPS1710b_A0560"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53204"
FT                   /db_xref="GOA:Q3JL34"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL34"
FT                   /protein_id="ABA53204.1"
FT                   /translation="MVVERKCERVLVVDSHPIVRDGIEVVLGKAYAGIDVDGAADMAEA
FT                   SDRCGRDRPDLVLLDVMLPGEDPLPAMGEILRAHPGLRFVVFTALGSEARAADAIRFGA
FT                   SGYLLKWCSPDGIVQAIRRVMAGRVHIDPSLDEARVASAAGGRTLASPVDELTRREKQV
FT                   LKLIADGMRNREIASLLNISPKTVDCHRQRLMQKLGARNVATVIHWAYRYGYANACAPA
FT                   M"
FT   gene            complement(754948..755403)
FT                   /gene="bicP"
FT                   /locus_tag="BURPS1710b_A0561"
FT   CDS_pept        complement(754948..755403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bicP"
FT                   /locus_tag="BURPS1710b_A0561"
FT                   /product="putative chaperone"
FT                   /note="identified by match to protein family HMM PF05932"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53107"
FT                   /db_xref="GOA:Q3JL33"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL33"
FT                   /protein_id="ABA53107.1"
FT                   /translation="MNTHTEWLNALSEAAGVPLEFDEHGQCFVLLDTQLMISIRDRPDA
FT                   LVLYGMVGEFAEHAPAQCWKRMLAVNLDLSEAGRGGLGLDDETGAVMLIERVATANLGG
FT                   REFVDVFEAFASRVESLIDTFEQAGAYDADARGLPADSHAAARALRG"
FT   gene            complement(755544..757082)
FT                   /gene="bopA"
FT                   /locus_tag="BURPS1710b_A0562"
FT   CDS_pept        complement(755544..757082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bopA"
FT                   /locus_tag="BURPS1710b_A0562"
FT                   /product="BopA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51593"
FT                   /db_xref="GOA:Q3JL32"
FT                   /db_xref="InterPro:IPR011070"
FT                   /db_xref="InterPro:IPR015203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL32"
FT                   /protein_id="ABA51593.1"
FT                   /translation="MINVDAFVASARSGARVVVGGDARGPVVSAARLGMKERLFAFLAH
FT                   VPLLKHCDAVRRYAEQVRMENRRSLEVFVLALSKRYGPEGAKAAFDYGARRDGAPLDQR
FT                   RVRNMVSIAEHFHGTGDAKPLARQMVFRSWECRGLDHPGHASLTIKNQADADAGRHVYE
FT                   HVSWWPNQRLGSKEHFDRIEPKTLDGYRIDKRSEISSATEQRLREGDAARRKILADGFK
FT                   YANQDERHDARFFPRAGQKLDKDAEWGLSARKVYFPAIGFNHDRRDTDRPRAFVLFGLN
FT                   EAAMLRDARTVKEGAKSGELMYQMISKKENCASMALRVLRAGGAEHFVPYTAAWISEDP
FT                   NHAHAYALAVQARIDALNQRRADVERRCERLRDSASVRQAWRAFSEAGGASASPLAEDA
FT                   GRGRASAHMRQARLDEHAREVERIGAYFAELSAGRSGKHRDRADAALADAMKRCAPSAR
FT                   DDVAALTRKASVLVETLGRHLDAPPPSDSSALRRLAAHAMIGRIEAFMAAAIAA"
FT   gene            757201..757614
FT                   /locus_tag="BURPS1710b_A0563"
FT   CDS_pept        757201..757614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53534"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL31"
FT                   /protein_id="ABA53534.1"
FT                   /translation="MPLGIDVDAEDIHPASLADSAQTATHIPAEATSGVASRGGSRAHR
FT                   LSAYRAPHALAGTCAPRGIGPAPGIATQAAQPIVKRHAADREAPRRPRRFAPTPRGHLS
FT                   AHAITGGRTRRVPEPPTAHEQFMESEPTARFIE"
FT   gene            757715..758500
FT                   /gene="bopE"
FT                   /locus_tag="BURPS1710b_A0564"
FT   CDS_pept        757715..758500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bopE"
FT                   /locus_tag="BURPS1710b_A0564"
FT                   /product="type III secretion target BopE"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53377"
FT                   /db_xref="GOA:Q3JL30"
FT                   /db_xref="InterPro:IPR005414"
FT                   /db_xref="InterPro:IPR016019"
FT                   /db_xref="InterPro:IPR035949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL30"
FT                   /protein_id="ABA53377.1"
FT                   /translation="MTYNPRIGGFTHVKQASFDVHVKRGEAQPRTSFAQQIKRIFSKIG
FT                   ETLGQLFRHRAPDSAPGRVRLQGVRYVGSYRPTGDAKQAIRHFVDEAVKQVAHARTPEI
FT                   RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATRAGNVRPAFIEALGDAARATGLPGADK
FT                   QGVFTPSGAGTNPLYTEIRLRADTLMGAELAARPEYRELQPYARQQAIDLVANALPAER
FT                   SNTLVEFRQTVQTLEATYRRAAQDASRDEKGATNAADGA"
FT   gene            complement(758925..759488)
FT                   /gene="bapC"
FT                   /locus_tag="BURPS1710b_A0565"
FT   CDS_pept        complement(758925..759488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bapC"
FT                   /locus_tag="BURPS1710b_A0565"
FT                   /product="BapC protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51545"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL29"
FT                   /protein_id="ABA51545.1"
FT                   /translation="MSARRAEAARPRGYAARIARVAATFAIGIVSAGGVAHADCIDDAA
FT                   RRYGVNADLLRSIAYYESGLNPRALHRNGDGSTDIGLMQINSVHLPALRDQGIDRLRLY
FT                   DASINARVGAALLRRQIDQYGDTWRAVGAYHSRTPGLSERYARAVHDVYVARPWAAKAA
FT                   ARRDAAHTMPARAPGLVIEEASVQ"
FT   gene            complement(759485..759766)
FT                   /gene="bapB"
FT                   /locus_tag="BURPS1710b_A0566"
FT   CDS_pept        complement(759485..759766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bapB"
FT                   /locus_tag="BURPS1710b_A0566"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53506"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL28"
FT                   /protein_id="ABA53506.1"
FT                   /translation="MTAGPHLSDAAALAAAKTLLAGMLGVPEAQIAPPQRLLDDLAMDS
FT                   LELIELAMELDERWNIRLDRARLAEVATVADVAALLGAAARADDSGGA"
FT   gene            complement(759763..762504)
FT                   /locus_tag="BURPS1710b_A0567"
FT   CDS_pept        complement(759763..762504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51331"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL27"
FT                   /protein_id="ABA51331.1"
FT                   /translation="MPRSEATDKRKRFAMPPSIHRTSSINSTPAVTATGARRASGPGGV
FT                   LSADVARVASARRHTMPEIGARRGVDGDRAAPAPRESFRRRLETVSSRAPTPPPEADSR
FT                   AANARTTGAADGAGATGAAAGPSHGATSLDAARAYLAELAGDRGGALTTLVAQLNGHDR
FT                   RALDHLALTVHALHLSVDDASHAKTFAGIGDALASFLAAAARANAKPGSTPRDLCVEGN
FT                   KGYRKLCECVGALLRSDGIANALFGRARERGDAAADTLVSERLGGRMDGHVRTNGMVNR
FT                   HGGDAQRRMADAAQRFALGARHATNLVDMVGSALELLGRTDQLLNDVSLKRPAAEPGGP
FT                   RAPGGGPAAPAGPASGAAQQPAAPVVVNNHNENNVNVNLDGLERLVGDLGKMMGALLER
FT                   MGAYDPSHTRPAAPDANGPAPVRTGGHTTVVKSPVSVARTSNNGAPGSPAADGTRGDAP
FT                   MPPALSATPTTPTTPTTPTTPTTPTTPAMSPAGGPSMDERTPATNTLERGAGNGGASPT
FT                   GAWRRGDDGGWRMARGNPVVRTTEGATRIDPFSRVGARAASGAGAARAWRDAAADATQR
FT                   SLASGTSGGAADAIAPRAGAGAAAGGDAARVARRMPDVRAGGPERDAPGERAAGPNGSN
FT                   GSAVGQPIAGHAPAGGPDAVDFSDASGTGGTGARAPGMPPATGSWSRDPASGRWLRAGG
FT                   GVPLRSTEGFGRIDPFAGAQRNASATGASAVSSPSFASASMSVGSTGALPAGSSIASPD
FT                   TSGIAPAVASGGALDVASNVASNVASNVASNVASNVTSNVTSGVTSGVAPDGTAWTRPS
FT                   ALAPRNIDPHRMNRAQLERAGLYPLVDDALPPSSQSAPADAGDAGDAGDAAARRASRPD
FT                   TGAPQPGAAKTFPSVAPAHRIVTTEGAARVGWNDSIANGTKR"
FT   gene            complement(762562..763392)
FT                   /locus_tag="BURPS1710b_A0568"
FT   CDS_pept        complement(762562..763392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0568"
FT                   /product="type III effector protein IpaD/SipD/SspD"
FT                   /note="identified by match to protein family HMM TIGR02553"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51873"
FT                   /db_xref="GOA:Q3JL26"
FT                   /db_xref="InterPro:IPR009483"
FT                   /db_xref="InterPro:IPR036708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL26"
FT                   /protein_id="ABA51873.1"
FT                   /translation="MTDDDLRAAGVDRRVPEQKLGAAIDEFASLRLPDRIDGRFVDGRR
FT                   ANLTVFDDARVAVRGHARAQRNLLERLETELLGGTLDTAGDEGGIQPDPILQGLVDVIG
FT                   QGKSDIDAYATIVEGLTKYFQSVADVMSKLQDYISAKDDKNMKIDGGKIKALIQQVIDH
FT                   LPTMQLPKGADIARWRKELGDAVSISDSGVVTINPDKLIKMRDSLPPDGTVWDTARYQA
FT                   WNTAFSGQKDNIQNDVQTLVEKYSHQNSNFDNLVKVLSGAISTLTDTAKSYLQI"
FT   gene            complement(763556..763858)
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_A0569"
FT   CDS_pept        complement(763556..763858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_A0569"
FT                   /product="HNS-like transcription regulator protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51275"
FT                   /db_xref="GOA:Q3JL25"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL25"
FT                   /protein_id="ABA51275.1"
FT                   /translation="MVERMATYKELKARAEALSAQAEAARQAELQAAIEDVRAKVREYG
FT                   LTAYDVFGHRKKPGERHRGAVRPKYRDPATGATWTGRGIEPKWIRGRNRDEFLIE"
FT   gene            complement(763980..765239)
FT                   /gene="bipC"
FT                   /locus_tag="BURPS1710b_A0570"
FT   CDS_pept        complement(763980..765239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipC"
FT                   /locus_tag="BURPS1710b_A0570"
FT                   /product="putative cell invasion protein"
FT                   /note="identified by match to protein family HMM TIGR02101"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51853"
FT                   /db_xref="GOA:Q3JL24"
FT                   /db_xref="InterPro:IPR005427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL24"
FT                   /protein_id="ABA51853.1"
FT                   /translation="MSIGVQSSGINISHAELSRLVDAGKSEQGDKAVRDGGRALARADA
FT                   ALAAVVGERVAARRDAVAGSGAQRVELARPKPDAQTRATDRRTVSGLEREHKRLAASQT
FT                   PRVTGMHDALVQRHVSLDGAKAAHGEGVKRAAGDAPRAAADAPQRFAFADDKAFDAMLA
FT                   LGAAMQKNVQSDLAMQGKLTMLAHDAMMSAAAQDRSIGAAQMTAAIAGGALQATTSLGG
FT                   AMQQMKSLSTKSMSIEKELKPQAELKQFHAEQALELRGINKPVLSNDEVSHVKIKRDTG
FT                   ETVRHEIDHGGERMSDEHASVLAQEAPARQHRIDMHGMRHEENLVKAGRQQMKGDLLQS
FT                   GGQIGKNQIDGASAQQQGADRAEQKEDENAQQTAMAAASTRDEAAHRSREAAQKAIDAA
FT                   KSQVANDNAVAAQVAGNLRT"
FT   gene            complement(765281..767143)
FT                   /gene="bipB"
FT                   /locus_tag="BURPS1710b_A0571"
FT   CDS_pept        complement(765281..767143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipB"
FT                   /locus_tag="BURPS1710b_A0571"
FT                   /product="BipB protein"
FT                   /note="identified by match to protein family HMM PF03518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52751"
FT                   /db_xref="GOA:Q3JL23"
FT                   /db_xref="InterPro:IPR003895"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="InterPro:IPR032391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL23"
FT                   /protein_id="ABA52751.1"
FT                   /translation="MSSGVQGGPAAHANAYQTHPLRDAASALGTLSPQAYVDVVSAAQR
FT                   NFLERMSQLASEQCDAQPAAHDARLDDKPALRAPQERDAPPLGASDTGSRASGAAKLTE
FT                   LLGVLMSVISASSLDELKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQA
FT                   AAAAKQAGADAKAADAAVDAAQKQYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRA
FT                   DALQADATKKLDAASALATQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAEL
FT                   TAVLGKLQELISSGNVKELESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMG
FT                   CIGKIVGWVITAVSFAAAAFTGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVM
FT                   DAILKPLMEMISSLITKALVACGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAV
FT                   ASKVIDAMAGQLTKLMDSAIGKMLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEA
FT                   KEDGMLLANRFEKAGTVMNVGNQVSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGD
FT                   LLKQAVDAFAEHNRVLAQLMQQMSDAGEMQTSTGKLILRNARAV"
FT   gene            767137..769824
FT                   /locus_tag="BURPS1710b_A0574"
FT   CDS_pept        767137..769824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0574"
FT                   /product="200 kDa antigen p200, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL22"
FT                   /protein_id="ABA53638.1"
FT                   /translation="MTYDQLLLASGRSRRMRAPHRRPLRRARRDRTAPSARGARRASAR
FT                   RRCRSSAARAPPCPSADGIGRCGTSAGGRPSTANTRVHTDRSPARTPSSTGTPPRAPSR
FT                   IRRCRSRRCTESGRTPPRRRAAPAGRSGTRTHRCRPSGPAAPDAGPSASRRSGPRPAAP
FT                   PPFPAPRCRLCSRRVASCRHLVWFLQSHGCRRVAVPSNDGCHITRRAPGKISQSSLFGL
FT                   SSVLIARSGRRAAVRRRAVRRTGVRRGGARWGVVGKGVVRAGVARRGHAVARLRLGRSQ
FT                   RARLGRRPAAIGRLDLAEPDQHAHHAVDVVVAHEAVAARRVAIDRARERDVAHDGHAAR
FT                   FGMPNDGERACVGLAHRHERNRHDVRIHVDADRDVGRVRDDEIGLLDVRLDLLRQQFLM
FT                   NLAPLALDLVIALALLVFLLHLVLVHLQFAVVQEVFDGGVEDQHGQCAQQEQQHEAHRE
FT                   HDPHVAEQRRARAEQPEHVGVVETGEHAHREGEHADIEQRLHRVLRRAPAEEPLHSLDR
FT                   IERGEIEADRFDREREAALHKRRQRARRRAEQHERRGDAQEQLRPRECVRTRVRLRARR
FT                   RDPHEFGRDARQIDERGRGQRARGDHDERDDVPRLERLPLLRRVAQLLRGRLLGFLGHR
FT                   SLHQAAERMHAQQRRQLVRRRVYEVQVEHGERDDALDRQRQRERVDLRAEAREQPEQRI
FT                   GDEHHDQHGRGEREPVRDEIGQQRADARQIDREQRAGGHRRVARLERADDRQHAALLQE
FT                   RGRVEQAHERRERRRFDARRRVDRIADRRAALVVDQFAHRRRDPERQRQRDAEHDARGR
FT                   LRQRDAGERAALQRRMREARPQPEDDREHDRVLHDAVDDRPVVQERQQIEHRRDARVRD
FT                   RDRAGVPVERLHQDIHRVARHDVT"
FT   gene            complement(767162..767662)
FT                   /locus_tag="BURPS1710b_A0572"
FT   CDS_pept        complement(767162..767662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0572"
FT                   /product="type III secretion low calcium response chaperone
FT                   LcrH/SycD"
FT                   /note="identified by match to protein family HMM PF07720;
FT                   match to protein family HMM TIGR02552"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53339"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL21"
FT                   /protein_id="ABA53339.1"
FT                   /translation="MNIDDIEAQEMAAALLDAVQNGATLKDLHQVPQDLMDGIYAFAYR
FT                   FYQQGRLDDAEVFFRFLCIYDFYNAEYAMGLAAVCQLKKEYARAIDLYALAYSLSKDDH
FT                   RPMFHTGQCHLLMGKAALARRCFGIVAERSRDERLAQKAQSYLDGLDEVGADAAPASAG
FT                   NDH"
FT   gene            complement(767803..769038)
FT                   /gene="bsaZ"
FT                   /locus_tag="BURPS1710b_A0573"
FT   CDS_pept        complement(767803..769038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaZ"
FT                   /locus_tag="BURPS1710b_A0573"
FT                   /product="surface presentation of antigens protein"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR01404"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52308"
FT                   /db_xref="GOA:Q3JL20"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JL20"
FT                   /protein_id="ABA52308.1"
FT                   /translation="MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALV
FT                   DLTRIAAEFVRIASTGAQPNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTL
FT                   AVESIRFDLTALDPVKGMKRLFSWRSAKDAVKALLYVGVFALTVRVFAGLYHADVFGLF
FT                   RARPALLGHMWIVLTVRLVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKES
FT                   EGNHEIKSKRREIHQELLSEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRE
FT                   TNARALAVIRHAEACGVPVVRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVE
FT                   AANRGGPPPETRALTSAEPQARDGVAPPGDACADNAFPDDAPPGAAAPNAGSPDGPAPD
FT                   GGAPARTGDQNA"
FT   gene            complement(769042..769797)
FT                   /locus_tag="BURPS1710b_A0575"
FT   CDS_pept        complement(769042..769797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0575"
FT                   /product="type III secretion protein SpaR/YscT/HrcT"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01401"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53081"
FT                   /db_xref="GOA:Q3JL19"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL19"
FT                   /protein_id="ABA53081.1"
FT                   /translation="MDVLMQAFYRHAGAIAIAYARVAPVFYLLPFLNDRTIVNGIVKNT
FT                   IVFAIILGLWPSFAHPPLQGGALAGVALTEAAAGVVLGVALSLPFWVATAVGELIDNQR
FT                   GATISDSIDPATGVEASALAPFVSLFYAAAFLQQGGMLTIVGALEASYATVPAGALFSV
FT                   DLPRIGALLTDLVAHGLALAAPVLIVMFVTDALLGLFSRFCPQVNAFSLSLTVKSIVAF
FT                   AVFHLYFVYAAPHELTALLRVHPFSSLVK"
FT   gene            complement(769831..770085)
FT                   /gene="bsaX"
FT                   /locus_tag="BURPS1710b_A0576"
FT   CDS_pept        complement(769831..770085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaX"
FT                   /locus_tag="BURPS1710b_A0576"
FT                   /product="type III secretion system protein BsaX"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01403"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51300"
FT                   /db_xref="GOA:Q3JL18"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL18"
FT                   /protein_id="ABA51300.1"
FT                   /translation="MAELTYAGDKAILLVILLCAAPVAVATVVGLAIGLFQTVTQLQEQ
FT                   TLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLSIGLR"
FT   gene            complement(770123..770803)
FT                   /gene="yscR"
FT                   /locus_tag="BURPS1710b_A0577"
FT   CDS_pept        complement(770123..770803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yscR"
FT                   /locus_tag="BURPS1710b_A0577"
FT                   /product="type III secretion apparatus protein, YscR/HrcR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01102"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53667"
FT                   /db_xref="GOA:Q3JL17"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL17"
FT                   /protein_id="ABA53667.1"
FT                   /translation="MANNEIALIVLLTAATLVPFVVAAGSCFIKFSIVLVLVRNALGIQ
FT                   QVPSNLALNSIALIMSLFVMMPVAQSAYRYLQHHPLDVMSGASVNEFIDGGLGDYKRYL
FT                   TRYSDPELVRFFERAQTARLKGDDADAADADDAPDGLDNSLFSLLPAYALTEIKSAFKI
FT                   GFYLYLPFLVVDMVVSSVLLALGMMMMSPVTISVPIKLILFVAMDGWTLICKGLIEQYL
FT                   NLMQ"
FT   gene            complement(770793..771752)
FT                   /locus_tag="BURPS1710b_A0578"
FT   CDS_pept        complement(770793..771752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0578"
FT                   /product="type III secretion system apparatus protein
FT                   YscQ/HrcQ"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51949"
FT                   /db_xref="GOA:Q3JL16"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL16"
FT                   /protein_id="ABA51949.1"
FT                   /translation="MSARYTLFRRVAPAELPLYRRARALRAAGEHAALRTIAPPRGYAA
FT                   LRATWRGVEHDGWVDLDDLMRRRYPALGALAWRALDRRYALDLLSGRDAAAELPAPPGG
FT                   WAHVRLVDLVERALPAEPLLCFDTPGRARALFRAFPDEAPAACAVADIGGVPLTMRFAI
FT                   GTARLPLALLPAVAPGDVLLVCAPRNVVRIGARALCEFCCEGENIMLNEPLADSAIDAL
FT                   HDASHDEPTAAHAPPAFDIDALPVTLEFVLHDERVTVAQLAGCHPGMVLPLRGAPGEVT
FT                   IRANGQPFGRGELIQVGEQLAVEVKALWRAKPAACDGE"
FT   gene            complement(771154..772788)
FT                   /locus_tag="BURPS1710b_A0579"
FT   CDS_pept        complement(771154..772788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52221"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL15"
FT                   /protein_id="ABA52221.1"
FT                   /translation="MRRGTGRSRCGSAARGSAKREAARTRVMRASERAPKRISKRISKR
FT                   VSKRAWGWAPTRMRRAARARAAKSRRAAARRCAATRRPPARFARLANAHPPLRRPTRTR
FT                   RQRRPRARRRPCRCRRRTRRRARRAAARAISRPPPRGFARRRRTRRRASSRRARRRCPP
FT                   RAGRPRRRPPHRPCRPCRRHDARRPPLRRALRANASTATIRTVRATRRSPACRAAFNRR
FT                   RRCAPPSPRRARTTRRAPHANARRPARRRRTRAMSGKRKAPRCATASIRGTGGPRSSCA
FT                   SMRAARRASSTRSRATTACSARWSTAPIGCRPDGRSNSIGRVRMMTAAAARRGGARGRS
FT                   RRRMSDERALYVVQARRARGIAAVPPCAGAARGGRARRAAHDRAAARLCGAARDVAGRR
FT                   ARRLGRPRRSDAPPLPGARRARVARARQALRARFAERAGRGGRAARAARRLGACAARRS
FT                   RRARAARRAAAVFRHPGPRACAVPRVPGRSARGVRRGRHRRRAAHDALRDRHRAPAARA
FT                   VARRRAGRRAARMRAAQRGPHRGARTV"
FT   gene            complement(771749..773038)
FT                   /gene="bsaU"
FT                   /locus_tag="BURPS1710b_A0580"
FT   CDS_pept        complement(771749..773038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaU"
FT                   /locus_tag="BURPS1710b_A0580"
FT                   /product="BsaU protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL14"
FT                   /protein_id="ABA53036.1"
FT                   /translation="MGSTISNSAPIAPIVSGVEPAQQSDAERTSDLQRAYREQCRAALG
FT                   KRDDGRDCDDTEAQRAHARKKTKRNGEPPGAAGGMPAPHAARDRAFALRFGGARLGEAR
FT                   SGANARDARVGAGAEADIEADIEAGIEAGVGVGTDAHAAGGARTRGEIAARGGATMRGH
FT                   APASGAVRATSERAPAAATADAHAPPAAAESAPPSVPMPAAHAAPRTSGGSARDIAAAA
FT                   ARICATAADPAAGVVASRSPALPAARGPASATAAASAMSAMSSTRRPTAAASPGAARER
FT                   VDGDDSNRAGDASLAGLPRGVQPQASLRAAEPAARAHDPSRAARQRAQAGAAQADARDV
FT                   RETQGTQVRYSFNSWDGRPAVELRFDAGGAPRVVNAQPSHDRVQRAMEHGADRLSPGWT
FT                   VEFDRSRADDDSGGRSPWRRARQEPEADER"
FT   gene            complement(773016..773480)
FT                   /gene="bsaT"
FT                   /locus_tag="BURPS1710b_A0581"
FT   CDS_pept        complement(773016..773480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaT"
FT                   /locus_tag="BURPS1710b_A0581"
FT                   /product="surface presentation of antigens protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52896"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL13"
FT                   /protein_id="ABA52896.1"
FT                   /translation="MKRLDGARRLLAVLERRGDALRRQAARERGALAALDARIAERRAA
FT                   IAQLCERLAASVPPRPYARSELMRVRGKQAAIRHAIACQQIEVDDLLERRQAAEQALRD
FT                   SLAAALGLERRRNAHRDWLARRRIETERRRESAAEADITEGAGHGFNHQQ"
FT   gene            complement(773477..774784)
FT                   /gene="bsaS"
FT                   /locus_tag="BURPS1710b_A0582"
FT   CDS_pept        complement(773477..774784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaS"
FT                   /locus_tag="BURPS1710b_A0582"
FT                   /product="surface presentation of antigens protein"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF02874; match to protein
FT                   family HMM TIGR01026"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABA52368"
FT                   /db_xref="GOA:Q3JL12"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL12"
FT                   /protein_id="ABA52368.1"
FT                   /translation="MKAAGDPLRLLARRAHPRRIQGPIIEAPLPEVAIGELCAIRAAAG
FT                   SDTTIGRAQVVGFGRDTAILSTLGSTAGLSRQVALVPTGERMTIDVSPALLGAVVDATG
FT                   GIVETFGAPPPAGAAPGRRAIDAAPPDYAARRPIERRLATGVRAIDGLLACGVGQRFGI
FT                   FAAAGCGKTSLMNMMIEHAAADVYVVALIGERGREVSEFVERMRRSGSRDRTVVVYATS
FT                   DRSSVDRCNAALVATTIAEYFRDLGCDVMLFLDSMTRYARALRDLALATGEAPARRGYP
FT                   ASVFEQLPRLLERPGRTRAGSITAFYTVLLENEEEPDPIGDEIRSIVDGHVYLSRQLGA
FT                   KGHFPAIDVLRSASRLFDEIADAPHRALAKRFRQHLARIDEMQVFLDLGEYRRGENPEN
FT                   DDALDRRPALDAFLQQAVDEASAFGDTLERLSEAAS"
FT   gene            complement(774781..775188)
FT                   /gene="bsaR"
FT                   /locus_tag="BURPS1710b_A0583"
FT   CDS_pept        complement(774781..775188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaR"
FT                   /locus_tag="BURPS1710b_A0583"
FT                   /product="surface presentation of antigens protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53440"
FT                   /db_xref="InterPro:IPR003065"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL11"
FT                   /protein_id="ABA53440.1"
FT                   /translation="MNVDVVMLVKESMEKMDCGNAIAGELDAHAPICIAFHSMPEMFVE
FT                   RDGEHVTIWSRLGCAGESQLARCAFDLLAYQLPRGSDAFASRRPLLSFVDDALVLHGRV
FT                   EPRCLADAEGFTEALETFYADLCAVSEILAR"
FT   gene            complement(775200..777272)
FT                   /gene="bsaQ"
FT                   /locus_tag="BURPS1710b_A0584"
FT   CDS_pept        complement(775200..777272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaQ"
FT                   /locus_tag="BURPS1710b_A0584"
FT                   /product="type III secretion system protein BsaQ"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01399"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABA53525"
FT                   /db_xref="GOA:Q3JL10"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL10"
FT                   /protein_id="ABA53525.1"
FT                   /translation="MLKNLLIKAQARPELIVLCLMVLVIAMLIVPLPPYVLDFLIGLNI
FT                   VTALLVFMGSFYIVNILEFSTFPPILLITTLFRLALSISTSRMILLTAEGGKIITTFGQ
FT                   FVIGDNLVVGFVVFVIVTIVQFIVITKGSERVAEVAARFSLDAMPGKQMSIDADLRAGI
FT                   IDNEGVKARRSALERESQLYGSFDGAMKFIKGDAIAGIVVIFVNLIGGISVGVMQHGMS
FT                   VSDALTTYTILSIGDGLVAQIPALLIAIGAGFVVTRVGGSGNNLGANIVGELFSNPFVL
FT                   VVTAVLALAIGLLPGFPLIVFLLIALALGALYVRREWRKPGEPAREGGLVGKVAGALSG
FT                   GGAAKAADGGAGDVDIDKLIPETVPLMLMVPEAAQPMFEQEGVIGAFRRRAFVDMGLRL
FT                   PDIRVVYSPQVHPREAIVLINEIRAATFAICFDRHRVVGSTLALEGLPVDVVTLPDGAG
FT                   GDAWWVPGAQTDALAKIDVLTRSAIDDLYGQFLAVMLANVSEFFGVQEAKRLLDDMDQK
FT                   YPELIKESYRHISVQRIAEVFQRLLAEKISIRNMKLILESLAQWGPKEKDSILLVEHVR
FT                   AALARYISNRFAAGGKLRALVLSAQFEDAVGKGVRQTSGGAYLNLEPATSEQLLDRLAL
FT                   ELARAGFSQRDMVLLASMEVRRFVKRLIESRFPELEVLSFGEVADSVAIDVLKTI"
FT   gene            complement(777308..780289)
FT                   /gene="bsaO"
FT                   /locus_tag="BURPS1710b_A0585"
FT   CDS_pept        complement(777308..780289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaO"
FT                   /locus_tag="BURPS1710b_A0585"
FT                   /product="Type III secretion system protein"
FT                   /note="identified by match to protein family HMM PF02523;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02511; match to protein family HMM
FT                   TIGR02568"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51884"
FT                   /db_xref="GOA:Q3JL09"
FT                   /db_xref="InterPro:IPR003520"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JL09"
FT                   /protein_id="ABA51884.1"
FT                   /translation="MMYADTARRYAAALAASLLMTGAAFAAPTDAAPLADAPAAASATP
FT                   DARDGDASRVAAPQDDERHFVANDASISVLLNALSGRLHKPIVASEKVRRKHVTGEFDL
FT                   AQPRALLARLGESMSLLWYDDGASIYIYDNSEIKNAVVSMRHATVRNLRDFIRQTRLYD
FT                   PRFPVRGDDLSNTFYVTGAPVYVNLVAAAARYLDEVRSNEASDRQVVRVVQLHNSFVVD
FT                   RQYTLRDKEVDIPGMATVLGRIFGPARPGAPADSPVAAADATARGGAGGAAGKPAFSLA
FT                   DAFARAARRRQRAGRRGLDAFDKPGERREPDGRRGGRRRAARVGRRARGGVSGHQQRDP
FT                   RRPARQGAGHGGADPLARCREAADRAVAVDHRHPQEPARSARHRLAGCAQCAGYRRRLQ
FT                   QSRRQRDDARRHQVPRIGRGAQPDGRRHRDLAADRAHAGERAGDVRQQPDVLREADRRA
FT                   HGAARSRDLRHARQRAAAAHARWVAGRDDRRHRGRQHRRRDERRPDRHRQQHDAAREPH
FT                   RDQHGRARAARDEPAHRRQHARRRHAPHVPDSRAGQHSADRRAVSRAFGSARAGGARVP
FT                   DPAEAAARGRGLARRPAVGIGRSGGQRDAARDRADAQTLHGRQVMSSIIGGASAARRGF
FT                   SIDGTGSAANRLDAEPSLDDAPQTGAAGAADVQAQLAGVDEEAANAAAQFGRFRASERK
FT                   GRRSDELERILDTDADEKLDELAALLGGRAARGRADLATLLRDARERFRDESDLLLALR
FT                   ELRRRRRLDGESVDALERAIDELLAGDGAKRIKAGINAALKAKVFGARMQLDARRLREL
FT                   YRQFLEFDGSHLVIYEDWIEQFGASRRKRILDYVSAALSYDMQSHDPSCGCAAEFGPLL
FT                   GTLHRARMLASADEQFVGRLLDDALARDCGLTEARALATMLGGLQRPFSVADVLLGTLG
FT                   DLLEPLAPARRSQLLQLALRAFAGVPIALYGDADARRAALGALEELIGATYARERRQAR
FT                   PRAD"
FT   gene            complement(778426..779445)
FT                   /locus_tag="BURPS1710b_A0586"
FT   CDS_pept        complement(778426..779445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_A0586"
FT