(data stored in ACNUC7421 zone)

EMBL: CP000150

ID   CP000150; SV 1; circular; genomic DNA; STD; PRO; 1395069 BP.
XX
AC   CP000150; AAEI01000000-AAEI01000060;
XX
PR   Project:PRJNA10695;
XX
DT   21-OCT-2005 (Rel. 85, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 9)
XX
DE   Burkholderia lata strain 383 chromosome 3, complete sequence.
XX
KW   .
XX
OS   Burkholderia lata
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1395069
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Kyrpides N., Lykidis A.,
RA   Richardson P.;
RT   "Complete sequence of chromosome 3 of Burkholderia sp. 383";
RL   Unpublished.
XX
RN   [2]
RP   1-1395069
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Kyrpides N., Lykidis A.,
RA   Richardson P.;
RT   ;
RL   Submitted (11-OCT-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2400 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-1395069
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Kyrpides N., Lykidis A.,
RA   Richardson P.;
RT   ;
RL   Submitted (02-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2400 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; df282288111b31d31406cce3dca3d8b5.
DR   BioSample; SAMN02598262.
DR   EnsemblGenomes-Gn; Bcep18194_CR0084.
DR   EnsemblGenomes-Gn; Bcep18194_CR0085.
DR   EnsemblGenomes-Gn; Bcep18194_CR0086.
DR   EnsemblGenomes-Gn; Bcep18194_CR0087.
DR   EnsemblGenomes-Gn; Bcep18194_CR0088.
DR   EnsemblGenomes-Gn; EBG00001107614.
DR   EnsemblGenomes-Gn; EBG00001107615.
DR   EnsemblGenomes-Gn; EBG00001107616.
DR   EnsemblGenomes-Gn; EBG00001107617.
DR   EnsemblGenomes-Gn; EBG00001107618.
DR   EnsemblGenomes-Gn; EBG00001107619.
DR   EnsemblGenomes-Gn; EBG00001107620.
DR   EnsemblGenomes-Gn; EBG00001107621.
DR   EnsemblGenomes-Tr; Bcep18194_CR0084-1.
DR   EnsemblGenomes-Tr; Bcep18194_CR0085-1.
DR   EnsemblGenomes-Tr; Bcep18194_CR0086-1.
DR   EnsemblGenomes-Tr; Bcep18194_CR0087-1.
DR   EnsemblGenomes-Tr; Bcep18194_CR0088-1.
DR   EnsemblGenomes-Tr; EBT00001699365.
DR   EnsemblGenomes-Tr; EBT00001699366.
DR   EnsemblGenomes-Tr; EBT00001699367.
DR   EnsemblGenomes-Tr; EBT00001699368.
DR   EnsemblGenomes-Tr; EBT00001699369.
DR   EnsemblGenomes-Tr; EBT00001699370.
DR   EnsemblGenomes-Tr; EBT00001699371.
DR   EnsemblGenomes-Tr; EBT00001699372.
DR   EuropePMC; PMC1847439; 17362501.
DR   EuropePMC; PMC2168197; 17905875.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000150.
DR   SILVA-SSU; CP000150.
DR   StrainInfo; 299650; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Jim Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1395069
FT                   /organism="Burkholderia lata"
FT                   /chromosome="3"
FT                   /strain="383"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:482957"
FT                   /type_material="type strain of Burkholderia lata"
FT   gene            537..845
FT                   /locus_tag="Bcep18194_C6524"
FT   CDS_pept        537..845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6524"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05575"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PP1"
FT                   /protein_id="ABB05575.1"
FT                   /translation="MRIQIRKLTLAATAAAFLFGSAVPAFAQTDASAPAAQDAKAAKSQ
FT                   ARKAARAQRKAEHKAARAKNTAELKKLEDAGYKPAANDPNYPQNLQNAQKKAAGAGQ"
FT   gene            complement(1025..1930)
FT                   /locus_tag="Bcep18194_C6525"
FT   CDS_pept        complement(1025..1930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6525"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6525"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05576"
FT                   /db_xref="GOA:Q39PP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PP0"
FT                   /protein_id="ABB05576.1"
FT                   /translation="MARRLPPLNSLRAFEAAARLGSFTLAADELCVTHGAISRHVQQLE
FT                   AWLGRPLFERHNRRVELTDSGRAYLAEVGASFDRIALATAQHFGHAQQRVLRVSAPATF
FT                   SLRWLVPKLSSFQVAHPAIEVRLSTSNEPIDKLRDKVDLIVRGGPQAIDGYVAEEFLSE
FT                   VRLPVCAPKLLEGRPLHTPADLAGFTLLHAATYPGMWPEWLAAAGQPNLVPRHSLTLEH
FT                   FYLTLQGALDGLGVAMGPIALVADDIAEGRLVQPFSEPALPPWRYFTYVASARANDEAV
FT                   RAFKEWLKVTGNAAAPLGPS"
FT   gene            2070..3368
FT                   /locus_tag="Bcep18194_C6526"
FT   CDS_pept        2070..3368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6526"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6526"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05577"
FT                   /db_xref="GOA:Q39PN9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39PN9"
FT                   /protein_id="ABB05577.1"
FT                   /translation="MPNVVVVGAQWGDEGKGRVVDWLAAQADLVARYNGGHNAGHTLVV
FT                   GGKTYKLALLPSGVVRGKRGVIGNGVALDPEALLAEIGRMAELGLSVTPDNLSIAENAT
FT                   LVLPIHRAIDQAQERLRREPIGTTLRGIGPAYEDKVGRRGLRVGDLAEPGRLAAKLDVL
FT                   VDHHNAWFRGLGLDEYSRDAMLATLVDLAPRILPFVRPVWADLNDATDRGERILFEGSQ
FT                   AVMLDIDWGTYPFVTSSGTVASAAAAGTGLGASKLGHVLGVTKAYATRVGGGPFLTELS
FT                   DATGETLRARGQEFGVNTGRPRRCGWLDAAQLRQAVRISGIDSLALTKLDVLDGFESIE
FT                   LCVGYEFDGARVDHLPASLDAQSRAKPVYERFDGWRGTVKGVRERAALPRAAQDFIARV
FT                   EAVAGAPVSMITTGAERDDTIVLRNPFDAAAGA"
FT   gene            3668..4609
FT                   /locus_tag="Bcep18194_C6527"
FT   CDS_pept        3668..4609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6527"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6527"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05578"
FT                   /db_xref="GOA:Q39PN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN8"
FT                   /protein_id="ABB05578.1"
FT                   /translation="MDTLQMMRIFVRVAEEGSFTSAAQRLDITTAYASRSVAQLETHLR
FT                   TRLLNRSTRRIALTDAGQRYLDRCQRILGYIEEAESEAADAQAKPSGRLHVHATTSFGQ
FT                   AYVVPAVVRYRQRYPSVAVELTLSQHVPDIIDEGYDVSLQLSATELPDSGLVSQRLGEV
FT                   HSVLCASPAYLKERGTPRTVRELDGHACLQIVTPVFPRDRWHLDGPDGPETFDLPLPDF
FT                   QVNIADALGAALRAGLGIGSLPMSSALPALASGALVRVLPDYRLQKLTVYTLYASRQYL
FT                   DAKIRTFVDFLRECVPEMLATDEAALHASCKS"
FT   gene            4876..5847
FT                   /locus_tag="Bcep18194_C6528"
FT   CDS_pept        4876..5847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6528"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6528"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05579"
FT                   /db_xref="GOA:Q39PN7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN7"
FT                   /protein_id="ABB05579.1"
FT                   /translation="MADQHSTTRRRLLHAGLAIAAGAAVHPGFALASTAGVRTLRIGYQ
FT                   KGPLSLLKARGTLQSKLATLGVTVTWTEFPSGPPQLEALNAGSIDFGDVGEAPPIFALA
FT                   AGAPLVYYAQTPAGPAAEALVVAKDSPVKTFADLRGKRIALVKGSNTHFLLVRLLQAAK
FT                   LNYADISPVWLSPSDARAAFENRSVDAWIIWDPFLAVVQQAFGARIVADGTGLVENRGY
FT                   YFASRTYAQHNADVLDVAVSELTAVQRWLDANRAQGAAEFSKLWGIPEPAVALAFRRAR
FT                   FGVEPVTRDTLAYQQRIADVFYQAGVLPKRVDVSLAAPPALA"
FT   gene            complement(5860..7278)
FT                   /locus_tag="Bcep18194_C6529"
FT   CDS_pept        complement(5860..7278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6529"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6529"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05580"
FT                   /db_xref="GOA:Q39PN6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN6"
FT                   /protein_id="ABB05580.1"
FT                   /translation="MTSLALDFIDSQRAQFTELSDRIWNLAELRYEEFASTDLHIRMLE
FT                   EAGFRVTRGVADIPTAFVAEAGDGGPVIGILGEYDALSGLSQEAGALTCQPSGEISNGN
FT                   GHGCGHHLLGTAAHLAATAVKAHLERTGQPGTVRFYGCPAEEGGSGKTFMARAGVFDDL
FT                   DAALSWHPHVYTGIFPAGSLANIQAYFRFTGKASHAAASPHLGRSALDAVELMNVGVNY
FT                   LREHMLPEARVHYAVTNTGGLSPNVVQANAEVLYLVRAARNDQAAELFERVKNVARGAA
FT                   MMTDCRLEIVFDKACSNLLENAVLNQVMYRHLQSIGTAGFDADDAALADTYQRQTLTAQ
FT                   DIETSSRSLNQAWRNPKALFDGIDPYEPGKGRPICGSTDVGDVSWVTPTAQCHTSCYAF
FT                   GTPPHSWQWVAQGKTPLAHKGMLLAAKTMAATAIDLLGAPDTLAQAKAELLERRGGRPY
FT                   VCPIPDDVALPFRR"
FT   gene            complement(7308..8561)
FT                   /locus_tag="Bcep18194_C6530"
FT   CDS_pept        complement(7308..8561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6530"
FT                   /product="outer membrane protein, (porin)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6530"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05581"
FT                   /db_xref="GOA:Q39PN5"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN5"
FT                   /protein_id="ABB05581.1"
FT                   /translation="MALPRTPGRLASRRPLNSAPLHSRRRRIPAAPPTIRQQNPRRRRV
FT                   RGRALARLRFARRRSRHHETNVRNSTLMAACCAATCMWAAPARANVQIYGALDSFLQYA
FT                   RIGSQTSVGLMSGGASTSRFGFIGSEDLGGGLRASFRLESGFDLMSGRPQSAASFYNRE
FT                   ANVAIGSADWGTIKLGKQYPAIVPEAADPFYLVGQLSPFASTALIGSDLGRGAASLPGR
FT                   IENAISYKTPTYGGLDVTVLYAFRNAAGASPIASNAGAVANFARGPVMLSGAYNAMWAA
FT                   TSSTPGGAPDGPRTDSVMASASYAFGPTLASFAYTLMRPTAPGTLVAQVYSLGAIWQRG
FT                   PHAIRADLAYRTIAGQASHALGALLGYDYQFSKLTGVYVRLGGFRNTGQSALSFGSAPM
FT                   SAPGMSSTVFALGLRQKF"
FT   gene            complement(8513..9904)
FT                   /locus_tag="Bcep18194_C6531"
FT   CDS_pept        complement(8513..9904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6531"
FT                   /product="Major facilitator superfamily, (MFS_1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6531"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05582"
FT                   /db_xref="GOA:Q39PN4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN4"
FT                   /protein_id="ABB05582.1"
FT                   /translation="MRPALAGCLTIHAALTIPIPMETSPMQDAATPLVDAPPAPRRRSA
FT                   QTRTIIATSAGNALEMFDFTVFSYFAALIGKTFFPVDSGAGPLLLAMATFGVGFVMRPL
FT                   GGVLIGNYADRAGRRAALTLTIQLMIAGTALIALTPSYAHIGVVAPVLVVIGRLLQGLS
FT                   AGGEIGASTTFLMESGPLSGRGFMVSWQMISQGVAALLGALSGALLSAVLSADALESWG
FT                   WRVPFLLGLLLGPVGFYIRRHLDETHVPTHDADGSAVREVFTRYLGRVVLGTLMIIGGT
FT                   STLYIFVFYMPAYAVRTLHLPMATSLLAGCASGLAMIVAALVSGLWIIDRLPRRKPMIA
FT                   VTWLLSLACVYPAFRLLIAAPSVGLMVAIVTVVMAFATAGSSAFLLLIMEAFPPRVRAT
FT                   ALATIYSFGVTIFGGFAQFNVTWLLHRTGDPMSPAWYVLACGAVSMIALWRFRERPADS
FT                   HHDGR"
FT   gene            10402..11229
FT                   /locus_tag="Bcep18194_C6532"
FT   CDS_pept        10402..11229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6532"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05583"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN3"
FT                   /protein_id="ABB05583.1"
FT                   /translation="MGQQQDLYDRWKRAKAQLNDLFKKPENTLIVHYSCESFYDQTKAD
FT                   SPRVTSIAVRNLQSGQTHSFSIHFAAERAHALDQIENRYDEFEQAMLTDFFAFARDHQF
FT                   HTWLHWNMRDMNYGFPALEHRAAVLGSQSFHIDEKQLVDLSRVLIAIYGNKYTGHPRIQ
FT                   SLMEKNHITPRDFMVGQSEADAFEQKRFLDMHRSTLSKVDVFANFAERAHSGTLKTNAN
FT                   WFERNGRSFKAGIEKIREHWFWGALIAVGFGAWNYRDQIVQIWGWALKHLGHG"
FT   gene            11249..12616
FT                   /locus_tag="Bcep18194_C6533"
FT   CDS_pept        11249..12616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6533"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05584"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN2"
FT                   /protein_id="ABB05584.1"
FT                   /translation="MRSAVLLDVLHSSTKQRGMNVRSFNSVVDEARLVASPAETVAKYL
FT                   EDRGVQVAKQPFSDTVDEQFEQALLERHDPLIDLALARWCCYLPTGRALLAANAGDGTH
FT                   ALAIRLSLLSNVAVGASFMSNGPMEFFANSPMDWFPSATDEELTAFFKNPSLSNEFFEA
FT                   FFNGGPSWTCLSEPQRLTALRAVTGNPRMRIPYDQAFADGYAEFLHNKVFEAAWNMATT
FT                   VPNTRVWAFTLGWLFDVLLPVGHGIDDPLTSAARWTPDDDEGIKHGSLSSFQNVRKGLA
FT                   RLALAKNAKRTDEFLTSDDPALRAAVYASSPLSTDQIACAVERDGAMGFDEMVRNTKLW
FT                   REQEHRDALRAASWVVINADSHSDLLPHNLFTRMRERMEHEHPSWFSNVVACDPDDLDL
FT                   PATRADMHRVLETLTGSNTGLGLQQVSASIQALNKRLGWVWWFSLGALLATASHWL"
FT   gene            complement(12906..14003)
FT                   /locus_tag="Bcep18194_C6534"
FT   CDS_pept        complement(12906..14003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6534"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05585"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN1"
FT                   /protein_id="ABB05585.1"
FT                   /translation="MAAENIEKLVNVLRQQTRKSTVLQGGTLIDRLTHATGLDAAAIRA
FT                   GFKDMRTRGWIEASSWSGTGNPVGRVKVNLPPLPPPSWAEGWKDALITCERLSDSDRDA
FT                   LFECGASLADMDASEFPKILDGLIRLREDQLALAGSPAYLVSARYLRGSSKMLSKLGAR
FT                   AIKAFGIDLSRFPYHPPYVITAGASNPEAVVLVENPAAFELAVTTSAIEHCAFIATFGF
FT                   GLSKASEDFGNQLAGMVEEYFYSAVTLVREGSRTPSARELLNHPNITFWGDLDIAGMEI
FT                   HERIAKRHSHVRLSALYGPMLEAVLVEDNRHPYVSAVGKSGQAMFRATRSDALAMLRYC
FT                   NEWAADQELVTANQIEEFAGKPLAI"
FT   gene            complement(14010..19049)
FT                   /locus_tag="Bcep18194_C6535"
FT   CDS_pept        complement(14010..19049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6535"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05586"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PN0"
FT                   /protein_id="ABB05586.1"
FT                   /translation="MISALLYLLSRDTKLKGIALPLFTPRRCGAPSHIRVQLWDLQDDL
FT                   SQTDLNLDEGLLDPKDLPNKNDHHVFGLCAYQGDEPRFYYYRGVLEDCPVFDRTEGGYL
FT                   YHHEAEVQQVVKLVGGTWNISSVHEWRSLITSHIPSRVLAQQVKFHLAGGGDKSAQLHQ
FT                   VEVDGDESFDQAFFRTVIAQELLISTSEPESDPDDPRENFEDLLYAHFSKMASATIKAE
FT                   QEQQVIREQEGIVHDLAGLVIAGEKANEGHGEYQRLIANIARDGALVWHFVRNDPLPGL
FT                   LDVRRQPSGRVGEIVPYIVIDKIYGAMILDAGLEKLTNVEASALNQVSGRQRLLKQEVD
FT                   QTQVIDFACNLDLKTSPKGGGYARKGYTLDTALELVPLLREVGTARLAGATDTLKQAFA
FT                   WVENTADTNSYRTIARRLATEIKQHQEEIRCRASEIVEWEIEVRELSDRITKYDQAKGA
FT                   YEDLATSGHFTSDELNAPELLTDQVKKELRAAEGALSDHDKRVGSLESIFDSHRAFCQK
FT                   NAGIPARTRLEELSARATSTRDDRTHAEQRLERSKAELAQLNVSKVEQEGQYKQNQQQL
FT                   DVLLELQSHQPAYTKWFGDTLPHDIDIRGNIKEITDDEKALAQRREERERFLHTISVLS
FT                   LTVPRYRELFGDADAESIDISGALQNISTQEKALGARRGAADALHTRIQSLKSFVEIFH
FT                   RIFGNTDPTMLDPGQERADLQKDIALTEAVVESLGSQVSRLNLFRDEHPGWTAAAWLAD
FT                   MESQRATRLRQIAQYNQQILTAERQLAELMSDPVARPEDVACAHALLDEAVPFVPLHIF
FT                   VESHCPPTVKQQWLTHFSALLFAPVVESIEEAAEAARILHDGQFMMPVLIASRLRDVME
FT                   SDAPALALEGECAYTWLAGIKTRLVHCLLNPAAVEEERTLAKQRLSELRELLAREEEAL
FT                   GHLSETSPSVLLARDAARAETSNAETELTASSERFKELRKQLPDVLARNSSEALDSIQN
FT                   TREYQSLIRQHGENVAERIEEELHQLDEQADVLRQAREWHEARNSDTVREVIMDMRRYQ
FT                   ALLAEHGVDALQKATQDLQKIAEEAEDLRRSREWYEARDQDDIHAAVSAMRRYRDVDGD
FT                   AEVVRLENVVKVSTEKLSAIATKIVSATHNVNEDENHLSTARDTESNASAAYLENKQYL
FT                   EALVSFSESKDLAFMETHEESRISLEIDKRRADARKSYQSQFPHAQRYVNATRDGQTSE
FT                   QELLTRKASVEIKVTEANRQQEQDRLVVEEKIERRDTLKNYQDALHEAACQLLGEFRAV
FT                   SNSLNEIRAAVTEGAPRFENTALYQHADSIRGKLERADGDPFFLDDIRTISRLAGELGL
FT                   AGQSKDIAQARRLTERLTREYQDRKSSFCTEIITGTRRGLSVLNAEWLLSQDRFDAPLE
FT                   MKTQIEVSLASNRALLQQATTSLEFARDKTTEMLTILAKDAERALSILDEAMTTTPTSR
FT                   FYVNANVITEDKIGDLLDHLYSNIEAEMRRKADSSSLVAEKRHRKRALDELRTEVYRSL
FT                   FSDVSVEFRHPSIWEGGQHPLTSKGLSEGMRTAISLMWIAKLAEFRLRQAIDQAGGMRR
FT                   QNRAALRKERYFVILDGLFSNLSHDDMIDSAMESLRLSAGHFQLIGMIHHPRYINNPKI
FT                   FPAYFVGRPYRANGGKHSWLTVDPHKAPPGSLGVFGSQFSS"
FT   gene            complement(19216..19998)
FT                   /locus_tag="Bcep18194_C6536"
FT   CDS_pept        complement(19216..19998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6536"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05587"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM9"
FT                   /protein_id="ABB05587.1"
FT                   /translation="MDTEDIGRVVAYLLQHRIVETRPASGRSSDEERAVAKLLTSMIPD
FT                   ERRSLDRMFAGMRLGFVDFDWDAIPALPKGGRVFLLARDIGKGEPPGVLSPGVVIEAMR
FT                   EKGNEPAREAAAWFVHLWLVHLDLIYTDQERSPSQMQTYPKGMFDFDVFLGRVRSHFED
FT                   LRQGLDRNEVPADAVFKTFEKASHAEGERRCRRFVNLMLDAGLLTTIAKDLYQQTLLSA
FT                   YEIKRNYERGLQQFVTDASSKKYKMATSILTGIDIDSI"
FT   gene            complement(19998..21377)
FT                   /locus_tag="Bcep18194_C6537"
FT   CDS_pept        complement(19998..21377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6537"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05588"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM8"
FT                   /protein_id="ABB05588.1"
FT                   /translation="MDWIPLIASTARLIDLHDSNRTAGHAASQYDLYREARTGNQNGLW
FT                   LDVGLTVIEYLRERENEVVGGFVSGTEVREALQKRIAGLTDEDVRFVLSVLTTPAELWF
FT                   VERMDNGGRPINSTKETNLVERSRTADAYRLAPAGRTASGLAANVRDIAYIAGSAKNLL
FT                   TAIKARDFWKITELSAAIIDVLRAFRLEIESRREGGRLNGVQAFFKERGEVIKEQIEEA
FT                   TEILMEASEFLSLQSTRNEFQAWIGAMDRIGKPSFGHGYAIEHLRRVAEQTLKLLESFT
FT                   QLVDESLAVDGPVCQTVSFIDLSTSLAAQPFQERLYFALICSFGPTSLRQPMPCIFDFL
FT                   GIVEPRQIADTREEDVDAHGTEDIGVRAISFVAEHGAAILTELRRGPLSLTDALKHEWI
FT                   RLGSSGMNDLSALIGTYCDPSMLGADLNIVVRLGSGRDVFESDAIGRLTFDNLVMVMEE
FT                   A"
FT   gene            21510..22316
FT                   /locus_tag="Bcep18194_C6538"
FT   CDS_pept        21510..22316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6538"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05589"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM7"
FT                   /protein_id="ABB05589.1"
FT                   /translation="MSKDISSPAAADLPFTVRQRLEHIERCLLWKGELQRADLVDRFGV
FT                   NPAQAATDFSTYMAVAVGNMDYNKSRKRYLPTPGFKPRFIQPQSLDEFVPMASSLVRVE
FT                   PWPLPQRAASSETLQAVVRAIREKEALEVRYQSMTDPKSSWRWLSPHAFASDGERWHVR
FT                   AFCHKHEEFRDFVLGRIIATRRTRSTDVVADQDTDWQTFATVIVKPNPQLSEEQCAAIA
FT                   AEYNMPRSQKMELRLRRSMLFYLEARFMPKPDWVAEAHQLIVAEIK"
FT   gene            22618..23097
FT                   /locus_tag="Bcep18194_C6539"
FT   CDS_pept        22618..23097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6539"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6539"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05590"
FT                   /db_xref="GOA:Q39PM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM6"
FT                   /protein_id="ABB05590.1"
FT                   /translation="MENIVRVLVIEDDASIATNLYDHPEGAGYGVDMAMSGPAGRKLAV
FT                   SQTWDAILLGTSLPGMDGLTLCRKLREENHRDTPVLMLMARGTLDDKLDGFGHGADDYL
FT                   VKPFSLKEVGARLGALVKGYRGQVAEIALCWAPGSLMLPGQDACCLAPVVLDQRN"
FT   gene            23597..23938
FT                   /locus_tag="Bcep18194_C6540"
FT   CDS_pept        23597..23938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6540"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6540"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05591"
FT                   /db_xref="GOA:Q39PM5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM5"
FT                   /protein_id="ABB05591.1"
FT                   /translation="MTQRPWMRTHHIGTIEAMPASLKGPDPNQRLVSLRDVLAFNVRVV
FT                   RVRNMLSQEQLGFAADLDRTFISQVERARINVSLDNIERIARALGVAAYILLQRPDETP
FT                   ALVAETQPK"
FT   gene            24442..24798
FT                   /locus_tag="Bcep18194_C6541"
FT   CDS_pept        24442..24798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6541"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6541"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05592"
FT                   /db_xref="GOA:Q39PM4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM4"
FT                   /protein_id="ABB05592.1"
FT                   /translation="MTPFSNALVYYRKRAGLSQTNVAKQLGVAIQYLWKLERAIKPPPS
FT                   TEQIERIAAVLGMTEADIASLLEAALDSQRRVRLPDDLHSDTLRLINRLVRASTRLNVD
FT                   EVTMLDELVTRLDR"
FT   gene            25081..25716
FT                   /locus_tag="Bcep18194_C6542"
FT   CDS_pept        25081..25716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6542"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05593"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM3"
FT                   /protein_id="ABB05593.1"
FT                   /translation="MPSYDTRSGGNFRGFTPSVKNACSMPWYSLAEEASTLLLEFSPDV
FT                   LRFRGAQDRTFLLREAGQTFRYTPDYQIVRRDGSTVFVEAKPAKDLQKPSVQARMARAR
FT                   AVLAEHGYALFIWDERTYICGTRHETLRLLRPWRGRMSAERIREAQWLVEKTHPKTFRN
FT                   LVHLARTRDVALTWIANGAAGIDLDVPLTSDAAIYVAPSEVRHAEIFA"
FT   gene            25697..27646
FT                   /locus_tag="Bcep18194_C6543"
FT   CDS_pept        25697..27646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6543"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05594"
FT                   /db_xref="GOA:Q39PM2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM2"
FT                   /protein_id="ABB05594.1"
FT                   /translation="MQKFLLKRGVEFQEGEYVWRVQGGLPDGRIEFSSDYNSPIRIPET
FT                   EVWERHSNGRWSVRIESLLETGASPIIVARRDVSTFEEKDIVVMRARLVYLRAVEEAKC
FT                   SRVREVETVIRRVACEVGALTPPNYRTFCRWKKRYQHSRDVMDVVPRHENKGRREILEG
FT                   PLLTLVEDVIETHYLNDQKLNVARLFDRVEEAIALQNERDPENPLPTISRATIYRHVEK
FT                   LNSYLVTAAREGRTEALKRYRPVFRRLKTKRLNERWEIDHTPVDLMCVCERTRMVIVRP
FT                   VLTVIIDAHTRMVMGFHIGARSPGQEEVGWAMRMAMLSKRDLLNRLGMGHLEWRARGVA
FT                   EMVVGDNAWEFHGSAMRAGCDELGISLMYCPKRAPWFKGRVERFMRTISEQLFHTIPGT
FT                   TWSNTTERGEYPSEKLACVSLDELTALVVRWIVECYQHAPHRGLKNKTPLQAWQESARL
FT                   TPIYMPADPDQLSIAFSDDIMRPITNSGVTFDHLSYNSSALQLLRHSIPECEKVKVRYF
FT                   NEQTGYVYVYDTRQKEYFRVDCTDPDYTKDLTRWMHNEVTDGMRNSRIDISSVSLRKAR
FT                   IRLADDIARAELDQKLKKRKWVAQIKGKSSKDPVSGVDGGMGVDDSVRSDQVDPAVVKF
FT                   NSIPEFLVMKRTER"
FT   gene            27657..28565
FT                   /locus_tag="Bcep18194_C6544"
FT   CDS_pept        27657..28565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6544"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05595"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM1"
FT                   /protein_id="ABB05595.1"
FT                   /translation="MKRFNVRKSIVEHPDFVAALKSIEDIHQWLRESGEAGCLATVGES
FT                   GAGKSTVLECYRARFPMREEVLRRHVPVLYVIVPAVPTVRSLAEAILIALGELPQAGQS
FT                   SARLTEQIVKLVHGCGVEIIMLDEFQHFVEGDRRSLRQVSNWLKVLLDRLPTAVVLSGL
FT                   PSLLGVLRVNGQLRRRFSRVTEIRPFDVSTQEGAETFIGVMQALAKDMPLPMVDITDKR
FT                   VAMKLYYATAGLVDYICKLLNGACLIAERRGAKNVGLNDFAEAFLIHIWKDAPPARNPF
FT                   DARFKGGPLDKPGEPFAGDVQ"
FT   gene            28562..29530
FT                   /locus_tag="Bcep18194_C6545"
FT   CDS_pept        28562..29530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6545"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05596"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PM0"
FT                   /protein_id="ABB05596.1"
FT                   /translation="MTTPLLLSVAPHRGESLSSLLHRVAEVNGLSGPGMVLRRAGVAAV
FT                   RPRFPSDADALARVCRLSPKLVRAITPLTVGAIDRNGTKHVKVGMYGHWVEPSLVMVGE
FT                   NERVCPACIAEHKHVLGVNAYVFATSCAVHGVRLLDRCPNCKRELSCLRLSLTRCQCGS
FT                   DLGSATCQPVEQGEMMIARLIDRRWRMSFERDVPSFPHDAPLDFRALDLGELLRALSFL
FT                   YRTSGATNGSPDKGLRSKAIHELAPRMQKVGRVMLNWPIGFTELVKAERLYRPRSVSRV
FT                   VVARSVEHISLRLFTELPEPKFAFLHTALVDAIDRNVTRAV"
FT   gene            29622..29897
FT                   /locus_tag="Bcep18194_C6546"
FT   CDS_pept        29622..29897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6546"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05597"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL9"
FT                   /protein_id="ABB05597.1"
FT                   /translation="MNACRCGACRSDCMIKRLPDDVWNRLVSLVQQMVDESGEPEGFDA
FT                   RKWLCTWLHEEVPSLGWKKPVAYLDTTDGEALVIATLKSLQSGAYR"
FT   gene            complement(30528..31769)
FT                   /locus_tag="Bcep18194_C6547"
FT   CDS_pept        complement(30528..31769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6547"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6547"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05598"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL8"
FT                   /protein_id="ABB05598.1"
FT                   /translation="MTTAIPEISPTLRQWTASVAEHNDTFVERVYNTLMNIKPYADLDA
FT                   TTLLDVRDTIVLSSKLWLDSLVSGKMPSEEALEGFRAHGRRRVYQGVPLEALLRAFRLG
FT                   SRELWCVYIGVAGENDALRDELLLRISPYLLEFCDILSQEIAQTFLEEQYKQARWRESL
FT                   RYQLHGIILNFPDDTEGFNKTAAALRLDVAVPRVALAIDIELIDNNSATIRNEIDRIVA
FT                   AAAQCLRLPVDNIFDIWFREQLLMWIPVRPEAMIGANDLQMAKQIASIADTLPEVKAIG
FT                   VGLPGEGASGWAMSADEAGRALSFGRNHLNEERVRLYSEIAVEECIRGTKRAFAYLTSL
FT                   IERLAREPDLLKTLRTYFDQLQRRKATASVLGIHPNTLNYRLERIENILGARLDDVSWI
FT                   SKLDIAIKLGNTVQ"
FT   gene            complement(32033..33310)
FT                   /locus_tag="Bcep18194_C6548"
FT   CDS_pept        complement(32033..33310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6548"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6548"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05599"
FT                   /db_xref="GOA:Q39PL7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL7"
FT                   /protein_id="ABB05599.1"
FT                   /translation="MRKSTLTFLLAGCLALPGLVRAADAADPALVKRGEYLAVAGDCMA
FT                   CHTAKGGKPFAGGLGMPIPMLGKIYTSNITPDPETGIGNWSAEDFERAVRHGVSKNGDN
FT                   LYPAMPYVSYAKINDDDVQALYAYFMHGVEPVKQAPPKNEIPALLSMRWPLKIWNWLFL
FT                   KDGAYEPKPAQSAEWNRGSYLVQGLAHCSTCHTPRGIAMQEKSLDETGGSFLSGSVLAG
FT                   WDGYNITSDANAGIGGWTQQQLVQYLRTGSVPGLAQAAGPMAEAVEHSFSKMTEADIGA
FT                   ISTYIRTVPAVASGDAKQSRSSWGKPAEDGLTLRGVALASSGIDPARLYLGNCATCHQM
FT                   QGKGTPDGYYPPLFHNSTVGASNPTNLVQVILNGVERKAGSEDVGMPAFRHELSDAQIA
FT                   ALTNYLTGQFGNPAAKVTEQDVAKLR"
FT   gene            complement(33313..34932)
FT                   /locus_tag="Bcep18194_C6549"
FT   CDS_pept        complement(33313..34932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6549"
FT                   /product="Glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6549"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05600"
FT                   /db_xref="GOA:Q39PL6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL6"
FT                   /protein_id="ABB05600.1"
FT                   /translation="MADTDTQKADIVVVGSGVAGAIVAHQLAMAGKSVILLEAGPRMPR
FT                   WEIVERFRNQVDKTDFMAPYPSSAWAPHPEYGPPNDYLILKGEHKFNSQYIRAVGGTTW
FT                   HWAASAWRFIPNDFKMKTVYGVGRDWPIQYDDIEHYYQRAEEELGVWGPGPEEDLYSPR
FT                   KEPYPMPPLPLSFNEQTIKSALNGYDPKFHVVTEPVARNSRPYDGRPTCCGNNNCMPIC
FT                   PIGAMYNGIVHVEKAEQAGAKLIDSAVVYKLETGPDKRITAAVYKDKTGADHRVEGKYF
FT                   VIAANGIETPKILLMSANRDFPNGVANSSDMVGRNLMDHPGTGVSFYANEKLWPGRGPQ
FT                   EMTSLIGFRDGPFRANEAAKKIHLSNMSRINQETQKIFKGGKLMKPEELDAQIRDRSAR
FT                   FVQFDCFHEILPQPENRIVPSKTATDAVGIPRPEITYAIDDYVKRGAVHTREVYATAAK
FT                   VLGGTEVVFNDEFAPNNHITGATIMGADARDSVVDKDCRTFDHPNLFISSSSTMPTVGT
FT                   VNVTLTIAALALRMSDTLKKEV"
FT   gene            complement(34932..35468)
FT                   /locus_tag="Bcep18194_C6550"
FT   CDS_pept        complement(34932..35468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6550"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6550"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05601"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024651"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL5"
FT                   /protein_id="ABB05601.1"
FT                   /translation="MSYDYLKIPNMTNKTVPHPRRDIDAAVTGITRRQWLQGALALTAA
FT                   GLTGSLALRALADDPGTAPLDTFMTLSEALTGKKGLSRVLGQRFLQALQKGSFKTADSL
FT                   PQLASALASGSLNPDQEALALKILEAWYLGIVDNVVITYEEALMFSVVSDTLVIPSYCP
FT                   NKPGFWAEKPIERQA"
FT   gene            complement(35483..36490)
FT                   /locus_tag="Bcep18194_C6551"
FT   CDS_pept        complement(35483..36490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6551"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6551"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05602"
FT                   /db_xref="GOA:Q39PL4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL4"
FT                   /protein_id="ABB05602.1"
FT                   /translation="MQIDLPVVWAAIIGLGVFIYVMLDGFDLGIGLLFPFFDAKAEREV
FT                   MLDTVAPVWDGNETFLVLGGAGLYGAFPVVYSTLLPANYLPLVLMLVGLIFRGAAFELR
FT                   AKATRTQHMWDLAFIGGSALAAFCQGIVLGSLLQGIKIENNQFAGGPFDWLSPFSLLCG
FT                   IGVLVTYATLGCGWLILKVDGELQRKMRLLMKPLAGVLLAVMGVVSLWTVLGLPAVAHR
FT                   WFGSGNLGWFLPVPILVIACVWGIFHTVKREHEATPLLLMFGLVFLGYTGFVISIWPNI
FT                   VPPSLSIWDASSSHSSQLFALVGTIIILPILLVYNAMQYHVFRGKARETDVTHY"
FT   gene            complement(36494..37894)
FT                   /locus_tag="Bcep18194_C6552"
FT   CDS_pept        complement(36494..37894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6552"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6552"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05603"
FT                   /db_xref="GOA:Q39PL3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL3"
FT                   /protein_id="ABB05603.1"
FT                   /translation="MDIFDAFHLARLQFAFTVSFHIVFPAISIGMASFLAVLEWRYLVT
FT                   GDAVYKSMFQFWSKIFAIGFGMGVVSGVVMAYEFGTNWAGFSRVAGNITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWQRVSPRAHFFATLMVAVGTLISTFWILASNSFMQTPQGYKIEN
FT                   GLVVPVDWFKIVFNPSFPYRLVHMTIAAFIVAGFIVAACGAWHLLKGRRDEPVKRSFSM
FT                   ALWMLLILAPIQIVVGDAHGLNTREYQPAKIAAIEGLWETEKGGTALNLFGLPDMQAET
FT                   TRYAIQVPHLGSLILTHSWDGEIRGLKEFPPQDRPYSPIVFWTFRIMAGLGMLMLLTAL
FT                   LGLLLRKGGRLYETRWFQWFVVAMGPSGILALLAGWITTEVGRQPWTVYGVLRTVDSVA
FT                   PLSAQQVGVSLLIFVVVYFLVFGTGIYYMMKLMKRGPAAQAGYIELHRHPGLRKSALST
FT                   PLNVTEAE"
FT   gene            38369..38683
FT                   /locus_tag="Bcep18194_C6553"
FT   CDS_pept        38369..38683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6553"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05604"
FT                   /db_xref="GOA:Q39PL2"
FT                   /db_xref="InterPro:IPR031381"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL2"
FT                   /protein_id="ABB05604.1"
FT                   /translation="MAAMLPSSVALHIFLMRSSTVLSFISIAASLLLGGCVPAPSVAVF
FT                   GAAFPDWLFCIVVGVLGAGIVHVVLGKRGKRALLAPLAISYPALCALLAMAFWLLFFPH
FT                   "
FT   gene            38697..39752
FT                   /locus_tag="Bcep18194_C6554"
FT   CDS_pept        38697..39752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6554"
FT                   /product="Secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6554"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05605"
FT                   /db_xref="GOA:Q39PL1"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL1"
FT                   /protein_id="ABB05605.1"
FT                   /translation="MSDASGASRKKSLPAWLIVVATLVLLGVVVWRLDQALTTDDAYVY
FT                   ADTINVVPEVTGKIVEMPVRDNQPVKRGDLLFRIDPRPYQDALNQARARLVTLERQIGL
FT                   TQRTVNAQQYNADSVKAAVERSRAQAVQAADTLHRMEPLLAPGYMSAEDVDRARTAERA
FT                   AQAELNAAMLQAQQASAAVSGVDALVAQRAEVEAQIAIAELNLEFTEVRAPFDGRVASL
FT                   RTTVGQFASALKPVFTLIDIRHWYVIANFRETDLKGVRAGTSATVYLLSDTGKHFDGEV
FT                   DSISYGVLPDDGGVVQEGLPRVARSINWVHVSQRFPVKIAVRNPNPETFRIGTSAVATL
FT                   RRDASARGAAQ"
FT   gene            39724..41850
FT                   /locus_tag="Bcep18194_C6555"
FT   CDS_pept        39724..41850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6555"
FT                   /product="Fusaric acid resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6555"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05606"
FT                   /db_xref="GOA:Q39PL0"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PL0"
FT                   /protein_id="ABB05606.1"
FT                   /translation="MPPPAARLSEHRMSTEQFASSNLQRLAGFIGGEVRPYPGRMNVML
FT                   RCLLTSALVIVTSMALQVPLLPVSLIVVFFVTQSNVVVTRLTGVLFVVGSTIAVGSTIL
FT                   VLKFTYDYPLLRILLAGTLVFLSVYMMRVAKIGVVFFIVGLTVIYGQTFVDSTDQAELL
FT                   VRAELWAWVAVTYAIALTLLINTLFLPVEPMRQLCSAMGGQLKAIDTSLAGLEHWALVA
FT                   SAPGAYEIQVGALTLKKLLRFATMRDAAYRANQALHLARVATVSRLYAATGHLPASSAG
FT                   LTVDAIPVLRDAIQRLADAVEADGQFVAPGALIDLGGDGLPGALAEMRDALLEFSGRSA
FT                   APQGVQSPAEKERLLVPDAVTNPVYAQFALKTLMAAMISYLFYIATDWQGIHTMMLTCL
FT                   IVAQPSLGSSVQRAVLRIGGAAVGSVLALAMVVWVMPHLDGVVGLLMMVLPVIALAAWV
FT                   SAGSEHISYAGTQIMFTFSLAVLEQFGPAINLTEIRDRMIGILFGVAVSAVVHACLWPE
FT                   AEGEALRQRAAKLLRRIGAQLRSDGTGPIPVTLWAELSDSEAMSARVALEPGWQMADGE
FT                   QESLTLRMQTLLARVREILLATDAFGAERNAQKLPGGIATATTAFQAELAGLLDGYASA
FT                   LAERPLTINAPPCASLAALSDCCAAELSTLPTDALRAAYDRLLTRASNLAVQVAGLPAW
FT                   APGSVGTVLTSRAS"
FT   gene            41853..43337
FT                   /locus_tag="Bcep18194_C6556"
FT   CDS_pept        41853..43337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6556"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6556"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05607"
FT                   /db_xref="GOA:Q39PK9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK9"
FT                   /protein_id="ABB05607.1"
FT                   /translation="MTDSLIRSFCLLLRHIAVTALLCGSAACALIHRDVKPSATLDPER
FT                   IRIANDIHLANDGWPSARWWMRYGDPQLDALVDRALADSPTIASAHSRVSQAKADVDLV
FT                   KAGTSLQVSALGSVNRERVSSNGFLSAYSGNQPMLGASGPWYTEGVVGLGASLDVDIWG
FT                   KQRAQVAAALGVHNARVVETSAIELEISADVAQIYYGIQTTYHLIDLLEQLHDIVTFSM
FT                   NAHAARASRGLEPQTQTEIARSQKLATERQIVAARGRIQQLRESLRALIGAGAVDLAEI
FT                   RPVALPTPPSSLPATLSFELLARRPDLQAMRWYVEGSFDKIDAAKAAFYPSFDIKAFFG
FT                   VNALHLGDLFTHASQQINLVPGLYLPIFDGGRLNANLGGARSASNLLILQYNQAILNAV
FT                   RDIATTGSQLQDLDAEAKLQTEKIQATTFSQDSADAQYQRGLASRLTAVEAKQAVILER
FT                   VALLDLDGRRIGQDIALTKALGGGYRSDAPVVLNPR"
FT   gene            43337..43807
FT                   /locus_tag="Bcep18194_C6557"
FT   CDS_pept        43337..43807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6557"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6557"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05608"
FT                   /db_xref="GOA:Q39PK8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK8"
FT                   /protein_id="ABB05608.1"
FT                   /translation="MQIMSGESLRPTFCDVPFEADGFRTMQSVQLMIRNVVNQRMLIAL
FT                   GVQFSQGSALVHLARSDTMSCQALANLLGCGTSRLTRLAQDLERRALIVRRRNGQDRRA
FT                   LDLSLTSRGMEIAERVPFVVSEAEQVVLGRLSMEERMILKRFLQRILREIDA"
FT   gene            44967..45872
FT                   /locus_tag="Bcep18194_C6558"
FT   CDS_pept        44967..45872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6558"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6558"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05609"
FT                   /db_xref="GOA:Q39PK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK7"
FT                   /protein_id="ABB05609.1"
FT                   /translation="MAALDIVSAMRIFVRVIERGSISMAARDLDMGQSTVSERINRLEE
FT                   YLGIPLLYRHARTLTRTSDGQAFYACCKAALSAVDDALAVAQEHREIRGMFRISAPQSL
FT                   GEIIMPAVLLEIKAQYPDLYIDLDLNDSIVDPVTAGVDISLRLGRPVEGRGAKYRMGHV
FT                   RRKLVAAPSYLARYPEIEDPHGLSQHPFIRVRGVYGDRLLELDDSRGESISISLDLGMT
FT                   VSHWRAARELLLGGAGIGVLQLPACLDALTDGRLQQILPDYTVPGFDLHLILPVTRPIP
FT                   AKTRAILQILEHQLPARLAG"
FT   gene            46230..47144
FT                   /locus_tag="Bcep18194_C6559"
FT   CDS_pept        46230..47144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6559"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6559"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05610"
FT                   /db_xref="GOA:Q39PK6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK6"
FT                   /protein_id="ABB05610.1"
FT                   /translation="MRILDILTAMRAFVRVVECGSISDAAHGLGMGQSTVSERLDRLER
FT                   HLGLPLLFRHARTLTCTDDGQIFYERSKRAIALIEIAMGVSREQHDVRGIFKLAAPHAF
FT                   GEIVLAGIMVDIRKRYPELSVELVLEDAVIDPATAGVDLSLRLGQPGVAAQDSYYLGHV
FT                   HRTLVASPVYLAKHAPISEPSELADHPFIRARGIYNARDIELIAADSAMVKVRVNVAFS
FT                   VNHWRPAREHLIAGFGIGILQRRVCAEAIADGRLQQILPEYNVSGLDLHAVLPVARPLP
FT                   PKTRAILSIIEECLPGQLAQARA"
FT   gene            complement(47457..47585)
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C6560"
FT   gene            48249..48584
FT                   /locus_tag="Bcep18194_C6561"
FT   CDS_pept        48249..48584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6561"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6561"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05611"
FT                   /db_xref="GOA:Q39PK5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK5"
FT                   /protein_id="ABB05611.1"
FT                   /translation="METNRTIAALAALAHESRLAVFRALVQAGPEGLPAGQIATLLDVP
FT                   PSSLSFHLKELAHAQLVTSRQEGRFVFYCANFATMNGLLAYLTENCCGGNPCSPVSACP
FT                   TSGTRQS"
FT   gene            48596..49102
FT                   /locus_tag="Bcep18194_C6562"
FT   CDS_pept        48596..49102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6562"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6562"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05612"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK4"
FT                   /protein_id="ABB05612.1"
FT                   /translation="MPPPMTTNILILCTHNSARSVLAEGMLNHWAAKLGKDVRAYSAGS
FT                   APSGRLNPFALEALTNAGIDVDGYRSKSWDEFVGDGVPEMRVVITVCDSAAAETCPYWP
FT                   GSPVKVHWGYADPSNAAGGDDGRRLAFELTRQAIGYRMLQLLALPLDRMNDAELQTALI
FT                   EISQN"
FT   gene            49167..50240
FT                   /locus_tag="Bcep18194_C6563"
FT   CDS_pept        49167..50240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6563"
FT                   /product="putative arsenate-sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6563"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05613"
FT                   /db_xref="GOA:Q39PK3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK3"
FT                   /protein_id="ABB05613.1"
FT                   /translation="MNTSNVAPPGKVVAKPSINFFERYLTVWVALCIVAGIALGQVLPG
FT                   LFQQIGRIEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRRHVKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIRHLFAPMLPADQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFTPLVGLLLGMSAITVPWATLLTSVVLYIVIPVILAQIWRKVLLARR
FT                   QAAFDAAMAKIGPWSIAALLATLVLLFAFQGEAILTQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHDIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECRT"
FT   gene            50262..50684
FT                   /locus_tag="Bcep18194_C6564"
FT   CDS_pept        50262..50684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6564"
FT                   /product="Arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6564"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05614"
FT                   /db_xref="GOA:Q39PK2"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK2"
FT                   /protein_id="ABB05614.1"
FT                   /translation="MTAITIYHNPDCDTSRNTLALIRNSGEEPAVIEYLETPPPRETLV
FT                   KLLADAGLTVREVLREKGTPYAELGLGDPKWTDGQLLDFIEQYPILMNRPVVVTPIGTK
FT                   LCRPSEAVLDILPNPQKGPFTKEDGEVVIRAEGERV"
FT   gene            50662..51399
FT                   /locus_tag="Bcep18194_C6565"
FT   CDS_pept        50662..51399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6565"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6565"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05615"
FT                   /db_xref="GOA:Q39PK1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK1"
FT                   /protein_id="ABB05615.1"
FT                   /translation="MRRASVSEQLKDLPQLDAALFRVPDAVRLRPASPSTHPPRLLLLY
FT                   GSLRERSFSRLLVEEAGRLLTAMGAEVRVFNPSGLPLPDDAPEHHPKVVELRELVMWSE
FT                   GMAWCSPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRV
FT                   LGRWMRMLTIPNQSSVAKAFAEFDEAGRMKPSSYYDRVVDVMEELVKFTLLTRDIGPYL
FT                   VDRYSERKESAEALSNRVNQRSI"
FT   gene            51422..51850
FT                   /locus_tag="Bcep18194_C6566"
FT   CDS_pept        51422..51850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6566"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6566"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05616"
FT                   /db_xref="GOA:Q39PK0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PK0"
FT                   /protein_id="ABB05616.1"
FT                   /translation="MEIRPATVDDLASIEALLHQCGLPVIGVSDHLQDFVVAMDGSTMC
FT                   GCGGIERYDDAALLRSIAVAEHARDAGLGQRIVSRLVAACHLLQVRSLVLLTTTAEDYF
FT                   ARLGFVCVARDDVPHLVRTSSKFQGVCPGSAVSMLRVL"
FT   gene            52400..52825
FT                   /locus_tag="Bcep18194_C6567"
FT   CDS_pept        52400..52825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6567"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6567"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05617"
FT                   /db_xref="GOA:Q39PJ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ9"
FT                   /protein_id="ABB05617.1"
FT                   /translation="MAASNRKAGASATKHDLEQLSEFRYRLRRFLRFSEEILRAEGLTP
FT                   LQYMLMLHTCAFPDRSWATVGEIAERLQASSHGTVALITRCEAAGLVRRQTSEQDRRQA
FT                   EIHLTEKGAECLRKVAALHKSEIQSFGWAFHDVTDIN"
FT   gene            52951..54552
FT                   /locus_tag="Bcep18194_C6568"
FT   CDS_pept        52951..54552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6568"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6568"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05618"
FT                   /db_xref="GOA:Q39PJ8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ8"
FT                   /protein_id="ABB05618.1"
FT                   /translation="MSTTSSLNLEGKLRRDAGIIGLLFASTTSMVGSGWLFGAYHASRI
FT                   AGPLSIGSWVLGAIIIMLIALCFAELAAMFPRSGALVHMSHASHGVGLGRIWCGLLFLA
FT                   YVPVPAVEAEAIVTYANNYLPWFIQPGSAGLLTAVGFVACAGLLGIMALLNLMVIRWLL
FT                   SVNSTITWWKILVPLLTIAGLLGASTHWGVMHAAPGSYHVSGMFTALPAAGIVFSYLGF
FT                   RTAIDLGGESANPHRNIPLAVIGAVLLAAVIYILLQVAFIYALAPADLAAGWNNLSFKG
FT                   EMGPFAGLATTLGMGWMATLLYIDAYVSPGGTGLMYVTGGSRILFAAGELDAGPRMLTR
FT                   LNANRIPWVAVLIMWAVGVLFLMPFPAWQQMVSYITSITVLTYGLGPIALLVLRRNVPE
FT                   LQRPFRMSGAGLIAPLAFVCSNLVIYWTGFKTNNFLFSLVAIGFVLYALHHHVVLRRSA
FT                   RDFGWKHIAWLLPWFGGLWLLSWMGGIGGGLGVIGFGWDILLVAAWSVVVLVLAVRSAL
FT                   DAGETLEMMGRMNETS"
FT   gene            54586..55848
FT                   /locus_tag="Bcep18194_C6569"
FT   CDS_pept        54586..55848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6569"
FT                   /product="Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6569"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05619"
FT                   /db_xref="GOA:Q39PJ7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ7"
FT                   /protein_id="ABB05619.1"
FT                   /translation="MTSGSTGGEDGAAGELASLRVETGRVQRASQTEDDASPIDMYRLS
FT                   CLGIVVGVVTGIGAVAFRGLIGFVHNAFFLGRFSASYNASEFTPTSVWGAFVILVPVVG
FT                   GLVVTWLVCTFAPEAKGHGVPEVMDAIYFKRGVIRPVVAIVKSLASAFAIGTGAAVGRE
FT                   GPIIQIGSALGSTLGQAVRMTTGQRITLVAAGAGAGIAATFNTPIGGVLFATELMMPEI
FT                   SVNTFLPVALATGTATFVGRLFFGSAPAFLVPAQLGAIPDRPGSVLTLLLYAALGIVTG
FT                   VGAAMLTHGLHVAEDIFERIPGRYARHALGMLLVGVTIYLLMRFAGHYYVEGVGYATIQ
FT                   ALLYGQLGGGLFLITLALCKTLATSISLGSGSSGGVFSPSLFIGAALGAAFAASVQAVS
FT                   ARLRSRWSGWGRWWAGEPVRR"
FT   gene            55845..56549
FT                   /locus_tag="Bcep18194_C6570"
FT   CDS_pept        55845..56549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6570"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6570"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05620"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ6"
FT                   /protein_id="ABB05620.1"
FT                   /translation="MTAVAMIFEMTRDYDIVLPMIIAVAVSLATRRLLCRESIYTLKLV
FT                   RRGHVIPNALHANMFLVQNAAQVMETDVLVQDAEVLFRDILGNLDGPPFRHVVVTRSGR
FT                   IDGVLRINTGLRRAISHDHPSVTLGMLAQRNFIVVAPGEAAFDVISKLRQKHATMAVVV
FT                   TQPEEEGAMEVVGVIAKEHIADAVASSIRIFPENQRGTQRSLRSGKQHGDSHASTRAEA
FT                   HAGKEGQHETQR"
FT   gene            complement(56859..57362)
FT                   /locus_tag="Bcep18194_C6571"
FT   CDS_pept        complement(56859..57362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6571"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6571"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05621"
FT                   /db_xref="GOA:Q39PJ5"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ5"
FT                   /protein_id="ABB05621.1"
FT                   /translation="MKSLTRYAVLLALVLFGGCHSATKTPSTAGMMNQGTANGQAIGTP
FT                   STMADELNNPNSPLAKRSIYFDFDSYEVKPEYQSLLQAHADYLRLHPGRHILIQGNTDE
FT                   RGTSEYNLALGERRSQAVLRTLETLGVPDAQIEAVSFGKEKPVALGHDEASWAQNRRAD
FT                   IVYR"
FT   gene            57767..58954
FT                   /locus_tag="Bcep18194_C6572"
FT   CDS_pept        57767..58954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6572"
FT                   /product="Major facilitator superfamily transporter, MFS_1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6572"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05622"
FT                   /db_xref="GOA:Q39PJ4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ4"
FT                   /protein_id="ABB05622.1"
FT                   /translation="MSQSSIVSSRMTAPELRATTSLAAIFALRMLGLFMIMPVFSVYAK
FT                   TIPGGDNVLLVGIALGAYGVTQSLFYIFYGWASDKFGRKPVIATGLVIFAIGSFVAASA
FT                   HDITWIIVGRVIQGMGAVSSAVLAFIADLTSEQNRTKAMAMVGGSIGVSFAVAIVGAPI
FT                   VFHWVGMSGLFAIVGVLSILAIGVVLWIVPDAAKPVHVPAPFAEVLHNVELLRLNFGVL
FT                   VLHATQTALFLVVPRLLVDGGLPVAAHWKVYLPVMGLAFVMMVPAIIVAEKRGKMKPVL
FT                   LGGILAILIGQLLLGSAPHTILIVAAVLFVYFLGFNILEASQPSLVSKLAPGSRKGAAT
FT                   GVYNTTQSIGLALGGIVGGWLLKQGGPNMVFLMCAGMVAVWLAIAFGMKPPPRRA"
FT   gene            59012..60331
FT                   /locus_tag="Bcep18194_C6573"
FT   CDS_pept        59012..60331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6573"
FT                   /product="Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6573"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05623"
FT                   /db_xref="GOA:Q39PJ3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ3"
FT                   /protein_id="ABB05623.1"
FT                   /translation="MIRISALADRRALLHARRLWLHYGVFWLGAVAVGLVAVLYAKLID
FT                   FGYAVFLGYAAEHAWLPLIVTPLIGAVTVWLTRRFFDGAEGSGIPQVIAMLHAPGNTGA
FT                   RLLKFRILIGKILVSFLAILGGFTIGREGPTIHVGAALMFNLRQFYPQRFRAIRPGVLE
FT                   HRLALAGAAAGLSAAFNAPLAGVVFAIEELTRSFEQRTSGVLITAIIFAGIVSLGIQGN
FT                   YVYFGTIDVGAHLPQSLALAVILIGVIAGVMGGIFCWLLLNTRRWMPRRLQDFRAGQPV
FT                   LFGAACGLVVAVVGVATHGHTFGSGYAEARSMLESHTNVSVLYPVFKMVSMIGSYLPGA
FT                   PGGLFAPSLAIGAGIGNTLHTLFSGMQLQMLIALGMVGYLAAVTQSPITAFVIVIEMIN
FT                   GHALVISLMATALIASRVSRFFAPPLYEALSTRYFPADHR"
FT   gene            60495..60743
FT                   /locus_tag="Bcep18194_C6574"
FT   CDS_pept        60495..60743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6574"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05624"
FT                   /db_xref="GOA:Q39PJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ2"
FT                   /protein_id="ABB05624.1"
FT                   /translation="MTIAAANALIFFATESPVSYGILHFLDAFSSGFGMPVIAVAEMRS
FT                   FTHGHRLSVGQDAHFFVMAAAGAIALVATGSAQSVLP"
FT   gene            complement(60768..62066)
FT                   /locus_tag="Bcep18194_C6575"
FT   CDS_pept        complement(60768..62066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6575"
FT                   /product="Manganese/iron transporter, NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6575"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05625"
FT                   /db_xref="GOA:Q39PJ1"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ1"
FT                   /protein_id="ABB05625.1"
FT                   /translation="MNEAMIQAVVPKTLTEQTCSDIRETLAGRRRGARTVLSFAGPAVV
FT                   ASIAYMDPGNFATNIQAGAGYGYTLLWVVALANVVAMLFQSLSAKLGLVTGRNLAELCR
FT                   DSLPRRWVIAMWGMSEVAAMATDLAEFVGGAIGVSLLLHLPMIPSMLITAAVTYGLLQF
FT                   EKLGFRPLELAIAALIGVIGLSYLAELLIAPVHWPSVALHSVTPSIPDSNALTISVGII
FT                   GATVMPHVLFLHSGLTQNRVRPRNDRECSQLLAFSNVEVVVALGIAGLINMAMVIMASS
FT                   AFHLGHADIASIETAWRTLTPLLGGAAAGLFLTALIASGISSSVVGTMAGQMIMQGFVG
FT                   FRIPVWVRRLVTMAPAFIVVASGVDATRALVLSQVMLSIALPVPMIALVWFTSRRDLMG
FT                   RHMNRRVTTVSAVLGTLLVLALNGVLLVQLALG"
FT   gene            complement(62157..63134)
FT                   /locus_tag="Bcep18194_C6576"
FT   CDS_pept        complement(62157..63134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6576"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05626"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PJ0"
FT                   /protein_id="ABB05626.1"
FT                   /translation="MSDVKTDSSALIDVFDRRVERRLQRRQFFRNAGGLGLGLMGGTLI
FT                   SACGGGSGVDATAAGAPTDAEILNFALNLEYLESQFYTYATTGSGLPAGMVTGVGTPGA
FT                   VIPGQQVPFQDPVVQAYANEIAKDEREHVTFLRTALGSAAVAQPAIDIGGTDPNGAFSV
FT                   AARAAGLVGSGVAFNPYASDNNFLLGAFIFEDVGVTAYKGASPLITNKTFLEAAAGILA
FT                   AEAYHAGLVRTVLFAKGVDMTSLVNAANAISAARASLDQVGNDDQGITGSTPGSSNIVP
FT                   LDSNGLAYSRGYGNVLNIVYLTSTAAMKGGFFPNGVNGSLNMSA"
FT   gene            63515..64069
FT                   /locus_tag="Bcep18194_C6577"
FT   CDS_pept        63515..64069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6577"
FT                   /product="Beta-Ig-H3/fasciclin repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6577"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05627"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI9"
FT                   /protein_id="ABB05627.1"
FT                   /translation="MKRTVLFSAVALSVIAINVLAAGGTVMVGGQAMYPTKDIVDNAVN
FT                   SADHTTLVAAVKAAGLVDTLKGAGPFTVFAPTNEAFAALPAGTVDNLVKPENKAILTRI
FT                   LTYHVLPGRYDFRKLDQAIREGGGKAELKTVNGETLVFSENGPHNIVVMDAAGHTADIS
FT                   TYDVYQSNGVIMVVDKVLMPK"
FT   gene            complement(64188..65156)
FT                   /locus_tag="Bcep18194_C6578"
FT   CDS_pept        complement(64188..65156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6578"
FT                   /product="Esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6578"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05628"
FT                   /db_xref="GOA:Q39PI8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI8"
FT                   /protein_id="ABB05628.1"
FT                   /translation="MRSGWTGRSWRRSLPRKVLTSPCRILTALLLSAVAGARAEPVSLE
FT                   TYLVMHGPTPDTVVHYGPAPSQVVDFFRPPGQGPFPVAILVHGGCWQSRYGGRLQLRVL
FT                   AAQLARQGIAVWNVEYRRIDEPGGGYPGTYQDIGAAVDLLDVQAASLDLDSSRVVAVGH
FT                   SAGAQLAVWAASRARLPRGSALFVPRPLSIPTVVSLGGLLDLRSDANAIRESCGIDIAA
FT                   LTGMPSELRPDVLSDTSPASLVPNDMNVIAITGALDSVAPPGLARRYVALVQRAGGSAR
FT                   AIVVPDANHLDEVIPDSPVWPILDAIVLDALRVPSRQGGHR"
FT   gene            complement(65651..66238)
FT                   /locus_tag="Bcep18194_C6579"
FT   CDS_pept        complement(65651..66238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6579"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05629"
FT                   /db_xref="GOA:Q39PI7"
FT                   /db_xref="InterPro:IPR021306"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI7"
FT                   /protein_id="ABB05629.1"
FT                   /translation="MREPAKTTAVMSGACRPMIRSAAAETAAYLALSQAGWFVCVLSAA
FT                   HGRGWIGTLCAGLLAGAHLLRARAHAREAALMAIVTALGWSWDAVPVATGWLRYPNGVL
FT                   LEGAAPYWIAGLWVLFSTQLNVSLRWLRERWLTAALLGAVAGPLSFRAGATLGAVQIAS
FT                   PAAWVLLGCGWGILLPSAVWLARRLDGTRHEP"
FT   gene            complement(66246..66773)
FT                   /locus_tag="Bcep18194_C6580"
FT   CDS_pept        complement(66246..66773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6580"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05630"
FT                   /db_xref="GOA:Q39PI6"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI6"
FT                   /protein_id="ABB05630.1"
FT                   /translation="MARRLAIVVAVAAFATTQVARAGCVDDVAPARLIGSGRFCVLGIC
FT                   LYDAQLWAPRAPAAFDTPFALSLTYRHDVKGERLVSTGMSEIERLAPAPLPAATRDAWR
FT                   ADIARAFTDVLRGDVLCGVYLPGQGARFYTNGRLTADVADPDFARAFFDIWLDPRTRAG
FT                   SLRRQLLGDPGG"
FT   gene            complement(66763..67992)
FT                   /locus_tag="Bcep18194_C6581"
FT   CDS_pept        complement(66763..67992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6581"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6581"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05631"
FT                   /db_xref="GOA:Q39PI5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI5"
FT                   /protein_id="ABB05631.1"
FT                   /translation="MTLLHLLSCASQPAMPLSPRLFVALLRRLRHGHLTLVTPDGAQHV
FT                   FGDPHRQPAATLQIHDWRACRAILRAGDIGFAEAYRACRVDTPDLVTLLRLAIRNEPAI
FT                   AQTLTGGRLARVWYALRHRLRMNTRAGSRRNIHAHYDLGNRFYGLWLDDTWTYSSACFD
FT                   GDEQRPLADAQAAKYQRIVESLGLRAGMHVLEIGCGWGGFAMHAARQGIRVHALTISGA
FT                   QYVLAVERIARAGLSDLVTVELRDYRDIDGQYDAIVSIEMFEAVGEAFWPVYFDTLRQR
FT                   LKVGARALIQSITIDDSQFEAYRASSDFIREFIFPGGMLPSPGRFIEAARRAGLAAEPV
FT                   LAFGLDYARTLRAWRAAFEDHLDAVRAQGFDDTFIRTWRLYLAYCEAGFAERRTDVMHF
FT                   VVSSGDRHGA"
FT   gene            complement(67989..68843)
FT                   /locus_tag="Bcep18194_C6582"
FT   CDS_pept        complement(67989..68843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6582"
FT                   /product="protein of unknown function DUF1365"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6582"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05632"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI4"
FT                   /protein_id="ABB05632.1"
FT                   /translation="MNAPFARDGSAARLLVGYVTHERLRPVRHAFTYPLFQVCCDVERL
FT                   HEIDGRWFGIDRWRPLGLASRDYGPRDGRPLAPWMRARLAEAGIPADGPIWLQTIPRMF
FT                   GHAFNPVSFWYCYDRAGRLRALYADVRNTFGAHHGYLLSAPCHAPIGGGTVLVCRKTFH
FT                   VSPFCDVVGHYAFRVRQCGDRLLVAIDYRDDGGLLLRTALGMRAQPLTAARAWRALTRQ
FT                   PLNALAVVVRIHWQALRLWLKRVPFHGRTPPAQPPSGDAPASPPVQASPPCSPAMSDHE
FT                   VRP"
FT   gene            complement(68840..70147)
FT                   /locus_tag="Bcep18194_C6583"
FT   CDS_pept        complement(68840..70147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6583"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6583"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05633"
FT                   /db_xref="GOA:Q39PI3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI3"
FT                   /protein_id="ABB05633.1"
FT                   /translation="MHPHPTASPPGRRIAVVGAGIAGLASAYLLARRHRVTLFEAADYL
FT                   GGHTHTVDIELDGASHPVDTGFLVFNERTYPNLIALLDEIGVAAHPSDMSFSVSVDGGR
FT                   LEWAGSNLNTVFAQRRNLFSPSFLGMLRDILRFNASAQRHLETAHRQRLSVGELLAAGG
FT                   YGTSFQEHYLLPMAAAIWSSNADDILRFPAATFLRFCLNHALLQVNDRPPWRTIAGGAR
FT                   RYVERIAATLDDVRVNTPVRTILRDEHGVTVATDAAGHERFDAVVLACHAPTSLRLLAD
FT                   ASDAERGVLGAVRYRHNVAVLHTDTALLPRRRRVWSAWNYLSRRTAPAAGGASPVCVSY
FT                   LINQLQPLPFRTPVVVTLNPVDAPAPGTQLGSYDYEHPLLDLAAVDAQQRLPALQGRRR
FT                   TWFAGAWTGYGFHEDGLKSALRVVDDFGVKPAWATS"
FT   gene            complement(70240..70848)
FT                   /locus_tag="Bcep18194_C6584"
FT   CDS_pept        complement(70240..70848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6584"
FT                   /product="lipocalin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6584"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05634"
FT                   /db_xref="GOA:Q39PI2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI2"
FT                   /protein_id="ABB05634.1"
FT                   /translation="MPYRIVRRVAVLLAPGLALAAAGCPGTPPNPNPRAAVPLSTVPVD
FT                   LPRYMGRWYVIANIPYLAERDYVGSRAEWTLRADGRIDDAFVGRKGGFDQPEKRYRFVD
FT                   SVTPGSAGGEWRVRLFWPVYVTQLTLYVDPGYRYTILGYPGKTLGWIFSRTPTMEDATY
FT                   RALLARLDAMGYDTSRFRRVPQTPGQIGQPGFASPGERD"
FT   gene            complement(70857..71957)
FT                   /locus_tag="Bcep18194_C6585"
FT   CDS_pept        complement(70857..71957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6585"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6585"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05635"
FT                   /db_xref="GOA:Q39PI1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI1"
FT                   /protein_id="ABB05635.1"
FT                   /translation="MTATASQPSPAGIAAPGDTWLIRCCERGWLPDPLIRAGMRALMRQ
FT                   RLRDEHADDGERRAMAHDTLLRELRASPIAVETQAANTQHYEVPGAFFEAHLGPRLKYS
FT                   CGYYPGGDETLAQAEDAMLGLTARRAELADGQRILDLGCGWGSLALWLAERYPRARIVG
FT                   LSNSHGQRGFIEQCAARRGLTNLRIVTGNVAEFDFASGEAGFDRVLSIEMFEHMKNYGQ
FT                   LLSKIARWMPDDGKLFVHLFAHRLLAYHFTARDGSDWMSRHFFTGGTMPSADLLLHFQD
FT                   DVRIARQWWLDGTHYARTANQWLASLDAARGRVMPMLEAVYGADARVGFQRWRMFYMAV
FT                   AELFGYAGGQEWGVAHYLFDKRPARR"
FT   gene            complement(71954..72787)
FT                   /locus_tag="Bcep18194_C6586"
FT   CDS_pept        complement(71954..72787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6586"
FT                   /product="protein of unknown function DUF1295"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6586"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05636"
FT                   /db_xref="GOA:Q39PI0"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PI0"
FT                   /protein_id="ABB05636.1"
FT                   /translation="MPAAAVALAAFVGLILAFTAVWIVQLRSRNAGMIDPVWAATLGGV
FT                   AVLAAGFGTGAELNRALVALGGGLWGLRLARHLWHRNHGQPEDVRYRQFRLQWGDAAAR
FT                   NLFWLFQLQALISMALSVAFFVPAYSAAAPSRFALAAAVAIWFAAVAGETAADRQLKRF
FT                   LADPGQRGQVCRAGWWRYSRHPNYFFECLHWFAYTVLAIGMPWGALALLPPFLMAWLLL
FT                   RVSGLPLLEARLVDTRPGYREYMRTTSALIPWPPARAAPPSRTGPDRPEDRSTRS"
FT   gene            complement(72920..73654)
FT                   /locus_tag="Bcep18194_C6587"
FT   CDS_pept        complement(72920..73654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6587"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05637"
FT                   /db_xref="GOA:Q39PH9"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH9"
FT                   /protein_id="ABB05637.1"
FT                   /translation="MNTPADHDPELRCAEYALGLLDADARRALEHAVDADPALKSTLER
FT                   WQRRLAPLAEDIAPVEPPGHVWTRIQRDVGFLLRSSARGAAPTGGWWNSVNLWRWVGIS
FT                   ASAAALGLLAINLVWVREASQRTTAVESNYMVATISRSDGVAHWTATVDLPRARMVVVP
FT                   ADKPTIAVNRSTELWLIPPNAKPISLGVFPPDAPASMTLPPAVVAQLSARAVLAVSIEP
FT                   SGGSPTGQPTGPVLATGTLHAA"
FT   gene            complement(73651..74262)
FT                   /locus_tag="Bcep18194_C6588"
FT   CDS_pept        complement(73651..74262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6588"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6588"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05638"
FT                   /db_xref="GOA:Q39PH8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH8"
FT                   /protein_id="ABB05638.1"
FT                   /translation="MNDTPDSAERFGSSAPSHDGDADAARRAHLNQVMLQVARGDQAAF
FT                   AELYRLTSSRVFGIVIRMLHDQGEAEDLLQEVYATAWRRADTFDPVRGGAMTWLIALAR
FT                   NRTIDRLRQHREVPLDEEQVLDLPDEAPTPAALAEASQERQRLERCLEWLEPPQRRAVR
FT                   EAFFSGATYSELAVRLRVPLGTMKSWIRRSLMQLKECLEQ"
FT   gene            complement(74567..75226)
FT                   /locus_tag="Bcep18194_C6589"
FT   CDS_pept        complement(74567..75226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6589"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6589"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05639"
FT                   /db_xref="GOA:Q39PH7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH7"
FT                   /protein_id="ABB05639.1"
FT                   /translation="MRDVIDGFLRFQRDIYPQRVELFKQLATSQNPKALFVTCSDSRVV
FT                   PELLTQREPGELFVIRNAGNIVPSYGPEPGGVSATVEYAVAVLGVRDIVICGHSDCGAM
FT                   GAISRCTCLDNLPAVANWLRHADAAKVINAAHEYDTPRAKLDGLVRENVIAQLANLRTH
FT                   PSVALALEQGRMNLHGWVYDIETGGIDALDGATRSFVSLAESPTVVAVDSRNRGSI"
FT   gene            75652..78588
FT                   /locus_tag="Bcep18194_C6590"
FT   CDS_pept        75652..78588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6590"
FT                   /product="Transposase Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6590"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05640"
FT                   /db_xref="GOA:Q39PH6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH6"
FT                   /protein_id="ABB05640.1"
FT                   /translation="MDHWRLAYLGIRQVPRELSEFELATFFTFSKRERVAIDSRRTDLF
FT                   RLAVALHIGFLRMTGRPLGSYKQIPTVLWRHLGRQLNVKPPDLGTLRSLYDGNLKTLSD
FT                   HQRFARDAINFRAVAEHQRRYVIRWLKEQLTGRPERGQLTNDLKRWFYDHRIVIPPERM
FT                   LRQFVVQAVRDIEGQLHGALESAVGMEKLESWARVLAQPHGEHSSLQRWLWAVPLRNST
FT                   HQMSEILDKVNLLTMHEVATRWPVECNDAMVRHYARRCASRPPSISKRIEPQSRRIEAA
FT                   CFMRYSLCIATDQVLEMLRRWVLKVVNDTSREVDAMRMKAADQLREFALAVKALANDET
FT                   LSREQLGEKLCLLADDVLQPHPTSRRSQIRQCLVRKRYYARNLLNRIVQLPFEAEGAHP
FT                   VVDALSLLRVLYRRRAYLLPDGVNIRLGRTWREAIDGYDRLRAMVAFEWATLFALRVAL
FT                   RNGSVFINHSFSFRSQSHMLISPEQWQAKRNNHYGHLGLPQDPNEFLGPILEQLDKRLA
FT                   LLDDAVVNGSIRVDTAVHLDPLAAQDPDAQTDQLRRQIFEAHPPGQFPEIILEIDSATR
FT                   FSWILLGREPRSRTELLMVYSAILAHGTSLTAADISRMVPEVSTEAIRQMMKRLADERM
FT                   LRAAADAVLEFMHEHPIAAHWGRADLASSDMMSLETTRTIWRARADPRRRTASIGMYTH
FT                   VLDRWGIFYDQPIILNERQAGAAIEGVVRQSATKDIAQLAVDTHGYTDFAMGVSRALGF
FT                   DLCPRLSHLRDRRLHVPRSQVVPARLAGVTDRDVRLGLIVDVWDEFVRIAASIRSGQCT
FT                   AVEAIARFGSAARGQAVYDGGVHIGRLFRSIFLIDYFTNASFRSELQHALNRGEAVHTV
FT                   QRAIHIGRIPVELARRQESLAAVSSALTLLSNILMAWNTTHMQRALENIEATRGQPIAA
FT                   EQLRRIAPTHIEGINLRGTFNFPVSLYAKRILPSIAADNPIPSTSRSA"
FT   gene            79322..83302
FT                   /locus_tag="Bcep18194_C6591"
FT   CDS_pept        79322..83302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6591"
FT                   /product="Hemaglutinin/autotransporter like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6591"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05641"
FT                   /db_xref="GOA:Q39PH5"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH5"
FT                   /protein_id="ABB05641.1"
FT                   /translation="MNKIYRSLWNDALGAWIAVQENGKARGRLGRSSRRGAMLSSIATV
FT                   GMVTASLATAQTTVSGSANNGGSGRTASTDSTCGQNFVNRNNPGNPPSSGSTYMLQSGC
FT                   STAVGNNAKATSAGTALGDRANASVGGVALGVGASSTQNSSVAIGVVALSRGNTSIAIG
FT                   RQSAATADFSTAIGNVAYASGVSGIAMGDSALASGYRSVAIGSADTNLAGNDGISTGAN
FT                   YDPNTQTRASGARTVALGAGAVAAPDDSVALGSNSVGESNAQGPAAFSGDAIPVNGAVS
FT                   VGQAGAERQIKNVAGGTVGTDAVNVNQLTAVSNSAVKYDKNPDGSINYNSVTLNPGGSL
FT                   TTMTNLAAGDISQNSKDAVNGSQLYQTNQTVSTLGNNAASVIGGGASYDPSTGQMTGPT
FT                   FSIAGGKQTNLSDAINALNQGWNVTTGGNTSGASVTAVQPGSTVTFNGGKNIALAQNGA
FT                   DITIATSDTPTFTSVGIDNGGPTLSGSGLNMAGKKITNVATGDVSSSSKDAVNGSQLYQ
FT                   TNQTVSTLGNNAASVIGGGASYDPSTGQMTGPTFSIAGGKQTNLSDAINALNQGWNVTT
FT                   GGNTSGASVTAVQPGSTVTFNGGKNIALAQNGADITIATSDTPTFTSVGIDNGGPTLSG
FT                   SGLNMAGKKITNVAAGEVSSSSADAINGSQLYQVEQAQQQANDQAVKYDKNPDGSINYS
FT                   SVTLNPGGSPTTMTNLAAGNISQNSKDAVNGSQLYQTNQTVSTLGNNAAAVIGGGASYD
FT                   PSTGQMTGPTFSIAGGKQTNLSDAINALNQGWNVTTGGNTSGSSVTAVQPGSTVTFNGG
FT                   KNIALTQNGADITIATSDTPTFTSVGIDNGGPTLSGSGLNMAGKKITNVATGDVSSSST
FT                   DAINGSQLYQVEQAQQQANDQAVKYDKNPDGSINYNSVTLGGTPSTDGGKTGGTKLSNL
FT                   AQGDLSEKSADAVNGAQLYQTNQNVANLGQQVANISNGGGIKYFHANGGTTNSLPDSQA
FT                   VGAGSAAIGPGATAAGDTSVAIGNNASAKRDGDVALGSGSVADRGAEKYTGKYSGAQND
FT                   TAGTVSVGASGQERTISNVADGKEATDAVNLRQLDGAVQAANGYTNQQVKDVQGSVANV
FT                   TNNVQQLQSDMSSVKTGSAGMFQTGQDDATAPRASGKQSTAGGAGAVASGNSSTALGNG
FT                   AKASSNDSVALGARAQASGSNSLALGAGSVADRNNSVSVGAPGHERQITNVAPGTAPTD
FT                   AVNLGQLNVALNQTAGQLQQGINDTARKAYSGVAAATALTMIPDVDKDKVLSVGVGVGS
FT                   YQGYSAVALGATARITENIKMRAGASLGGSGTAIGMGASMQW"
FT   gene            83872..84555
FT                   /locus_tag="Bcep18194_C6592"
FT   CDS_pept        83872..84555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6592"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6592"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05642"
FT                   /db_xref="GOA:Q39PH4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH4"
FT                   /protein_id="ABB05642.1"
FT                   /translation="MRIAILGPDPVARGFAKEALVRVGHVCQTFSSGNEIIRQLRRETY
FT                   DLLILDWLVTDISGEEVMLWAHKNLPGRVPVIFLSKRGRDEDLVRILAAGADGYLVKPI
FT                   SGDVLAAYVNALARSIAGVDLKGRLSVREFEFDLRRKILLANGACVETTPKEFDIALLF
FT                   FRNLGNSVSRGHLLDIVWRQHPVSVSRTVDTHISNVRTKLNLNPENGYVFKPIYGFGYI
FT                   LDLVR"
FT   gene            85335..86042
FT                   /locus_tag="Bcep18194_C6593"
FT   CDS_pept        85335..86042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6593"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6593"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05643"
FT                   /db_xref="GOA:Q39PH3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH3"
FT                   /protein_id="ABB05643.1"
FT                   /translation="MTMLKSLVSVALAVSTLAACSSASGPTFNAYAVDLADGSRAFRVE
FT                   CHGLFEPLSACMREAQRVCGDQPVRLLDQQQRLSDPVQKIDDTDAMTFQCGAPPQPVVA
FT                   TPVPVEEKPIVLAADALFAFDEGDVDAINPEGRAELDEIAAKLIAMPAVRHIDVAGYTD
FT                   RLGSKEYNVALSQRRAEVVKWYLTSRGVTAAIDARGHGKVLPGTSCEMHIRAELIRCLS
FT                   PDRRVEIRASHAQ"
FT   gene            complement(86921..89185)
FT                   /locus_tag="Bcep18194_C6594"
FT   CDS_pept        complement(86921..89185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6594"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05644"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH2"
FT                   /protein_id="ABB05644.1"
FT                   /translation="MYDLHRLGWNSFQQLCLTIAREVLGQTVQSFLDSNDAGRDGAFAG
FT                   SWTPSSKQHFSGNFVIQCKFSSKPGSLLTKSSIADEIPKVRKLVSDGLCDVYILMTNAG
FT                   VSAKQEAQIKSALSGAGVRDVLICGSTWIEDQIRENTRLRMLVPRVYGLGDLSQILDQR
FT                   AYAQARAVLESLRDDLAKVVITESYRKAVNALDEHGFVLLIGEPAAGKTTIASMLAMAA
FT                   ADKWKSSVLKLADPAKIVERWNVDEPSQFFWIDDAFGVTQYESPLVHGWNHSLAQVKTM
FT                   LRRGAKIVMTSRDYIYNRARHDLKESAFPLLGESQVVIDVHDLSDLEKQQILYNHLKLG
FT                   KQTTEFRVAIRPHLEYMAAHPRFIPETARRIADTLFTKDLYLGKYHLGAFVEKREQLLL
FT                   EVIQGLDASSKAALGLIYMRKDHLESPIMLQGAEQTAIERLGSTLGECIQALDALNGSL
FT                   VTHMHVDDQPVWRFKHPTIGDAYAATLAFSPDLLGIFLSGSSTENLLSQVTCGKVGVEK
FT                   AVIIPKSLFPAMMERLRDFSSSNQYKVEWMSSWGARWTLYRFLANRCSKDFLAAYLEQS
FT                   PDVLQRVAKPGLSLSAVPEVDLAVRLHEFGLLPEEARKAFVETVSTYAVEGEDLYALDD
FT                   PSVRSVFQDSEFDELVEAVRTDLLPKLQDVRINAQSSHLSSDAPDEHMQGILESFGTLK
FT                   KRFGEDEQLVNLIDKEIDLVNKWISETEPPEPKVGPRVLGAVEHSEEKHGTRSIFDDIA
FT                   D"
FT   gene            complement(89210..91852)
FT                   /locus_tag="Bcep18194_C6595"
FT   CDS_pept        complement(89210..91852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6595"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05645"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH1"
FT                   /protein_id="ABB05645.1"
FT                   /translation="MAQPTFNIFDALSVWGKTLPTWQHFLLSKLVEDVELPDAVLDDVF
FT                   SEYLIDQNLAGPDAARVAWDPEPPQFQPDAPTVVSTLTTMTGVSGVNALAAGETLSFGP
FT                   KLTVIYGPNGAGKSGYARVLKSACFTRSKDIGILGDVKLVKSKQPKPTAKFSFDDGSAV
FT                   NFVHQEPCQRMRDGFAVFDSTCVSVHLDGRNAFQVMPYLFDVFPRMVAAFTELQTKLRD
FT                   QIMRRTPAADKFVIQNSTSEVATALSALTAKTDLARLQELAVYGDAEAARLSAIEQKLV
FT                   ELRTTDPQEIIKRNEQRIADLKAVHASIGALAQSIQPSLVQGIAEAAARITALVEQRAA
FT                   LSAARFGGEPVQPVGTRAWLDLLAAAITYGEEAYPGAPFPPQTDGARCVLCQQTLDAAS
FT                   ADRLTKFYQTATSDVEAQLAATRRTLKSHSIALGEVGLSFFDEESAARRTVEELDAALT
FT                   AAIVGHVEGFRTVVGVLSNAVATEIGPALSLLAYDAISDRVSALADRLDQDNVKLRQSD
FT                   PQVLIDALLLELQLLKDRQWLAGQYVAVGDAVEDLKWVAKANACLRSLPTIQRDVTSKQ
FT                   KALAKELVAQGFIARFTENCTALQLTLPVQFKFAGEAGTTERKIEIANAGMTGVDPSQV
FT                   LSEGEQTAAALADFLTEVELNGACAGVIFDDPVTSMDHVRKEAIAQRLVTEADRRQVIV
FT                   FTHDILFTNYLATAAEEKGVAFAGRTVWRDDTNSPGVIDRLAFPHEHYEGAAHDRAKGH
FT                   YESSRTLVGDPQRDALEKACGSLRTAYEDFIQKKLFHNVVRRWRENIPYTVNQVYFDEA
FT                   IAARVHDRMVVLSRYIDAHSHSEDFYEMPLTIDSVKSELAYFDAIKSDYKKARTEWEKT
FT                   RPKAGSIFS"
FT   gene            complement(92031..92321)
FT                   /locus_tag="Bcep18194_C6596"
FT   CDS_pept        complement(92031..92321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6596"
FT                   /product="Histone-like nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6596"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05646"
FT                   /db_xref="GOA:Q39PH0"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PH0"
FT                   /protein_id="ABB05646.1"
FT                   /translation="MATYKELKAKMDALAEQTEAARVAEFQAVVEEIRAKVAEYGVTEK
FT                   DIFGKQRGRSAKAVVDAKYRDPKTGATWSGRGRAPAWIKDAKNRDRFQIQE"
FT   gene            complement(92384..92767)
FT                   /locus_tag="Bcep18194_C6597"
FT   CDS_pept        complement(92384..92767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6597"
FT                   /product="nucleotide-binding protein containing TIR-like
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6597"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05647"
FT                   /db_xref="InterPro:IPR019302"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG9"
FT                   /protein_id="ABB05647.1"
FT                   /translation="MRTRFATLPKDILHEQANQGHTILEKIDAYSDVSFAVVLLTPDDE
FT                   GCVKGGHPQPRVRQNVLLELGFFIGRLGREKVCALKRGDPEIPSDYLGVIWHSMNVGDW
FT                   KSALCRELDAMGFEIDWKKAMQA"
FT   gene            93189..96365
FT                   /locus_tag="Bcep18194_C6598"
FT   CDS_pept        93189..96365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6598"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05648"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG8"
FT                   /protein_id="ABB05648.1"
FT                   /translation="MYLRSALHRQMDVRILSCTQIDHRGQMQFRAKQIAPPKEWGTFED
FT                   LCHALFKRVWRDPFAQKNGRRGQAQHGVDVFGSPGGDRSSYWGVQCKGKDCNYGSKAEW
FT                   SEVLLEVAKAEKFSPRLEKWIFATTAPTDALLQKAARELSVARRAEGLFSVDVLGWEEI
FT                   QALMADVPGVITEFYPEHADHLPQVIEALRAVPLLEAKVVDLVERIEATLLKPPNLHGS
FT                   AVWEAVTFDGDRGLGPALMGYALGPSDAVACPCLIEVGTVQAQLRVAYSARLIGEPGAG
FT                   KSICSYQAARELASGGFEVLRLLDPQADSIALEAVLPDKPRLYLIDDAHLLKPHILSRI
FT                   ENQACPSRLVLSTHNVVGRLGHRGAITLDAKRAVKTIAAALRADLPKTLEAVRLADDDV
FT                   GERMLDADLGERLEHAEAVADRPWQFCFVLGGGWRRSKQAADSARLAAADLVLAAVAMR
FT                   QMVSRDARAMPAEIMEVCERVGINSSVVEQGLEWLERERLIVGATDCRTPHQRFASVVL
FT                   KRILEGQDTSGRDKIARMIESVLCDSHYPFAGLRVLIHELSFGDRYSWTHLLGQPAVEA
FT                   AVARCWIAAGSDRNFAALALSDLWDFMGGGAAAVVGPHVSTLAKWISSPSDSAYGLGHL
FT                   LNALTRINQEVAEKVIAKVDSVAIAAAYSNANPETAYGLADLLCAVANVKVDDVNAKIR
FT                   AAIDRNRLRELAKHEGFLEDAFVFSKFCASVVWWEEDLALEMAELFVPTAQQVLSKDPV
FT                   EGFEQLSQDFASTVLRVFDVLGVYVGKWRPTRRQWAIARRICEKIDPKQAAEHISTVRP
FT                   RNFQSAGFFLHFLFQSAPRKYETVLQQIDWDKLDLAIGDDWRDMPHDTEVLLSTLYSGT
FT                   LAQQLVQNFISTRSNRIVHFPPRLLLMAPEVGFTHLANGGLLRLAQLDHVNWTDGGIAL
FT                   VLIAETHPELTERAVTPFIDVIAHGLMKYNRDFTGPAEGFVRVVIEHAPATWRAVLGKL
FT                   DPVTIEKNFAECLKGNADHRRTVAAVIESAIVLDDPVGHAARRIRARFPKASTAPTDTP
FT                   HFGRSRRRSG"
FT   gene            97139..98206
FT                   /locus_tag="Bcep18194_C6599"
FT   CDS_pept        97139..98206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6599"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05649"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG7"
FT                   /protein_id="ABB05649.1"
FT                   /translation="MHDLLLGFEKFKNISLGDPFFDSLKSDYDEFGEWFLKKSEHQAYT
FT                   FRNKAGLLDGFLYLKQEDGPVLDSTPPLPGARRLKIGTFKINPHGTRLGERFIKRAFDV
FT                   AVHARVDAIYVTIFAKHKALVDLFFRYGFLQKAIKQTANGQELVLERRLDLVFKDVVLD
FT                   YPRIPIGTGRHFVLSLYPQWHSRLLPDSLLRTESSSILQDISHTNSIHKIYLAAMSGVE
FT                   QLRRGDTLLIYRTAEGGSAYYTSVVTSLCVVEELTNVKNFATVEQFLAYCAPYSIFSEL
FT                   ELRNFYKSRRYPWVIRFTYNLALSRRPNRKALVEQVGMNPGMYWGFFQISTLQLKHILQ
FT                   LSSDYEKASSLVYSS"
FT   gene            98172..98546
FT                   /locus_tag="Bcep18194_C6600"
FT   CDS_pept        98172..98546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6600"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05650"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG6"
FT                   /protein_id="ABB05650.1"
FT                   /translation="MKKRVLLSIHPEYANAIFAGEKGFEFRRVIFKEDVSEVVVYATSP
FT                   ISRVIGCFKIEEIYQDTPGELWVKTEARAGVTREMFDSYFKDRVKAFAIKVSEPTRFSR
FT                   PQPLSKYLPSNTPPQSFCYI"
FT   gene            98552..99730
FT                   /locus_tag="Bcep18194_C6601"
FT   CDS_pept        98552..99730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6601"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05651"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG5"
FT                   /protein_id="ABB05651.1"
FT                   /translation="MATSYATSTFGLLCFARGGQPPSTPAAAHPPSTATLPELHLNIWE
FT                   RDPDRHSKNPDSFLDVGLMLDLGEHADSIELVLPQKMPVTSIVDLSPTIAQAQAIPAIF
FT                   NESWAIAHVGSQGSDSVVYDPANGDRSFAVVSITGAITETRHAGHDALSISVSELILRA
FT                   NAVAQLTGRDIERVYVRFRLLEFKKQYYCVGAGERANAWWQPSWQRTEDIDFRLNVRRG
FT                   APPRLESQIGRFLEFSKVHLFLMRSRDKDIVFQDKLFKASRSLEDEEFWAQYSIYGTQL
FT                   SRDDSLKRVQNSLGYHWKAAGSEPVKEFGTLARFKIVEFGVGKFVAVAMIVGAMGSMLW
FT                   DGTKGLYGLVTSHGSERATMTSSVEVGTAGRAANQRPAASGVKLPTERKEGG"
FT   gene            99727..100290
FT                   /locus_tag="Bcep18194_C6602"
FT   CDS_pept        99727..100290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6602"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05652"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG4"
FT                   /protein_id="ABB05652.1"
FT                   /translation="MSYLITKASLEQSPWLLDEALRLASEDVEFLRFSYPQFDHWFATK
FT                   VIPGIHDGERTLLLERRGSVTVGFLIVKHTAVEKKLCTLRVRPDFVSKGLGVRLFQTAF
FT                   HLLETEQPLLSVSAPAAPKFERLFRYFGFAQEAVYQGRYLPDVDEYSYNGLLDPAYMFH
FT                   DQRANSEDRALPSIHDRQHLACRL"
FT   gene            complement(100665..101069)
FT                   /locus_tag="Bcep18194_C6603"
FT   CDS_pept        complement(100665..101069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6603"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05653"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG3"
FT                   /protein_id="ABB05653.1"
FT                   /translation="MNHDLAPNSTPPLDFDQFMASLRDSESVAPIVSARRFAAALHIDM
FT                   QTLARLAHVHRNTVSRLAGSESVQKYLREAIRIIRAANDTSGDIQSTLFWYRNEPLPTF
FT                   DYKTAEELVSEGRVDDVLRYVVSLEAGAAG"
FT   gene            101352..102299
FT                   /locus_tag="Bcep18194_C6604"
FT   CDS_pept        101352..102299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6604"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6604"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05654"
FT                   /db_xref="GOA:Q39PG2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG2"
FT                   /protein_id="ABB05654.1"
FT                   /translation="MKLHQLRALVAVARSGSIHEAARTLHLTQPAVTRSLRDLEDELGL
FT                   MLVARSSSGVTLTDAGRAMLRRAELVVNEVARTEEEMAQLRENRQGRLAIGMTPLAGIT
FT                   VLPAAYNRFRRAMPDVQLEFVEGSPSQLVEQLKNGALDFALGAGADAQDFTSVRCEHLD
FT                   SFPMWFAVSRKGKLAGATSLADLQDAEWLHTGPSTEFRAFLAELFAQAGLPAPRRVTRC
FT                   ASQTLFYALAVNSDVVTAWTQLALRGEDASDTLKTLDLVGQPPARNLYLLFRDSAVLTA
FT                   SAEYFVRCIDEAVQAERANAGGTKRGTRSRAPRA"
FT   gene            complement(102309..103373)
FT                   /locus_tag="Bcep18194_C6605"
FT   CDS_pept        complement(102309..103373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6605"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6605"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05655"
FT                   /db_xref="GOA:Q39PG1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG1"
FT                   /protein_id="ABB05655.1"
FT                   /translation="MPAPPAGTPTRNHSRAPCTDHSAIRSRIMEIDARTPPLQRITPDH
FT                   DTQSPARAPTARLAALIAAYAPHDGMFDLPVRGMRIARASASPPHWNHGVLHACLSIVG
FT                   QGAKSTQVGDDTYVIDESRMLVATADLPVTGRVTRASPAEPFLYAQLELDPARIVALTP
FT                   RVFPLGLPKAVDCSALDTHDAQPEIVDAVVRLMQLIAQPDDIDLLAPLIVDEILIRLLR
FT                   GPSGARVAQIGLADSTTQRISRAVAWIRDHYLDPMTVESLARQVDMSPSTFHHHFRAVT
FT                   SMSPLQCQKVLRLQEARRLMCVSAMDARQACRSVGYVSASQFSREYARLFGDAPGRDVL
FT                   KLRDEAVPLSRVAP"
FT   gene            103886..104770
FT                   /locus_tag="Bcep18194_C6606"
FT   CDS_pept        103886..104770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6606"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6606"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05656"
FT                   /db_xref="GOA:Q39PG0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PG0"
FT                   /protein_id="ABB05656.1"
FT                   /translation="MDQLQSIRAFVTVAREGGFRRAATRLRVSTAMASRLVDALETRLG
FT                   ARLLQRSTCHQSLTEIGELYLARVERILGAIDEIDGRVVAMGSKPEGELRIAAPVAFGL
FT                   SQLSALLDRFVNRFPDVRPTVTLTDAHVDLTSEDIDVAFLTDGMPVTGAHALHTLAAYE
FT                   SVRVAAPSYVDAHGGAAASGDWPDITAVRLDLPATGEDDAAAFRPDTTPGGSPGVGHLD
FT                   MARRLAVAGMGAAVLPAYLVDADLVAGTLVRVAQIRPLAPVTLKLAHARTAHLPAAARV
FT                   FIEFAGAAFRPAS"
FT   gene            105003..106259
FT                   /locus_tag="Bcep18194_C6607"
FT   CDS_pept        105003..106259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6607"
FT                   /product="Secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6607"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05657"
FT                   /db_xref="GOA:Q39PF9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF9"
FT                   /protein_id="ABB05657.1"
FT                   /translation="MRVERVPYRLITAATAAVFLAACGKKESAPPPQTPEVGVVTVQPQ
FT                   AVPAVTELPGRTSAFLVAQVRARVDGIVLRREFTEGTDVKAGQRLYKIDPAPYVAALNS
FT                   AKATLARAQANLVTQNALVARYKVLVAANAVSKQDYDNAVATQGQAAADVAAGKAAVDT
FT                   AQINLGYTDVVSPVSGRVGISQVTPGAYVQASQATLMSTVQQLDPVYVDLTQSSLDGLK
FT                   LRQDVQSGKLKTSGPGAAKVSLILEDGKTYSEPGKLQFSDVTVDQTTGSVTIRAIFPNP
FT                   GRVLLPGMFVRARIEEGVNENAFLVPQIGVTHDQKGQAIALVVNAANKVETRPLTTAGT
FT                   YGQDWVVEGGLEAGDHVIVQGVDKVRPGATVKTVAAQLAPAPDAASGTPASAANASGVA
FT                   PASNAANAAARSTAASTAQ"
FT   gene            106275..109466
FT                   /locus_tag="Bcep18194_C6608"
FT   CDS_pept        106275..109466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6608"
FT                   /product="Hydrophobe/amphiphile efflux-1 pump, HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6608"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05658"
FT                   /db_xref="GOA:Q39PF8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF8"
FT                   /protein_id="ABB05658.1"
FT                   /translation="MAKFFIDRPIFAWVIAIVLMLAGVASIFKMPIAQYPTIAPPTIQI
FT                   QANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSSTSDDSGNATITLTFSPGTNPDVAQ
FT                   VQVQNKLSLATPNLPQVVQQLGMQVTKSSSNWLMWFAFNSDDGSMSKEDLTNYVASHVL
FT                   DPLSRVNGVGQTLLLGSQFSMRIWLDPVKLTNYSLTPTDVSAAITQQNVQIAGGQIGGT
FT                   PAKPGTMLQATITESTLLRTPEQFGNILLKVNQDGSQVRLKDVGRAALGSENYTFDTKY
FT                   MGQPTAGLGIQLATGANALATATALRAKIDELSKYFPHGLVVHYPYDTTPFVRLSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMGVAGFSINTLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPKEATRKAMGQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVSAMVLSVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNR
FT                   TFDRSRDRYTGGVNHVIRRSGRWLVIYLAVFIAVGVMFVRLPKSFLPDEDQGYMFMIVQ
FT                   TPSGSTQETTGKTLDNINTYLTTTEKDVVDSVFTVNGFSFAGRGQNAGLVFVKLKPYEH
FT                   RQRSDQKVQALIGRTFAHYSQYKDAMVIPFNPPSIPELGTAAGFDFELTDNAGLGHEAL
FT                   MAARGQLLGMAAKDPALALVRPNGLNDTPQYKVDIDREKANALGVTAAAIDQTFSIAWA
FT                   SQYVNNFLDMDGRIKKVYVQSDAPFRMTPEDMNIWYVRNSAGGMVPFSAFSTGHWSYGS
FT                   PKLERYNGVSSIEIQGQAAEGKSTGQAMAAMEALASKLPEGIGYSWTGLSFQEIQSGSQ
FT                   APILYAISILVVFLCLAALYESWSIPFSVIMVVPLGVVGALLATMLRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQTRENMGPVRAAIEAARLRLRPILMTSLAFMLGVLPLA
FT                   ISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVRVRAIFSGETENVDDAWRLVQG
FT                   DLQRGHDDAHDSKGQ"
FT   gene            109469..111001
FT                   /locus_tag="Bcep18194_C6609"
FT   CDS_pept        109469..111001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6609"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6609"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05659"
FT                   /db_xref="GOA:Q39PF7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF7"
FT                   /protein_id="ABB05659.1"
FT                   /translation="MQKHALTATAAALAAALFATGCTMAPHYKRPDAPVAQTYPAGGVY
FT                   ATQPGATGARSANGQAATAIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQY
FT                   QITRAGLFPTLDGIGTGSRQRLPNALTSVSGRNITTTYNVGLSASWELDLFGRVQSLKD
FT                   QALAQYLSTSYARQAQEISLVSQVADQYLTLLSSDDLLKVTEDTLKSAQASYNLTKLKF
FT                   DNGTGSELDLRQAQTVVETALASQQSQARDRAQALNYLVLLIGEPLPDDLPAGMPLDAQ
FT                   NLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANIGAARAAFFPKISLTAAFGTASPTL
FT                   GGLFKAGTAAWSFAPNIALPIFEGGSNLANLDLAHVQKRIEIASYEKAIQSAFREVSDG
FT                   LAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVDSYLSVLTAQTDLYNAQQSLISA
FT                   RLARWTNLVTLYRALGGGWVERAGETPRAPDAPVDYDRAAAPAPASAVATNG"
FT   gene            complement(111143..111856)
FT                   /locus_tag="Bcep18194_C6610"
FT   CDS_pept        complement(111143..111856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6610"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6610"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05660"
FT                   /db_xref="GOA:Q39PF6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF6"
FT                   /protein_id="ABB05660.1"
FT                   /translation="MSQTSGSMITFRRPDGQELQGYLATPAKTEGAPAVVVIQEWWGLN
FT                   DQIRGVADRLARCGYFALVPDLYRGKSTVEEEEAHHLMTGLDFGDAASQDIPGAVTHLK
FT                   TLASRVAVTGYCMGGALTLLSLQFADADAGVTWYGFPPLDYLDPAKLKVPLMGHWATQD
FT                   AFFAIDQVDALEKKLTDAKVNVEFHRYLAHHAFANETAVGPGRIAGTQFDPVWSQTAWD
FT                   RTLTFFGRTLWEKQG"
FT   gene            complement(112180..112491)
FT                   /locus_tag="Bcep18194_C6611"
FT   CDS_pept        complement(112180..112491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6611"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05661"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF5"
FT                   /protein_id="ABB05661.1"
FT                   /translation="MKSFIYAVVAATALSASYGAFAQSNPSGQLTRAQVRAELVQLEQA
FT                   GYKPEVSDQYYPRALQTAQARVTNADETGYGAQAAAGVRAGRAIAVKQDGRDSVYFGQ"
FT   gene            complement(112808..113833)
FT                   /locus_tag="Bcep18194_C6612"
FT   CDS_pept        complement(112808..113833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6612"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6612"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05662"
FT                   /db_xref="GOA:Q39PF4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF4"
FT                   /protein_id="ABB05662.1"
FT                   /translation="MRRWRLYTATRHVRHAMQSIMPKVVGIFAVPGVQLLDVSAPLDVF
FT                   AQANAECGKPFYTLRIIASESGPIRSSSGAQLLPDWIVPDIPERIDTLLVAGAPSAGRI
FT                   ALRTDVLAWLRAAAVQSKRYGSICTGAFILAATGLLKGRHLTTHWAAADALAEAYPSLA
FT                   VDADALYVRDGKLRTGAGVTAGLDLALALVEEDLGREIARRVAAQLVMFFKRPGGQLQF
FT                   SRKGEARPAGRSVLQEVQRWIAANPELEHSVAEMAKHAGMSPRHFARLFRAEVGMTPAA
FT                   WVEATRISAARHLLENGHDTPKQVAAKCGFANVDTLRRSFTRHVGITPAEYRKRQAVVV
FT                   E"
FT   gene            113988..114629
FT                   /locus_tag="Bcep18194_C6613"
FT   CDS_pept        113988..114629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6613"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6613"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05663"
FT                   /db_xref="GOA:Q39PF3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF3"
FT                   /protein_id="ABB05663.1"
FT                   /translation="MTENVAGITIPDSQLTREITELVRDTASPLLFHHSSRVFYFAALA
FT                   GQRRGLKYDPELLYCGCMFHDMGLTHKHSSACERFEVDGANAARDFLKGKGISQQDIDV
FT                   VWTSIALHTTPGIPQHMHPVIALVTAGVEMDVLGLTYPEYSDVEREAVVRAHPRTPHFK
FT                   EDIIQAFYDGIKHKPDTTFGNVKADVLADKDPHFHAGNFCSVIRSSAWAG"
FT   gene            complement(114823..115209)
FT                   /locus_tag="Bcep18194_C6614"
FT   CDS_pept        complement(114823..115209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6614"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6614"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05664"
FT                   /db_xref="GOA:Q39PF2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF2"
FT                   /protein_id="ABB05664.1"
FT                   /translation="MDTILMQKWLTIGALSQHTGASVRSIRHYDEHGLLASVRASNGYR
FT                   MFPDKAVTQVRQIQRMIATGFTIDDIRGFPDCMLLIEGARSCDQVTEVQQQRLAAIERQ
FT                   LADLERRRARLIQTLSEGRIPPVD"
FT   gene            115297..116205
FT                   /locus_tag="Bcep18194_C6615"
FT   CDS_pept        115297..116205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6615"
FT                   /product="Alpha/beta hydrolase"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6615"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05665"
FT                   /db_xref="GOA:Q39PF1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF1"
FT                   /protein_id="ABB05665.1"
FT                   /translation="MRIRSLIDLLNAVVTAAILITSVPSAVAAPKSYMVTSKDGVRLAV
FT                   QEDGNPDGRPVILIHGLLGSRLDWDGQVQSAELRHYRIITYDLRGHGLSDKPSGAAPYR
FT                   DGRRWADDLDAVVKGAHARKPVVVGWSLGGVVISNYLAAYGDRDVAGAVFVDGVVELAP
FT                   GQIVDHPEVYRDMNSPDLKTHLDGERRFLEFCFNHRPGAETFSRLLANAAMASWDMQRA
FT                   IPTMTVSAAEGLGAARVPLRFVYGGHDALVDTRKTLARAITLNSRIATKVYADSGHAPF
FT                   IEEPDRFNYDLAAFVRSASGR"
FT   gene            116603..117073
FT                   /locus_tag="Bcep18194_C6616"
FT   CDS_pept        116603..117073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6616"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05666"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PF0"
FT                   /protein_id="ABB05666.1"
FT                   /translation="MPGEVMSTIAFHPSGVAHPRQAEFTILEQLLAIRVRSGADLAELA
FT                   SARVDVSVIDRLSERGLKSDELAFIIPRRTLSHRRQAHERLSQEESDKAIRLARIVAQA
FT                   TATFGDQDKAMAWLRNGLQRFGGRTSLDMASTEHGARLVEEVLTQIDEGYFA"
FT   gene            117070..117549
FT                   /locus_tag="Bcep18194_C6617"
FT   CDS_pept        117070..117549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6617"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05667"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE9"
FT                   /protein_id="ABB05667.1"
FT                   /translation="MTTLWRISNFADLKGIGGLRAGGRWHFAGQPVVYLAEHPALALLE
FT                   TLVHFEIATVAQLPSGYQLLRVEVADSVDIAEIAEGDAPDDWRTNIDWTRSAGTEWLHT
FT                   QPSALLRVPSVVVPHAHNFLLNPLHPAASEARVAEVMQSPYDTRILRLIQSKQGE"
FT   gene            complement(117591..118529)
FT                   /locus_tag="Bcep18194_C6618"
FT   CDS_pept        complement(117591..118529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6618"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6618"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05668"
FT                   /db_xref="GOA:Q39PE8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE8"
FT                   /protein_id="ABB05668.1"
FT                   /translation="MDTNRWIHDPVGAFRAWQETAATGADRRPFAPRSVVQHVAMFERF
FT                   LRYLIAQRVSLATFGPDHVAAFLAELERTCAPGTSTRVRYAKLIDRLSRHLVEAGVRTL
FT                   HPAGRTTRDLAWPDGEPEPCYLPPDADTALQRHVQPRAGDTPADCRNRAIVALLLASGI
FT                   TSAEIRATTCGAPDLDARPPALSVPRDRARPARRIALAEFALAPLAAWRVRSPDAPASA
FT                   LLFPAPRGGGAMNDMFLLLVVRDALTAIGFHAADLSPRVLRNTYARRQLLAGHAHADVS
FT                   AMLGLVSTRTVTRIRQTLPPDAAADRAAHER"
FT   gene            complement(118611..119084)
FT                   /locus_tag="Bcep18194_C6619"
FT   CDS_pept        complement(118611..119084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6619"
FT                   /product="small integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6619"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05669"
FT                   /db_xref="GOA:Q39PE7"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE7"
FT                   /protein_id="ABB05669.1"
FT                   /translation="MAFFASLVAFGNITDYATNFAFVHHVFLMDTTFPGNGIMYRAIGT
FT                   TWVHHVGYIGIISMEALTAVLCWIGGARLLRARRTGDAAFRAAKAYAIAGLTLGFLTWQ
FT                   VAFMSVGGEWFGMWMSKQWNGVPDAFRFFITLLLVLVYLTMNNDGIDDTRTAH"
FT   gene            complement(119409..120764)
FT                   /locus_tag="Bcep18194_C6620"
FT   CDS_pept        complement(119409..120764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6620"
FT                   /product="Xanthine/uracil/vitamin C transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6620"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05670"
FT                   /db_xref="GOA:Q39PE6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE6"
FT                   /protein_id="ABB05670.1"
FT                   /translation="MSHDPTSTPVDARLPAWQLVLFGLQHVLSMAASPITAVFLIAKVL
FT                   ALPAELTVQLIGATFFACGIGTLLQSLGAGPIGARMPFVMVPGGAPTMLFAGIAAQSGL
FT                   PTAAGAALLASAFYWVLLPVFTRCLRLFPRIVVGAMLLLVSVNLIRIYATIVVGQPGSA
FT                   DFAQPRALGLALATIVATVVVAGTFRGTLGRLAVLIGLMAGATLGWALDAMPALADVWR
FT                   GPLFTHPVWLPFGMPRFDVLAALPLLIFTAISMAEATAQTVAVGETCGKPISLSRDVPK
FT                   TIRGDALASFAGALFGTPLIVTSAENIGVVQTTGVRSRYVTAAAGAILIVIALFAPLAR
FT                   LAYAIPAAVVGGTALVVFAMIGVMGIRLLASVDLHARANQYTLAAALVVGLAPILVPNL
FT                   YRHFGTPVQIVLGNGMAAGTLAAIATQLAFAALARTRGQAGTVAATAPSRDA"
FT   gene            complement(120823..121947)
FT                   /locus_tag="Bcep18194_C6621"
FT   CDS_pept        complement(120823..121947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6621"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05671"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE5"
FT                   /protein_id="ABB05671.1"
FT                   /translation="METAVTTVDQITQRRRGVGLIAHDPALSAGGYTLIAPQTADGNVY
FT                   LVGIDGEVAHQWKMPVRPGRHAVILANGNLGYNGNHPQSESRYAPWSMWHGGDFYEVTP
FT                   QGETVWRYEDPAHHHDAQWLPNGNLLYAACEPVDAAFARRVPGGTPHGDDEVMYSDVIR
FT                   EVNRAGQIVWEWHARDHLRPEDFPIAAGFGRYHWPLVNGLAVDANGRVLMSLRTTSGII
FT                   GVDRATGRVDLRIGPDVVSHQHAPVPLANGNILAFDNGNFRHGTHVVFSRVVEIDPATQ
FT                   RVVWSYADDVVNLFYTPFMGNAQRLPNGNTHVTESSTGRLFEVTPAGEVVWEYVIPWFA
FT                   EYPDEAARKTGPGQLNSVFQTFRYSAAQLPWLRD"
FT   gene            122050..123006
FT                   /locus_tag="Bcep18194_C6622"
FT   CDS_pept        122050..123006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6622"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6622"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05672"
FT                   /db_xref="GOA:Q39PE4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE4"
FT                   /protein_id="ABB05672.1"
FT                   /translation="MRSISQTFRCFDEVARRGSIRKAADALHLTAAAVHQQIRNLEEQV
FT                   GVPLFDRLPRGMQLTLAGEIVIAAVRRGQRDFDNALTQVEDLRALRRGHVNLAVPASTA
FT                   EKLVPDAILAAMQRYPGVTYSVRSGNGESIVRWVETGEADIGYALRRRTSAGVVEVRAF
FT                   AQPLGVVTAPGHPLAASGGKVRMRDCFAHPLILMTPDTELRAMFDQIDARQPRNVRPLV
FT                   ETGSVPMVRRLVAEGAGVGFLIAENVAEDVAAGRLAWTPLADAGARSFSCIYQRADMSA
FT                   TVAMTMFLAFFSETIEAMESGFAPDGRAAGKRRRAAK"
FT   gene            123156..125231
FT                   /locus_tag="Bcep18194_C6623"
FT   CDS_pept        123156..125231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6623"
FT                   /product="gamma-glutamyltransferase 1, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6623"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05673"
FT                   /db_xref="GOA:Q39PE3"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE3"
FT                   /protein_id="ABB05673.1"
FT                   /translation="MGLSNALPAHRGGRRQRDVHRNDLQEHRQTMNRTAIFPYASALLA
FT                   AALLTACGGDVENEAARTPTPSTDASCLAVDNSGATVVVGSNQPGDPSLPEASSGYRTG
FT                   MKPVYAKTYLVATSNAYASAAGCAVLKKGGTAADAAVAVQAVLGLTVPEATGLGSGGVL
FT                   LYYDARGKTLQAYDGRETAPAAATENYLRYVDDATDQSAPLPNARASGRSIGTIGVPRL
FT                   IEALQQDHGRLPWQNLFGDAITLATNGFPIGGRLADAIAANAANLKRDPEAAAYFLNAD
FT                   GSPKTLGTVLKNPAYAHTLTLMAQSGANALYTGQIAQDIVAKIATTKGADGSTLTPGKT
FT                   TVADLAAYQAKRRTPVCTTYRSYWVCGMPPPSSGGIAVASALGILENYDLKSLKPTAID
FT                   LEGGKPTVAGVHLVTEAERLAYADRDKYVADTDFVPLPGGTWDTLLNKPYLKSRAALID
FT                   PTKSMGTAQPGNLGAVPLGVDTTLIEHGTNQFTIVDGDGNVLSATTTVESSMGSFHMTN
FT                   GFLLNNQLTDFSANPVDSAGNPVANRLQPGKRPRSSMAPTIVFGQAADGSRGDFVMATG
FT                   SPGGGTIPQYVVKTLVGALDWGLDAQQSAGLVDFGASNSPTTTIGGEHPNVNTANNGAN
FT                   DPLITGLLALGHKVSTSAQASGVNTVMRVTVGQSPALQGGTDPRREGVVLGDTFRP"
FT   gene            125311..125679
FT                   /locus_tag="Bcep18194_C6624"
FT   CDS_pept        125311..125679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6624"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05674"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE2"
FT                   /protein_id="ABB05674.1"
FT                   /translation="MTNAHLLEMDAILSVPGFFDFLGDLDCDRALDSRDAEPFDTQWMT
FT                   SFDEVDDDPGAAVDRPAVSVLREKAFKLAFGASGNAAVAACVSDDIELIARSRLSGSID
FT                   GWPTHVLWHAYRSGRFPC"
FT   gene            125981..126523
FT                   /locus_tag="Bcep18194_C6625"
FT   CDS_pept        125981..126523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6625"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05675"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE1"
FT                   /protein_id="ABB05675.1"
FT                   /translation="MNKIRTILVGAALTAMATSAAFAQTAQTGAQGSAGVGAQVQTPLL
FT                   GGGVGVQAGAGANAAGSGSGAGNAVGGALNGVGKTVGGVGSAAGNAVGGATHAVGSAAG
FT                   TAKDAAASAVHSTKSHVKHVAGTAKSHAQGAVSTAGDVAGGAKAKAGEALEGATNSVQG
FT                   GASVGVKGSASAQGGAL"
FT   gene            complement(126731..127402)
FT                   /locus_tag="Bcep18194_C6626"
FT   CDS_pept        complement(126731..127402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6626"
FT                   /product="Toluene tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6626"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05676"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PE0"
FT                   /protein_id="ABB05676.1"
FT                   /translation="MRNHSRKLIVCCSLVLGSMACPAICSASDSGNYVHIEDQTDPGVL
FT                   IQTATEKVQDELRKRAIDPADTSRIMDIVNRDILPYTDIRRTTRLATGRHWREATPAQQ
FT                   DELTAQFQRLLIHTYSGALGLLTPDQKFQYPGTHGDANRADTVVRTVAIYNGQPVEIDY
FT                   RLYRTANGWRVYDLNLLGVWLVQIYRQQFSDEIGKHGIDGLIALLTARNADMANHGGSV
FT                   R"
FT   gene            complement(127807..128733)
FT                   /locus_tag="Bcep18194_C6627"
FT   CDS_pept        complement(127807..128733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6627"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6627"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05677"
FT                   /db_xref="GOA:Q39PD9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD9"
FT                   /protein_id="ABB05677.1"
FT                   /translation="MKAFVRVAEEGSFTGAASRMNTTTSYVSRAISALETHLRARLFNR
FT                   STRRIALTEAGERYMRRCEQIFASIDEAEAEAADAQARPSGRLRVHSPTSFGQSYVVPA
FT                   VVAFRKQHPAVSVDLTLSQKVPDMLEEGYDVSLQLTATTLPDSGLISQRLGVLHSVLCA
FT                   SPSYLARHGLPRSVADLDGHQCVPIVSSLFPHDLWHFDGPHGDEPFRLPPASFLVNGAD
FT                   ALATALREEAGIGAVPMPTALPAMRSGALVRVLPEHTLQPLTAHVLYPSRQYLDAKIKT
FT                   FIEALHALIPRALEADSAALAALSGNG"
FT   gene            129062..129679
FT                   /locus_tag="Bcep18194_C6628"
FT   CDS_pept        129062..129679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6628"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6628"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05678"
FT                   /db_xref="GOA:Q39PD8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD8"
FT                   /protein_id="ABB05678.1"
FT                   /translation="MIKAIFFDYDGVLTTDRTGSVTTIRYLSGQFGVEYDILRNAFARH
FT                   NADLLLGKTTHNAIWRAVCESVRHELDFGWLEAAFLSTPANAGMFDLARRLEPFYALGI
FT                   ITDNKKDRIDCLRKAQRLDDLFDPIVVSAERGSGKEGAAVFEYALGCLDVKPEEAIFID
FT                   NTPENLIAPRQLGMHAILHDDSRNDIDGLIATLTTEFDLRLS"
FT   gene            129953..130723
FT                   /locus_tag="Bcep18194_C6629"
FT   CDS_pept        129953..130723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6629"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05679"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD7"
FT                   /protein_id="ABB05679.1"
FT                   /translation="MTILFRLLALACALWLAACAAPPPPPASTSASAAAPDASERRGLG
FT                   TAWGESVRSETRQVDFERADPAKPTDLASVYYNDALPGHPAASQVRRLPTRVALANGDI
FT                   ALSFTDEKGAPLRLARSDGRWHMAGVEGSRYMIVLRNQGRRTFEVVSSVDGLDVLSGRP
FT                   GSYTNGGYVLYPGRTLTIEGFRKSRDEVAAFRFAAVPDSYVANSKYGDAANVGVIGVAV
FT                   FAQKESEEEALRRNANPFPGNDNGYAPPPVPRGE"
FT   gene            130692..131480
FT                   /locus_tag="Bcep18194_C6630"
FT   CDS_pept        130692..131480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6630"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05680"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD6"
FT                   /protein_id="ABB05680.1"
FT                   /translation="MRRRRCRAASDGASWISRVRRDERCTRCAPDSGLPERHARACDEL
FT                   HDNPARFMRTRINPTKSVALKLAALALLASNAVVACAETPAPESVRLANGHEIEWVRPG
FT                   LVDVDAARHQKSALIVPAALRRVLRDASSLAFPSDHAKRIDGKDYLLVVVNRSSNSKPT
FT                   GYCGAGEEGALYVLELHRARAVSRFSLPVQSCVDSISLDTHDGAQSPYLAIAWREDPIG
FT                   IDIRWEYLAHGGATHRVYRFVNGTFVEAEVPQSRGRAAAQ"
FT   gene            131535..132077
FT                   /locus_tag="Bcep18194_C6631"
FT   CDS_pept        131535..132077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6631"
FT                   /product="protein of unknown function UPF0167"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6631"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05681"
FT                   /db_xref="InterPro:IPR005363"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD5"
FT                   /protein_id="ABB05681.1"
FT                   /translation="MSLPAFRYHPDPLATGSAIRSDARCACCGVARGYVYAGPVYAVDE
FT                   YEQCICPWCIADGSAHARFDAIFTDTDGIGGGEWDEVPDAVVDEIACRTPGFQGWQQER
FT                   WWTHCGDGGQFIGRAGAGELTTLGPQAVASIRESAGLDEGAEWERFFAALDKDGSPTAY
FT                   MFRCIHCGELGGYQDCD"
FT   gene            132142..133392
FT                   /locus_tag="Bcep18194_C6632"
FT   CDS_pept        132142..133392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6632"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6632"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05682"
FT                   /db_xref="GOA:Q39PD4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD4"
FT                   /protein_id="ABB05682.1"
FT                   /translation="MKFIHAADIHLDSPLHGLSAYPDAPAAQLRNASREALRQLVDRAI
FT                   EEEVAFLVIAGDLYDGDWKDHNTGIFFGQQMGRLRKAGIRAFVLGGNHDAESEMTKKLT
FT                   LPDNVTVFGHRKAETHKLPEFDVALHGQSFKDKAVVDNLAIGYPDPVPGYYNIGVLHTA
FT                   LEGYAAHANYAPCTLAELHAKGYDYWALGHVHEFQQWSGPSTVVFPGNLQGRHIRETGR
FT                   RGAVLVTVEQGRTQVERLYLDVLRWEAVSVDASDCFTVADLSRKIGQSLEALLTVDGHV
FT                   PRAVRVTVTGRTPAHGLFFGRAPQLRAEVLNQIGIIGNERLWLEKVRLATSAADHQPGE
FT                   SEQLEALEDLKQILADAARDPDFLELLERDLKPFVGKVRSDVKEEVPLLTMARAGELTA
FT                   LVEQVGPALLARLARGE"
FT   gene            133396..136866
FT                   /locus_tag="Bcep18194_C6633"
FT   CDS_pept        133396..136866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6633"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD3"
FT                   /protein_id="ABB05683.1"
FT                   /translation="MRINQLDLIKYGKFTDETLRFPSSGEDFHVIVGPNEAGKSTIRTA
FT                   VSELLFGMKLQTPLDFLHSTPELRIGGVLGSGTGELAFHRARGRSPLRTPADDKLPDDF
FT                   LAAVLDGATREFFEQMFGLDHGRLVDGGRSILDASDKLGQVLFESAAGVGSLGPVREEL
FT                   DARSVELWAPRRSGSAFALAETSFNEAVTELKTVQVRTRDWVERKDAREAVEQQIEQAR
FT                   AEQRRLEALRSKLERVRRLAPYLKELTVKDAALVELGAVVELPPTAYADLLKAQGDLAA
FT                   EQKVLEERRADLLAKRQTRDAIDADADTLALEADIEALDRLRGACMNHAQDLLLLGADV
FT                   ERHLAAAFAAAAQLDWPTDEASLRASLPTALSLKTVANLLREHGALHQALAGARESLDE
FT                   RTRELAQVQEQQARLSTVDVPEALRAALADAQGFRNSGQREQALEHEIAAAERTLSGAL
FT                   DALGQWRMPVDALRALDVPSAARLGTLLKEDSERASAVAAARDARDGTLEELERLELQE
FT                   KHFAENHKVVTTADVLAARARRDGAWGDIRSGAVDLATGAPAVDDAIRLADELVDAQLG
FT                   ATQAAATLQSLRQQVESARAGVTRRQAALDEREHELAAHRDAWAALATTAAVPGMPLAA
FT                   MGDWLAKRDAVFAAQADLDRQRREFDTIRAARAGAETTLRAALRTVSRGGESDGLTALV
FT                   AIAETFVQSAEKALAQQDSLEDRAREAERGCATAQSRAGHAQTAYDAWHAQWRDALADA
FT                   KLSTSAATLAAAEGALGLANAVTTELADADAPRNRIAAIRAELAALEAGARRLAEALAP
FT                   EWLTSGDWPDVARRLTMRLSSAREIARAIGRADEAVRQADGKVADAAAAVAGADARIQP
FT                   LLQLAGVASIDAALPLAERSDRQRQLRQSVDAAHEALVRDGDGLSRSAVEAEVAEQDIA
FT                   DVPAHLEAVKQSLGDVGKRLNELAQQQVVADQAFGAIDGQANAAVAESKRQEALAAMGD
FT                   AAEQYLEAATASRLLKWATDRYRDQKQGPMLRRAGEIFAGLTLGEFARLTVDTERTPPA
FT                   LYARRSKGASVEVAGLSEGTRDQLFLALRIAALELQLGSRTALPFVADDLFINFDDARA
FT                   KAGLDALRDLSTRTQVLFLTHHDHLLPLVRDVFGARVNVVELQRAPVGA"
FT   gene            136988..137512
FT                   /locus_tag="Bcep18194_C6634"
FT   CDS_pept        136988..137512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6634"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6634"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05684"
FT                   /db_xref="GOA:Q39PD2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD2"
FT                   /protein_id="ABB05684.1"
FT                   /translation="MKKLVAAIAFAADKHRNQRRKDEEASPYINHPIALADVLANEAGV
FT                   EDERVIVAAVLHDTVEDTETTEQELLRLFGKDVADIVMEVTDDKSLPKEERKRLQVEHA
FT                   STISRRAKLVKLADKICNLRDIARHPPADWPLERKQAYFDWAKSVVDPMRGVHPGLEAI
FT                   FDTAYDARPAD"
FT   gene            137522..138208
FT                   /locus_tag="Bcep18194_C6635"
FT   CDS_pept        137522..138208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6635"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05685"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD1"
FT                   /protein_id="ABB05685.1"
FT                   /translation="MRSARSIESAARQSLAVAGVDVGGEKKQCDLVILRGQAVVCREAR
FT                   IAPEAVPALCLAHDVVAVGVDAPSLWWTGSGRRAAEQALARERISCFPTPSREQAVAST
FT                   SGFFDWMFMGERVYRALADAYPLLTDACYAGGRASFETYPYAITCAMLGRDVASAKQKR
FT                   NQRRQLLERLGVDVSTLKSVDARDATLCALTAQCVIDGNAHAYGDAEGGYIRVPIVNET
FT                   IVLDAL"
FT   gene            complement(138381..138851)
FT                   /locus_tag="Bcep18194_C6636"
FT   CDS_pept        complement(138381..138851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6636"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05686"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PD0"
FT                   /protein_id="ABB05686.1"
FT                   /translation="MPRPNHALISTMDSTTQPGDADLRDEYAALRERAIILEEQAPPLL
FT                   QRISDVLPRISGESELADEHRERLVGARNAAMVSIENYQQAIPFLQTADSIIEQLDKTP
FT                   ERDEDIEWRESLLQRLDELIDVAVVMINDADGYFEQAQACDLSSVPKAILED"
FT   gene            139518..140997
FT                   /locus_tag="Bcep18194_CR0084"
FT   rRNA            139518..140997
FT                   /locus_tag="Bcep18194_CR0084"
FT                   /product="16S ribosomal RNA"
FT   gene            141061..141134
FT                   /gene="tRNA-Ile1"
FT                   /locus_tag="Bcep18194_CR0085"
FT   tRNA            141061..141134
FT                   /gene="tRNA-Ile1"
FT                   /locus_tag="Bcep18194_CR0085"
FT                   /product="tRNA-Ile"
FT   gene            141235..141307
FT                   /gene="tRNA-Ala1"
FT                   /locus_tag="Bcep18194_CR0086"
FT   tRNA            141235..141307
FT                   /gene="tRNA-Ala1"
FT                   /locus_tag="Bcep18194_CR0086"
FT                   /product="tRNA-Ala"
FT   gene            141598..144479
FT                   /locus_tag="Bcep18194_CR0087"
FT   rRNA            141598..144479
FT                   /locus_tag="Bcep18194_CR0087"
FT                   /product="23S ribosomal RNA"
FT   gene            144611..144723
FT                   /locus_tag="Bcep18194_CR0088"
FT   rRNA            144611..144723
FT                   /locus_tag="Bcep18194_CR0088"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(145576..146292)
FT                   /locus_tag="Bcep18194_C6637"
FT   CDS_pept        complement(145576..146292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6637"
FT                   /product="O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6637"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05687"
FT                   /db_xref="GOA:Q39PC9"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC9"
FT                   /protein_id="ABB05687.1"
FT                   /translation="MASPTIALLQRLHEESRTEIVARARAQFQGSNEDFLSLAEEYEAI
FT                   APRLRGRFLETFGLSSDDFESPEGSPLSLAVSPETGKFLRNMVLSQRPARILELGSSCG
FT                   VSTLYFAEALRTLGRGMVVATERDALKCAHLRAHVRTAGLDAYVDMREGDVFETVAELD
FT                   GTFDMVFIDVWADAYLKLFKQIERLLRPGSVVLADNMYTAEDAVRPYKHYLDDGPRYST
FT                   TTLDFESGVEFTVVVS"
FT   gene            complement(146398..146700)
FT                   /locus_tag="Bcep18194_C6638"
FT   CDS_pept        complement(146398..146700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6638"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6638"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05688"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC8"
FT                   /protein_id="ABB05688.1"
FT                   /translation="MNVRDESTGDCKQQPGVIAPVVDLKRCEGKGDCVAVCPEHVFEIR
FT                   RIDQTDFQGLDLMHRLKLRVHGMKVAYTPNAYACRSCGLCVTACPERAITLARTA"
FT   gene            complement(146697..147005)
FT                   /locus_tag="Bcep18194_C6639"
FT   CDS_pept        complement(146697..147005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6639"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05689"
FT                   /db_xref="GOA:Q39PC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC7"
FT                   /protein_id="ABB05689.1"
FT                   /translation="MNFRIRCAGKALLVLVAIGVLGWVVMMLWNWVIPALFVGARTIDF
FT                   AHALGLLVLSRILFGGFRGHHGWRGRRHWRKWESMTPEEREHFRTAWRSRSNRPTGE"
FT   gene            complement(147018..147602)
FT                   /locus_tag="Bcep18194_C6640"
FT   CDS_pept        complement(147018..147602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6640"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6640"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05690"
FT                   /db_xref="GOA:Q39PC6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC6"
FT                   /protein_id="ABB05690.1"
FT                   /translation="MESPPTSHMMTDPDRDITATVMRERTRLVKFIRRRIRDPDDAEDI
FT                   LQDVFHEFVQAYRLPAPIEQVSAWLFRAARNRIVDRFRKKKEQPLADLSEVDDDANSEY
FT                   RLDLALPAHDAGPEALYARTLVLKALQDALDELPTNQRDVFIAHELEGQSFKEMAAQSG
FT                   VALNTLLARKRYAVLHLRARLQPIYDELDNT"
FT   gene            148146..149975
FT                   /locus_tag="Bcep18194_C6641"
FT   CDS_pept        148146..149975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6641"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="with Cache sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6641"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05691"
FT                   /db_xref="GOA:Q39PC5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC5"
FT                   /protein_id="ABB05691.1"
FT                   /translation="MLSSIRARILATCVAIVVTALAVTGGLVYYVVKQHNDETIDQNHK
FT                   SILAGHALAINEWVASRGRETQALADTIAIGEGDPLPALKLLGKSGGFEVLTLGLPDKT
FT                   AFSNVPLAPGYDPTARPWYKQAVSAGSLVVTALYRDATTGKPAVAFAVPVVRDGTVKGV
FT                   LAASLFMESVSSIVTSVHPTPASFAFLVDKGGRVIASAKTDLIMKPATGLSPAFDADHL
FT                   GALQTASEPVAVDIDGATKLVRAQPIAGTDWSLVLALDKADVTAGMRAVATTTLAAILI
FT                   VAVIAAALVGAMTNAAFKRILLVRDALTDVSSGSGDLTKRLPADGADEAAQIAHAFNLF
FT                   AEKISTILLQIREFSESVNLASAEIAQGNQDLSGRTEHAASSLQETAAALEEIAGTARN
FT                   SADAASQVSHLAESASDVAVRGGAVVSEVVSTMNEITQASSEIANIVGVIDGIAFQTNI
FT                   LALNAAVEAARANEHGRGFAVVAGEVRALAQRSAQAAKEIKQLIHSSVEKIEGGSGLVQ
FT                   TAGATMNEIVEGVRSITSVIAEITVAAKEQSTGLEQVNQAVSHLDNATQQNAALVEQSA
FT                   AAATLLREQAARLAQTVGEFKLEDSRAMKLQSA"
FT   gene            complement(150026..150490)
FT                   /locus_tag="Bcep18194_C6642"
FT   CDS_pept        complement(150026..150490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6642"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6642"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05692"
FT                   /db_xref="GOA:Q39PC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC4"
FT                   /protein_id="ABB05692.1"
FT                   /translation="MHPPFTIRAARTADADDLTRLARISKAHWGYPKDWLDLWQSDLTI
FT                   APETIDGSIGYVAESGEAIIGFWVRASSESDRPTPGWLFVHPDHMGRGVARALWEEVRR
FT                   ESAARGIRSFVIEADPNAVPFYLALGAEKIGEKESSVVPGRFFPILRITI"
FT   gene            complement(150600..150971)
FT                   /locus_tag="Bcep18194_C6643"
FT   CDS_pept        complement(150600..150971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6643"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05693"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC3"
FT                   /protein_id="ABB05693.1"
FT                   /translation="MDAIRTAIEPSEAALRAAMLTNDVEALDALLDDNLVFTVPTGQVI
FT                   SKEDDLATHRAKLLRLDRLDVQETRACAIGEMILTTTKATLAGHFDGAAFDGVFAYTRL
FT                   WRRSPAGWRVAAGHASQVT"
FT   gene            complement(151064..151663)
FT                   /locus_tag="Bcep18194_C6644"
FT   CDS_pept        complement(151064..151663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6644"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05694"
FT                   /db_xref="GOA:Q39PC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC2"
FT                   /protein_id="ABB05694.1"
FT                   /translation="MMSVDQGAASIFGAIGTAVSLLAAIPYALAIYRRTVRPHLFTWLV
FT                   WSVVTAIAAAGQFVAGAGPSAWCTAAIAVTCFLTLVASLFRGERGWTRIDWLFLIAALS
FT                   AIPLWILTDDPTISICLVTLIELAGLGPTVRKTIRDPWSESLAYFALCVLKYALALLAL
FT                   STWSVAVAFYPAVNVIASIGICVVMLVRRQSLSNAR"
FT   gene            152048..153553
FT                   /locus_tag="Bcep18194_C6645"
FT   CDS_pept        152048..153553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6645"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6645"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05695"
FT                   /db_xref="GOA:Q39PC1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC1"
FT                   /protein_id="ABB05695.1"
FT                   /translation="MNPTSAENHQHADWRRLAAHVVPRTLAHIGGCSVPARSGRTFAAI
FT                   NPATEAVIAEVASCDAPDVDDAVRAARHAFESGAWSRCAPAERKRVLCRLGELIASHGA
FT                   ELALLDSLNMGKRVADAFSIDVPAAGGLFSWYGEAVDKLHGEVASTDPGNLAVVTREPL
FT                   GVVGAVVPWNFPLDMVAWKVAPALAAGNSVVLKPAEQSPLSALRLAELALEAGLPPGVL
FT                   NVVPGYGETAGRALGLHPDVDVLAFTGSTAVGKKFLEYAAQSNMKQVWLECGGKSPNLV
FT                   FDDTDDLDLAARKACFGIFFNQGEVCSANSRLLVQRSIHDAFVDRLIAHAAAFMPGDPL
FT                   DPSSGMGAIVDEQQHRRVREWIARGRDSATLAIGGGAPRVDGKGYFIEPTIFIDVKHDD
FT                   AIAREEIFGPVLSVMAFDTEDEAVRLANDSIYGLAASLWTGSLSRAHRVSGRLRAGTVS
FT                   VNTVDALSAQTPFGGFRQSGFGRDLSLHAIDKYTGLKTTWISY"
FT   gene            153635..155026
FT                   /locus_tag="Bcep18194_C6646"
FT   CDS_pept        153635..155026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6646"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6646"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05696"
FT                   /db_xref="GOA:Q39PC0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PC0"
FT                   /protein_id="ABB05696.1"
FT                   /translation="MNAPNFPHRTTQDYQRSDAAHHLHAFVDQKALNEEGARVMVRGEG
FT                   VHLWDNDGNRYLDGMSGLWCTNVGYGRPELVDAAARQMKELSYYNMFFHTTHPSVIELS
FT                   ERLFALLGNRFSHVVYTNSGSESNEVLIRTVRRFWDVMGKPEKKVLIGRVNGYHGSTVG
FT                   SASLGGMAFMHEMGDLPIPNITHVDEPYWYANGGDLSPEAFGKQAALSLERKILEIGAD
FT                   RVAAFVAEPFQGAGGMIFPPDGYWQEIERICRQYDVLLCADEVIGGFGRTGEWFAHRHF
FT                   GFEPDLICVAKGLTSGYVPMGGLIMSRRVGDALVDKGGVYAHGLTYSGHPVAAAVALAN
FT                   LDVLEREGLVERTKTDTGPYLQKALRDAFGSHPLVGEVQGVGAVGAIQFAKNKATRERF
FT                   ANEADLTWHSRTVGFELGAIVRSTNGRLIVAPPLVIDHAQIDELVDTMRKAVDATAREV
FT                   LGIDC"
FT   gene            155327..156736
FT                   /locus_tag="Bcep18194_C6647"
FT   CDS_pept        155327..156736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6647"
FT                   /product="cytosine/purines, uracil, thiamine, allantoin
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6647"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05697"
FT                   /db_xref="GOA:Q39PB9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB9"
FT                   /protein_id="ABB05697.1"
FT                   /translation="MSQGESIAHLEESTIQPIPLTERHGSAKDLFTIWFGSNIMMLTIV
FT                   TGSLSTTVFKQPFWWAALATLVGSLIGAVFMALHSAQGPQLGVPQMIQTRGQFGSFGAL
FT                   LVVALVVVMYVGFFASNCVFGGQALHSLSADIPLDAGVVVIGLISLLGSIYGYKLIHAY
FT                   ARLLSWCSGSVLVLAFVWIIFVHGLPADTFSKHSLNLSGFLGAMSVAALWQIAYAPYVS
FT                   DYSRYLPPDTGPRTAFWSSYWGCVLGSFFPMLLGCLVGLATPDGNVVSGLTGLTQGISV
FT                   LVIVVLSFGIAASNAMELYCGALSAITVLQTLFPSWSGKARARAITAIVLCGVALAIAL
FT                   FGQNNFLAGYTNFILLLLYVLVPWTAINLVDYYLVCHGEYDVDSFFRQDGGIYGRFNTI
FT                   AVGSYVIGIVAQAPFMATDLYTGELASRLGGADVSWIVGLSLTSLVYYAGCKLFSRPLQ
FT                   GVAASVDGVSR"
FT   gene            complement(156749..158074)
FT                   /locus_tag="Bcep18194_C6648"
FT   CDS_pept        complement(156749..158074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6648"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05698"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB8"
FT                   /protein_id="ABB05698.1"
FT                   /translation="MRSIDCRSQSMSDGNIRPTTTAPAPMQATHFSDAELADLRAHGIV
FT                   LFADRVIFDAQPPMPADQIATVQARCHGDIPPALLDLWRTTAGGSLDYDLTLEMNGHIE
FT                   GISWGELFYNDSNGYRDLQGWIDHELELAEEAAEEDSRAWSGKLDVLPFGGFEYCDRIY
FT                   IVTEPDAKDCGHVLAWKQGLPPAWRGAMHEDGLATIAPDLYAAFGALQLNTDPLEPGDS
FT                   GTGMTFLEYVDERRAGHGLSEPLADKLIAFYRRAMIDWRTPLAAGTLAAQPALARQALR
FT                   DAIDHDDTALTLQLAPLVANLGTALANSSIPTDYALRRKKFAAAAALLESGAPVAPDSL
FT                   ESASGNVPAALMRALLDAGAQPDVDAMARCVAGGGADSARLIGAALAAQGVDTEAAYRT
FT                   ASATLLRKFTADIAEVRTGKLSHYLGLDGLEAHAERLRTFVL"
FT   gene            complement(158141..159160)
FT                   /locus_tag="Bcep18194_C6649"
FT   CDS_pept        complement(158141..159160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6649"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6649"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05699"
FT                   /db_xref="GOA:Q39PB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB7"
FT                   /protein_id="ABB05699.1"
FT                   /translation="MGPQMISPDFVDDALACLRRQGLPTEPVLRTAGLPAAVREPVTPQ
FT                   QYGRLWLAIAGALDDEFFGLAARPMRHGSFTLLCHAVLHAGTLEKALRRALQFLRVVLD
FT                   EPHGELVVADGQAQIVLTQTGAPYPAFAYRTFWLILLGVACWLIGRRIPLQRIDFACPS
FT                   PDQRSDYHQFFGVPVHFDRPDSRLAFNAAYLALPTIRSEQALKTFLRGAPGNLLVRYRH
FT                   DTGWVAKTRAQLKTLPAAEWPDFDTLAVRLGTTPATLRRRLRSEGQSFAAIKDELRGAL
FT                   AQSLLRGDALSVAEIAAELGFTEPSAFHRAFRKWTGTSPGAFRRDVHAAEGEPGVASG"
FT   gene            159305..160972
FT                   /locus_tag="Bcep18194_C6650"
FT   CDS_pept        159305..160972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6650"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6650"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05700"
FT                   /db_xref="GOA:Q39PB6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB6"
FT                   /protein_id="ABB05700.1"
FT                   /translation="MSDGATAQAVPAYADAVARFSIETAAQQLHGDLERSLNACVECCD
FT                   RHASADAVALDWIDAGGQHHRYTFAQMKALSARVANLLVAQGVKPGDVVAGLLPRTPEL
FT                   VATILGTWRAGAVYQPLFTAFGPKAIEHRLRMSDARLVVTNVANRAKLDEIAGCPSVAT
FT                   VREPGETLPERDIDFRVALDAQPDTFEPVLRKGTDLFMMMSTSGTTGLPKGVPVPLRAL
FT                   LAFGAYMREAVDLRAGDRFWNIADPGWAYGLYYAITGPLLLGHATTLYEGGFTVDSTYD
FT                   VIERLGITSLAGSPTAYRMLMAAGTEAAARLKGKLRVVSSAGEPLNPEVVRWFDAALGA
FT                   PIYDHYGQTELGMVVNNHHGLAHAVHAGSAGFAMPGYRVAVLDDASRELGPGEPGNLAI
FT                   DIARSPLLWFHGYWQQDTPAIAGGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGP
FT                   FDVESALIEHPAVSEAAVIGVPDAERTEIVKAFVVLSKDYEGTPALAEELSLHVKRRLS
FT                   AHAYPRAIDFVDALPKTPSGKIQRFVLRKMEAEKVAQP"
FT   gene            160995..161762
FT                   /locus_tag="Bcep18194_C6651"
FT   CDS_pept        160995..161762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6651"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6651"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05701"
FT                   /db_xref="GOA:Q39PB5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB5"
FT                   /protein_id="ABB05701.1"
FT                   /translation="MDIKDRVFLITGAGSGLGAAVARMVVAEGGKAVLLDVNEEAGAGL
FT                   AHELGAAARFVKTDVTSEADGQAAVAAARDAFGRIDALVNCAGVAPGEKVVGREGPHSL
FT                   DRFARAVSINLVGTFNMIRLAAEAMSKQDANAEGERGVIVNTASVAAFDGQIGQAAYAA
FT                   SKSGVVGMTLPIARELARFGIRVVTVAPGIFATPMMAGMPQDVQDALGKSVPFPPRLGR
FT                   PEEFAALVRHIAENTMLNGEVIRLDGALRMAPR"
FT   gene            161781..162971
FT                   /locus_tag="Bcep18194_C6652"
FT   CDS_pept        161781..162971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6652"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6652"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05702"
FT                   /db_xref="GOA:Q39PB4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB4"
FT                   /protein_id="ABB05702.1"
FT                   /translation="MTTQDPIVIVGMARTPMGGFQGDLAAASASDLGAVAIRAALERAN
FT                   VPAERIDEIVFGCVLPAGQGQAPARQAALKAGLPLAAGATTVNKMCGSGMKAAMFAHDL
FT                   LLADSAGVAVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGT
FT                   FAEDCAQAYQFTREAQDAFAIASLTRAQRAIADGHFVSEIAPVTVKAGKSETVVSIDEQ
FT                   PGNAKLDKIPTLKPAFREGGTVTAANASSISDGAAALVMMRRSEAERLGLTPKAVIVGH
FT                   STYADKPGLFATAPIGALRKLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHEKV
FT                   NVHGGACALGHPIGASGARVMVTLLAALETYGMKRGVASLCIGGGEATAIAIERIV"
FT   gene            complement(163080..163772)
FT                   /locus_tag="Bcep18194_C6653"
FT   CDS_pept        complement(163080..163772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6653"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6653"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05703"
FT                   /db_xref="GOA:Q39PB3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB3"
FT                   /protein_id="ABB05703.1"
FT                   /translation="MRHDEAATEVTDSDETPAPLRRRKAHIRESNEAHLLACAEAVFAE
FT                   RGLDGASTAMIAERAGLPKANLHYYFPTKLALYRRVLDDLFEDWHRAAGSFEADDDPVE
FT                   AIGAYVRAKMALSRRRPLGSKVWANEIIHGAEHMQDILSERVKPWFDTRVKVIDGWIAR
FT                   GLLAPIDAHALMYLIWATTQHYADFDAQIRALSGKRTFTQKAFDEKTEQVVQLVIRACG
FT                   AVSPHAKD"
FT   gene            164129..165409
FT                   /locus_tag="Bcep18194_C6654"
FT   CDS_pept        164129..165409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6654"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6654"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05704"
FT                   /db_xref="GOA:Q39PB2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB2"
FT                   /protein_id="ABB05704.1"
FT                   /translation="MNAVSETVKRAAFDTSIKVDGKRLWDSLMEVAKIGATPKGGVCRL
FT                   ALTDLDKAGRDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGG
FT                   RFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLE
FT                   YGLSRKDVDGKTIGEELARIGYAGDVPCGGRKLHAAFELHIEQGPILEAECKTIGVVTD
FT                   AQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPFGCATVGMMQ
FT                   VYPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLETELEQIFYYKP
FT                   VAFDAACVEAVRSAADRFGFSHRDIVSGAGHDACYLAQVAPTSMVFVPCVDGISHNEIE
FT                   DATPAWIEAGANVLLHAMLSRACEPAS"
FT   gene            165545..166882
FT                   /locus_tag="Bcep18194_C6655"
FT   CDS_pept        165545..166882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6655"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6655"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05705"
FT                   /db_xref="GOA:Q39PB1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB1"
FT                   /protein_id="ABB05705.1"
FT                   /translation="MTTKPTGDIAAHRLSSTQLSCEFADIAPLLDPTAAAAAASRCHYC
FT                   YDAPCVQACPTQIDIPSFIRKIGNGNLKGAATDILSANPLGGMCARVCPTEILCEGACV
FT                   RNHQDAQPVAIGALQRHATDWAMETGAVRFTRAPDTGRHVVVVGAGPAGLACAHRLALA
FT                   GHRVTLFDARPKGGGLNEYGIAAYKTVDDFAQREVEWLLSVGGITLKTGVALGHDITLD
FT                   ALREQHDAVFLAMGLGGVRALSIDGEQLGGVMNAVDFIVQVRQADALENVAVGRRVVVI
FT                   GGGNTAIDAAVQSRKLGAERVTMVYRRGVDAMSATWAEREFAQKSGVTLVTHAKPVRMA
FT                   GENGQVTGVEFEAASGERFTVDADMVLKAIGQTLVPDAIDAALLTADGARIAVDADGHT
FT                   AWPDVWAGGDCAATGGVDLTVQAVQDGKRAAASIDATLAQRDAKAA"
FT   gene            166956..168272
FT                   /locus_tag="Bcep18194_C6656"
FT   CDS_pept        166956..168272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6656"
FT                   /product="dihydroorotate oxidase B, catalytic subunit /
FT                   dihydrouracil dehydrogenase (NAD+) / dihydropyrimidine
FT                   dehydrogenase (NADP+)"
FT                   /EC_number="1.3.1.2"
FT                   /EC_number="1.3.1.1"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6656"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05706"
FT                   /db_xref="GOA:Q39PB0"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PB0"
FT                   /protein_id="ABB05706.1"
FT                   /translation="MADLRCTIAGITSPNPFWLASAPPTDKAYNVNRAFEAGWGGVVWK
FT                   TLGLDPHVVNVSSRYGAVQWNGQRIAGLNNIELITDRPLDVNLREIAQVKRDWPDRALI
FT                   VSLMVPCNERDWKWILPLVEDTGADAVELNFGCPHGMSERGMGAAVGQVPEYVEMVTRW
FT                   VKEGTKLPCLVKLTPNISDIRMGSRAAYKGGADGVSLINTINSIVAVDLDHMAPMPMVD
FT                   GKGTHGGYCGPAVKPIALNMVAEIARDPETPNLPISGIGGISSWRDAAEFMVLGAGSVQ
FT                   VCTAAMHYGFRIVSDLADGLSNWMDEKGYATLDDIRGRAVPNVTDWKYLNLKYDIKARI
FT                   DQDRCIQCGLCHIACEDTSHQAITATKDGVRHFEVVDSECVGCNLCMHVCPVEQCITME
FT                   RVDSGDYANWTTHPNNPASAEAGASAGAAAPEKHAKKAA"
FT   gene            168373..169881
FT                   /locus_tag="Bcep18194_C6657"
FT   CDS_pept        168373..169881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6657"
FT                   /product="cytosine/purines, uracil, thiamine, allantoin
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6657"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05707"
FT                   /db_xref="GOA:Q39PA9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA9"
FT                   /protein_id="ABB05707.1"
FT                   /translation="MNHAANPADPDSAAAQGGSLYNDDLAPTTPAQRTWKWYHFAALWV
FT                   GMVMNIASYMLAAGLIQEGMSPWQAVTTVLLGNLIVLVPMLLIGHAGTKHGIPYAVLVR
FT                   ASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAIYTLLNILTGNALHGAALPVIGIGFG
FT                   QLACFLVFWALQLYFIWHGTDSIRWLESWSAPIKVVMCVALVWWATSKAGGFGTMLSAP
FT                   SQFAAGGKKAGLFWATFWPGLTAMVGFWATLALNIPDFTRFAHSQRDQVIGQSIGLPLP
FT                   MALLSVVSVVVTSATVVIYGNAIWDPIDLTSRMTGIGVGIALVILTLDTMCCNLAANLV
FT                   GPAYDFSSLWPKAISYRTGGMITATIAIVMMPWKILATTDGYIFTWLVGYSALLGPVAG
FT                   ILMVDYFLIRGTRLDTRALFDERGGFSYARGWNPAALAALAVGVLPNLPGFLHTAFPAS
FT                   FPNVPAFFNTLYTYAWFVGLVLASCVYGTWMKWRAGQHAQIASA"
FT   gene            169952..171409
FT                   /locus_tag="Bcep18194_C6658"
FT   CDS_pept        169952..171409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6658"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6658"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05708"
FT                   /db_xref="GOA:Q39PA8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA8"
FT                   /protein_id="ABB05708.1"
FT                   /translation="MAILIRGGTVVDADRSYRADVLCAAPEDGGTILQIAEQIDAPAGA
FT                   TVVDAHDQYVMPGGIDPHTHMELPFMGTTASDDFYTGTAAGLSGGTTSIIDFVIPSPKQ
FT                   SLMDAFHAWRGWAEKAAADYGFHVAVTWWDESVHRDMGTLVREHGVSSFKHFMAYKNAI
FT                   MADDEVLVNSFSRALELGALPTVHAENGELVFQLQKALLARGMTGPEAHPLSRPPEVEG
FT                   EAANRAIRIAQVLGVPVYIVHVSAKDAVDAIARARSEGLRVFGEVLPGHLVIDEAVYRD
FT                   PDWTRAAAHVMSPPFRSAEHREALWRGLQAGQLHTTATDHCVFCASQKAMGREDFTKIP
FT                   NGCGGVEDRMSVLWHHGVNHGRITPNEFVRITSANAAQIFNLYPRKGAVQVGADADLVV
FT                   WDPAATKTISVKTHHQQVDFNVFEGMTVQGVATHTLTRGALAWADGDLRAVRGAGRYLK
FT                   RPPAASYYEAARIANRLREPHPVERTG"
FT   gene            171688..173025
FT                   /locus_tag="Bcep18194_C6659"
FT   CDS_pept        171688..173025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6659"
FT                   /product="Na+ dependent nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6659"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05709"
FT                   /db_xref="GOA:Q39PA7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA7"
FT                   /protein_id="ABB05709.1"
FT                   /translation="MRRRAGPPAEQSNNIESKEYEVDILRSLLGMLFLLMVAYLLSNNR
FT                   RAVSGRTMIAALCTQLAIGALVLFVPAGRTALAGAANGVNRVLDMGNHGIAFVFGGLVD
FT                   SRMFQLFGDGGFVFGLRVLPMIIFVTALIAVLYYIGVMKWIVAILGAALAKLLGVSRIE
FT                   ACSAVATIFLGQSEMPALVKPFVRNMTSAEIFTVMASGMASVAGSVLVGYAGLGVRMEY
FT                   LLAASFMAVPGGLLFGKLLYPTVEPSRVVVDGLDFDDKRAANVIEAAASGASVGLRIAI
FT                   NVGAMLIAFVGLIALMNLIVGGVAAFAGFPQITLVGIIGHLFAPLAWIIGVPWNDAALA
FT                   GNFIGEKLIFNEFVAYGDLSPYLKGGAHVAAAGLQVLDPKTLAIVSFALCGFANFSSIA
FT                   ILAGGFSAVAPERRSEVARHGLRALTAATLSNLMSAAIAGLFFSLH"
FT   gene            173064..174380
FT                   /locus_tag="Bcep18194_C6660"
FT   CDS_pept        173064..174380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6660"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6660"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05710"
FT                   /db_xref="GOA:Q39PA6"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39PA6"
FT                   /protein_id="ABB05710.1"
FT                   /translation="MFLPQEFIRQKRNRQALDRDGIAAFVRGVTDGSVTEGQVAAFAMA
FT                   VYFNDLSTDERVALTLAQRDSGDVLDWHALELDGPVIDKHSTGGVGDVVSLMLGPMVAA
FT                   CGGYVPMISGRGLGHTGGTLDKLSAIPGYNVTPDTDAFRRAVRDVGVAIIGQTARLAPA
FT                   DMRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEQSAELAR
FT                   SIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSRPARLHDVTMALSA
FT                   ELLVTGGLAHDVADARAKLLRALDSGAAAERFARMVTALGGPADLIDAPARHLARAKVV
FT                   VPVPARASGVVQRVDCRALGLAVVALGGGRTRAADAIDYSVGLTALAEIGQRVEADQPL
FT                   GYVHARDAAAAAHAVDTIQRSYVLGEAGDAPPTIYQQIG"
FT   gene            174484..174873
FT                   /locus_tag="Bcep18194_C6661"
FT   CDS_pept        174484..174873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6661"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6661"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05711"
FT                   /db_xref="GOA:Q39PA5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA5"
FT                   /protein_id="ABB05711.1"
FT                   /translation="MERHELIEAAKAARERAYAPYSRFKVGAALQARDGTIFHGCNVEN
FT                   ASYGLCNCAERTAIFSAIAAGYRPGDFTRLAVVGDTDGPIAPCGACRQVIIEIGTPDIE
FT                   VILANLKGAVEVTTAHALLPGAFRL"
FT   gene            complement(174902..176017)
FT                   /locus_tag="Bcep18194_C6662"
FT   CDS_pept        complement(174902..176017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6662"
FT                   /product="Dioxygenase, iron-sulfur subunit"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6662"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05712"
FT                   /db_xref="GOA:Q39PA4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA4"
FT                   /protein_id="ABB05712.1"
FT                   /translation="MRAVPIPDSGTLGEPSSGAAVRDLRRVPIHPDHWYPLAWSRELKR
FT                   GKTLGVHFAGDPIVLVRTESGAVYALEDRCAHRQVPLHAGVVSGETLRCCYHGWTYACD
FT                   SGRCVDVPYLGRERLPNGVRAYPCREAHGLIFVFPGDATLADTRPFPALESADDRAYKT
FT                   RRFGREVKCHYSFMHENLMDMNHQFLHRKQMGQMRARSVGRRRGDDWVEVDYTFARMEG
FT                   KQPVGEALVFGASKKPADQSDKSVMTVRTGYPYQTLQIRSSEGTLVMDLWIVYVPLDAE
FT                   QRTNRTFGLLSIHKPGIPFALDLAWPLLVWFTERIFREDRWIVEREQEAHDAQGADWNH
FT                   EVFPVINELRDLLRQCGARTVIPIRDMRDGA"
FT   gene            complement(176242..176985)
FT                   /locus_tag="Bcep18194_C6663"
FT   CDS_pept        complement(176242..176985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6663"
FT                   /product="protein-methionine-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6663"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05713"
FT                   /db_xref="GOA:Q39PA3"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA3"
FT                   /protein_id="ABB05713.1"
FT                   /translation="MNTTSPRGPAPQRRTAMLRRIGAIAIAAAAVFGYQRIVNSAEPMR
FT                   TVPAPTLDETPGTSHDETAVLAGGCFWGVQGVFEHVKGVKQVTAGYAGGASETAHYALV
FT                   GSGLTGHAESVRIVYDPTQITYGRLLQVFFSVAHDPTELNRQGPDEGSQYRSAIFPTTA
FT                   QQRAVATAYIAQLGTAHVFPAPVVTRVEDYKGFYPAEAYHQNYLELHPDAPYIAYNDMP
FT                   KITGLKQHFPALYRTDAVLWRDARS"
FT   gene            complement(177061..178932)
FT                   /locus_tag="Bcep18194_C6664"
FT   CDS_pept        complement(177061..178932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6664"
FT                   /product="Cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6664"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05714"
FT                   /db_xref="GOA:Q39PA2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA2"
FT                   /protein_id="ABB05714.1"
FT                   /translation="MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLAG
FT                   MALTFAVVATLAAVGGGWVAQANQAGRWVAIVLLAVFGLTLLMPRLAEHLTRPLVAAGN
FT                   RLTGLAQRDGRPAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTLLLVA
FT                   YAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIKRGIGVALLAGVGAIALGLDTGALAQ
FT                   LSTVTTGGLETKLVDRLGGRSNGAPAAMSATVSATGKAADNTSGGAMMAAAADGAQAGG
FT                   AMAGSAMMRAVDATPAALPVEGKLPSLDGAVQWLNSPPLTAAGLRGKVVLVDFWTYSCI
FT                   NCLRTLPYTTAWARKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGY
FT                   SIWRAFGNEYWPAHYFIDAQGRIRHHHFGEGEYAQSERAIQSLLAEAGHPEALNVPLGL
FT                   AGAPAKGALAAADAADVRSPETYVGYARAESFTSPGGAVRDAAHRYDAPAHPDLNDWGL
FT                   AGTWQVGAERASLDAPSGRIVYRFHARDLHLVLGPGANGQPVRFRVTIDGAAPGNAHGT
FT                   DVDAQGYGTVTGQRLYQLVRQPGAIADRTFAIEFLDPGVNAYAFTFG"
FT   gene            complement(178968..179498)
FT                   /locus_tag="Bcep18194_C6665"
FT   CDS_pept        complement(178968..179498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6665"
FT                   /product="Methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6665"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05715"
FT                   /db_xref="GOA:Q39PA1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA1"
FT                   /protein_id="ABB05715.1"
FT                   /translation="MPTRRHLLFAGATGLAVLATLSSVGRRALVGRAFAAPPATPQTAA
FT                   PFEVTLSDAEWHRRLTPAQYSVLREAGTERPYTSPLNDEHRQGTFACAGCALSLFSSAT
FT                   KFDSHTGWPSFWKPLDHAVATTTDASFGMIRTEVHCRRCGGHLGHVFDDGPQPTGLRYC
FT                   MNGLALTFHPAAA"
FT   gene            complement(180021..181142)
FT                   /locus_tag="Bcep18194_C6666"
FT   CDS_pept        complement(180021..181142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6666"
FT                   /product="outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6666"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05716"
FT                   /db_xref="GOA:Q39PA0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39PA0"
FT                   /protein_id="ABB05716.1"
FT                   /translation="MSINSGSAAVLLLLFGNPPGLLISTGDNFSMKRFVQLLLMSIPGL
FT                   AMAQSSVTLYGLVDTGIQYLTHADSAGHRSIGMAPSAYLPSRFGFRGVEDLGGGVKAVF
FT                   QLENGFNSATGSMVVANTLFNRQAWVGVDGSIGKLTFGRQYSVQFDRGIYYDPTFFAAY
FT                   SALSLNAIPLATIRVNNSAKFTSSRFAGFTTEAMYGFGQQEPGNALAGRYIGAALEYTV
FT                   NRFTATATYEQARGMVTETGDLSSRIDNRYAFAARYNAAKFAVMANVTRVTGDLQLTPR
FT                   GTVYWLAGNVFITPFLQVYAIGGRYDYQGCDAHPMIFVAGTLYSLSKRTMMYANVGTAR
FT                   NNGGSSLGLNNYASVGQTGHSQLGVAVGIDQKF"
FT   gene            complement(181255..182646)
FT                   /locus_tag="Bcep18194_C6667"
FT   CDS_pept        complement(181255..182646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6667"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6667"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05717"
FT                   /db_xref="GOA:Q39P99"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P99"
FT                   /protein_id="ABB05717.1"
FT                   /translation="MSSVVFTGFILLSFCLALYSRRGVGKQSVHDFFVASRQFGAFLVF
FT                   FLAAGEIYSVATMVGFAGGIYAKGPTYGIWFLGYILLAYPLGYFLGPKIWEAGQRYNAI
FT                   TLADLFGGYFRSRSTEFVVALSSIVFLLPMAQLQFTGLVAAFRGLGWQFEPLHMVLIAG
FT                   VLAFLYIMIAGIRSSAYVAVLKDILMVLAIVITGLAVAGHVGVTEVFHAASLHVGNQMN
FT                   AEQLRFSMSTILLQSLGFLAMPFGVQIFFTAKSADTIRRSQIAMPLYMLMYPFLVIAAY
FT                   YAISQNLHLRSPNEAFFAAANALLPSWMLGLVAAAAALSGLLVLTSMCLAIGPIVSRNL
FT                   LPSLPSQRQTGAAKIVIFVYLGVSIAMTSAAPTLMLTLINVTYYGVTQFFPGLIAVLFS
FT                   LRIRPVAVTAGMLVGQGLALALYLGKVQLGGINLGLPCLAANIATVAAIHYLLGAAKPR
FT                   TLASQ"
FT   gene            complement(182663..182872)
FT                   /locus_tag="Bcep18194_C6668"
FT   CDS_pept        complement(182663..182872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6668"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05718"
FT                   /db_xref="GOA:Q39P98"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P98"
FT                   /protein_id="ABB05718.1"
FT                   /translation="MPKFLIGIAVPYLGVLGLLPWVSSVDAYVFGVPFIYAWMFAWFVL
FT                   TSACLYVCWRCFDKPAADAARLDV"
FT   gene            complement(182879..184315)
FT                   /locus_tag="Bcep18194_C6669"
FT   CDS_pept        complement(182879..184315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6669"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6669"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05719"
FT                   /db_xref="GOA:Q39P97"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P97"
FT                   /protein_id="ABB05719.1"
FT                   /translation="MEQQLWRLSATEMTALVARRDVSSKELVQSCLQRLEDVNPRINAI
FT                   VDVLADSALAAATAADEAVARREPTGPLHGVPVTVKVNVDMAGFATTNGVKAFGNLVAH
FT                   EDSPVVANLRKAGAIIIGRNNAPAFSYRWFTDNDLYGRTLNPWHPGLTPGGSSGGAAAA
FT                   VAAGIGPIAHGNDLGGSIRYPAYACGVAGLRPTSGRVPAYNPTQSHDRTLAVQLASVQG
FT                   PLARTVGDLRLALSAMAAPDSRDAWWMPVAPDGGPASTARFPARVAVCPSIPGVPTDPV
FT                   VADAVRQAARWLEDAGCLVEEVVPPRLNEASDLWLALVTNEAVSGLGKTIETHGDQAIR
FT                   NTFASQRRLATPLDLAGYMNGLAQRTGLLREWQAFFQQYPLLLMPVSCEQPFAIDEDQR
FT                   GDDVFRRILDAQGPLLATALLGLPGLSVPTGVRDGVPTGIQIVAGRFQEALCLAAGEAI
FT                   EARAGICTPIDPVGAARQEA"
FT   gene            184553..185488
FT                   /locus_tag="Bcep18194_C6670"
FT   CDS_pept        184553..185488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6670"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6670"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05720"
FT                   /db_xref="GOA:Q39P96"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P96"
FT                   /protein_id="ABB05720.1"
FT                   /translation="MPRREIQECRTAAGDMKDHQLKAWLALVETGSIRGAARHLHLSQA
FT                   AVTKAIRELEQDLEAPLISRSTRGVTLTECGQQLTVRARLAQAQLTLARQDIRQILGGK
FT                   HGHVSVAVTPMVFLGVLPGVIERFRKRMPLAKLTVEEGMMPHVLHALRDGSIDFAVAAP
FT                   ADEEVKGEFHFEPLQVMETVVACRRGHPLETATEWHQLVGCTWVMNLSPGSQHSNLLDH
FT                   LRRTHHALPDSIVRVNTFGVGWNLMTRSDALLSCPAEMLAVEPYAAQACRIPLRMALPP
FT                   LTLGILKLRDAPLSLAAETLVALFRQDLAD"
FT   gene            complement(185850..186239)
FT                   /locus_tag="Bcep18194_C6671"
FT   CDS_pept        complement(185850..186239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6671"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05721"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P95"
FT                   /protein_id="ABB05721.1"
FT                   /translation="MSKLAILTGGRDLNRGASRIRVSSYAFVAEVDVVLLRSRARRAYQ
FT                   CNCSNCSPLQRSRPAFASTRAFSKRCKKPKPPIRRVSLGSEDSAQCAAHQTRGVMRDRI
FT                   QTTFVPQSDSIGKPKSGFAAPLDEH"
FT   gene            186452..187648
FT                   /locus_tag="Bcep18194_C6672"
FT   CDS_pept        186452..187648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6672"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6672"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05722"
FT                   /db_xref="GOA:Q39P94"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P94"
FT                   /protein_id="ABB05722.1"
FT                   /translation="MHDATQRFDVIVVGGGPMGLATAYHLGKRKARTLVLEQFTFVNQL
FT                   GSSAGVSRQFRIPYPDAYMVKLVKQSIPYWDELQSLTPVPLMDTVGTLWFGDPSVKSTE
FT                   GNIPAAEQELKAEGVAYETLDAHELEKRFHFRNLPSTYTGLFQAQGASIDLAATQRTLL
FT                   DWNERSPFVQLLQEAPVIGIERRQGLFEVKTPLGTFSAEKLVLTPGPYADDVFRLLGFR
FT                   IAATYWNMASAYYRKTRPDIQYPTWFVFQNPVGDNGNQFYGFPEVAWNYPGYIRVASDF
FT                   VLAPLTSPDQRTPIPNPQELAFTAEWVGEHMEGLEPVPRFTSTCLVALSKIANKELLID
FT                   FAPDYVPNHRDIVIYATGWAGKFVPLLGEILCQLTLDGHTPFDISHFSTGSRYFNKLA"
FT   gene            187682..189673
FT                   /locus_tag="Bcep18194_C6673"
FT   CDS_pept        187682..189673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6673"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05723"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P93"
FT                   /protein_id="ABB05723.1"
FT                   /translation="MASKTYSIFGCGAAGLYTAWRLLNGQARAGGDPNRQLQQGDVLEL
FT                   FDWGKYDFSQEFQGTRAPGARVCTWHYKNNPDHSYLELGGMRYSQWNGKNDGKAQGHRL
FT                   VTTVIAKLGLDRYAVPFNESSDPLYYLRARNLYQSDISSRNPAPYAANNFGAATTPDQG
FT                   FAAVEAVAVTSTSGPGTRKQWDAFYQQGRITAELPSSSIFQKGDLLKDIGYWNLMYDQL
FT                   GSEGYQYAADGNGYSSNVINWNTAVAFEANNEFTPGNQYMTLTTGYSGMFQALFAAIEQ
FT                   LARQRGVTLQYYPNQRLRSIHVENGVVHYTIATREDPYREAARRATAAAWLAMPRAALE
FT                   QVAQGSRYDDRGGLDVLNDRKVKLYLESAIMQPSYKVGMFFEKEWWLDPATTYPPKING
FT                   YEVTHAVIASLKEQDFPPVFVHAMSGSHKILNVQFASADALVKAVEEAAGERMTVKQET
FT                   SLLIAATRNTMGPSVTDTPIRMVVYFGNNAADKHAKPVYGLLASYDDETFTTFWRELEL
FT                   GPNEERHVPIADDIQPLIGPRKVPDRMVKMLRKQLAELHFGPNSNYADVPEPLEAAYVD
FT                   WSLPPFRAGYHAWAAHYDVADVQQKIRKPSQLIDGKDAPIFIVGECYSNDQAWVEGAYC
FT                   TAESVLNDFFDIEPLIDDSEYPFICKPI"
FT   gene            189887..191413
FT                   /locus_tag="Bcep18194_C6674"
FT   CDS_pept        189887..191413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6674"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05724"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P92"
FT                   /protein_id="ABB05724.1"
FT                   /translation="MQSLRLWRHLAPGGSSPGRLALGKLAAEGPTTKPVLNNELSTRDY
FT                   VTYLLSIDAEIEHCLMVQYLYAGYSLGGPQVPEAFRDTVRNWQETILGIAKEEMGHLIT
FT                   VQNVLRLIGSPLHFERDDYPWDTPFYPFPFMLEPLTLDSLAKYVYTEAPPDWDGGELGA
FT                   DIRRRVGEQASNPHQVAELFDTLIPLVRDHLPDEVFQADTYRCQADFAEWGRGYKGGHR
FT                   GGGGRAPGGTPDVLVMPATSRDDAVNALDKIAQQGEAPHGKDPSHFVRFLRIYVEMLAV
FT                   VEGELFGVDTWRAARPDDFLEEAWTEAYPAAAADLQAAQVDETWRPSRPVAVNPYVALD
FT                   PEFEPELGGTPVTPITEPVTQLWASLFNLRYRMLLQYLIHSFTLYGGLNAAGQFTPRGT
FT                   IVNAAFGEMYNLRALSEILMQSRVSAEPDASLAGPPFQMPYTLNSPFGEANRWRGHLDL
FT                   LAASENLVVELLANTDAGRHPYLLSLREADRNLAAVARRILSGEVDLALL"
FT   gene            191423..192859
FT                   /locus_tag="Bcep18194_C6675"
FT   CDS_pept        191423..192859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6675"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05725"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P91"
FT                   /protein_id="ABB05725.1"
FT                   /translation="MPILELRILPPVAVGRLGAAATPLEAFDLVVDPDNPLDFRRIVPC
FT                   TTLEVDPESGEIAKAYVPDTIRFKDENRKVRPVAPFLEVFARTSEAPHTLQPLTLQLLA
FT                   AEQLDLDALHWDIHLGNIKIYRRTNDPNDKIHANLTGLKDHARHAMLGHCEHFRAGRLL
FT                   PLGHVQFVKPTAQFPEIRLRYTPAAGIVYGTRLVRRTSDKERESELKPDPVIDRDDLLL
FT                   YAETPGKWLGFREAGGPTKAHPAPTNPAQIFAGYADKDGNQVSWGYLDDECDGHVQVVL
FT                   TKRDGSTLRAHGYIGAGPPAYAPDTMPVRVVSDEMEQILQGIHVPEESVSIDEATEIVL
FT                   RALETIRLMNTAVMNGNPVNGRLNVASTMVRQNTADFERYYEPIAAESIVDNLALRALH
FT                   ERVFSTLAAGGAPWFARLLRQPEEIGDLTAEGLRKMPALMRGADGRSLTLTRRHINLVI
FT                   KAARDAMFGQPDPKGDKHVG"
FT   gene            192849..193712
FT                   /locus_tag="Bcep18194_C6676"
FT   CDS_pept        192849..193712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6676"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05726"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P90"
FT                   /protein_id="ABB05726.1"
FT                   /translation="MSVNDPNVPKDLEQPGNGEIRASNLTAQIHHRGVGNPVSVLPRTA
FT                   ISNCFPGLEFDFRNLWRRAFVGITLVENNNYVIDAEPGYEHLKTRRLLSFDGHKVGTMV
FT                   LTTGPVLPGGDPVTLASKPNPNAVSFMEWSNSIARIVHLQGKPVECEFTAHDNALEEVY
FT                   YDHGKTETLKVTLTLRRFFEGDTASFNLEMLKPGELTQGLCAPWQNDYRECACYYWAAS
FT                   RPDFVNVEPGDDGLARGDMWFAKRRTGTYVPDNRVDTRLWSYDDLFRSWQEDLQFVIRG
FT                   KDADET"
FT   gene            193702..195114
FT                   /locus_tag="Bcep18194_C6677"
FT   CDS_pept        193702..195114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6677"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6677"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05727"
FT                   /db_xref="GOA:Q39P89"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P89"
FT                   /protein_id="ABB05727.1"
FT                   /translation="MKPDRAVEPLAPLASAMATRIVAASRPRHPGIHVVEDAEGAQLLL
FT                   VNGSRLFHVPRDLHDAFQAALEDGDAQAVASLVASRGLDMRPAIDDAPLTEMPVHALSL
FT                   AVAQKCNLGCTYCYAQQGEFGGKAKNMPLETALAAVDLLIEQASEGGKINLAFMGGEPL
FT                   ANRAVLRAATVHARERADARGIRCQFSVTTNGSLLQEDDGAFFEEHGFAVTVSLDGPAP
FT                   VHDRLRPFKGGMGSFDHIVERVTPLLARQRRMQVSARVTVTPFNLDLPSTLDTFVDMGF
FT                   HSVGFSPLLRASNGRAEMGPDDMADMLQGMIACGLAFEQKVMRGERYPFSNMQNALREI
FT                   QRGTHRPYPCGAGAGYLGVSADGELAACHRFVGDEAGVMGHLATGVDQARQTIWLAERH
FT                   VHQQQPCNTCWARYLCGGGCHHEVLERGRSACDYIRGWLHYAIGAHGRLARYAPAWFAG
FT                   SPGASASGAGTA"
FT   gene            195111..196631
FT                   /locus_tag="Bcep18194_C6678"
FT   CDS_pept        195111..196631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6678"
FT                   /product="Tryptophan halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6678"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05728"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P88"
FT                   /protein_id="ABB05728.1"
FT                   /translation="MNRTFDMLVTGAGPAGLCAALRLNHLGHRVLLVERSPLWPRPQIG
FT                   EALTPGVRNIIDYLDADEVLESVPIVAGKPTRVRWTSESIETVAHDGAVVERAAFDAAL
FT                   LRLAVARGVDVLRPASLAQVDGAPGAWRVQIATPDGLRSVEAHVLLDARGRQSRREPQR
FT                   LHARRLSTVWAEAAMATPAAHADAATRVEALDDGWMWGAALPGGRYRVMFTFDPSARDD
FT                   AREREPASVLRNACTRSALFKDMAGVRWCDSPRMCVSTPYVDALSWQDGRIKLGDAAFA
FT                   LDPISSSGVEKAMRFSLQAAIAINTWCRASDASERELAQRFYESRLIEGAARHLAWTAG
FT                   YYRQAWCAEAPFWRLRSAPALTSDTVATPSLGDETAARVDLMTHALQDEWARVPSDQPQ
FT                   PGEPAPPPPLPLHSPIRFARNTGIVVVPCATDDRVTAHPALQHPSLDRPVAFWNGVALF
FT                   PLLDMLTRATHPLELMAFLGRSMEAASAQQLLEWLWSRQMVEPAVFGA"
FT   gene            197145..197735
FT                   /locus_tag="Bcep18194_C6679"
FT   CDS_pept        197145..197735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6679"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05729"
FT                   /db_xref="GOA:Q39P87"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P87"
FT                   /protein_id="ABB05729.1"
FT                   /translation="MAQTYAVVRDSSKNFFIAVKNTKGFFFHTDNNGNGVIYQNGTVIK
FT                   NGPGESALPGGGLAANTDPAIGAANEFQEETGVELRNFDGKLMPKEWHGVTGKYEYYGV
FT                   YYQFSSAVFNDISSRAIANLRTGADAAAAIRNGKIKTYKDIFKTYPNCPADNELATGSV
FT                   WNLDRDWSRIQALNNSQSTSWFYEILKNLKNNI"
FT   gene            198154..198477
FT                   /locus_tag="Bcep18194_C6680"
FT   CDS_pept        198154..198477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6680"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05730"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P86"
FT                   /protein_id="ABB05730.1"
FT                   /translation="MNRHERSTLARWIAVNQEEQARARALLVLADAPQHVEAIIAALGA
FT                   ATDTLSVEDADPLWAQLQAIARTTGIDNTARSTAYHRDARACRIVWNISRPISGVFLVF
FT                   ELE"
FT   gene            198663..198959
FT                   /locus_tag="Bcep18194_C6681"
FT   CDS_pept        198663..198959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6681"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05731"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P85"
FT                   /protein_id="ABB05731.1"
FT                   /translation="MSHGNRMKDASKFWMLNRIRHNTTGIGDLKRPRLRVPNQARRKRP
FT                   LFLETEDGKSSVRWNAGLRRRDDRRRGTRRLPCRFRFRRIRRRHPLRIDRFEG"
FT   gene            198997..199770
FT                   /locus_tag="Bcep18194_C6682"
FT   CDS_pept        198997..199770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6682"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6682"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05732"
FT                   /db_xref="GOA:Q39P84"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P84"
FT                   /protein_id="ABB05732.1"
FT                   /translation="MKRIMIGLVALAMSATGFAKEWTTIRIGVDPSYPPFEYKKPSGEL
FT                   TGFGVDLGNEVCRRLNAKCLWVENAFDGMIPGLKARKFDAILSSMSMTPARLKQIDFSN
FT                   KTAHAPTFLVVKKGSGIQPTPASLNGKAIGVLQGSMQETYAKAHWEGGGARILSYQNQD
FT                   QVYADLTNGRLDAALQNGVQASRGFLNTPQGKDYAFAGGELSDPKIFGPGQGIGIRKDD
FT                   TDLKDKINTALAAIRADGTYDKIASRYFNFDIYGN"
FT   gene            complement(199758..200156)
FT                   /locus_tag="Bcep18194_C6683"
FT   CDS_pept        complement(199758..200156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6683"
FT                   /product="Transcriptional regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6683"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05733"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P83"
FT                   /protein_id="ABB05733.1"
FT                   /translation="MISHTTGIGVALVVRTPRSVQSTDAGAQLVQSLEGPLVDIGSALD
FT                   ATDTTDAPRGHLRLTATSIAESFLSGPLLASFAERYPDVTIDVTVTEEEFDIVERGFDA
FT                   GIRLGQVIEKDMIAVPLGGEQRACAQLP"
FT   gene            complement(200173..200904)
FT                   /locus_tag="Bcep18194_C6684"
FT   CDS_pept        complement(200173..200904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6684"
FT                   /product="transcriptional regulator, LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6684"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05734"
FT                   /db_xref="GOA:Q39P82"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P82"
FT                   /protein_id="ABB05734.1"
FT                   /translation="MPTALIADDEPNLSAELAARLATLWPELEIVGMPRNGVDALAELN
FT                   AKRPDFAFLDIRMPGIDGLKIASLVPHVHVVFVTSYDEYAVQAFDQSAIDYLLKPVADD
FT                   RLLRCIVKLQRGGPAPTDTELLANAAEPRDAAPIRWITVGLRDTTRLVSVDEVLYFQAA
FT                   DKYTEVVTASERHVIRTPLREMLQRLDTERFAQVHRGVIVAYAAIDHIERDLLGRQRIH
FT                   LRGSGDVLPVSRACAGLFKQM"
FT   gene            complement(200906..201979)
FT                   /locus_tag="Bcep18194_C6685"
FT   CDS_pept        complement(200906..201979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6685"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6685"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05735"
FT                   /db_xref="GOA:Q39P81"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P81"
FT                   /protein_id="ABB05735.1"
FT                   /translation="MPSKPFAFLSFEPHVGPAQRGRSLLGLFCFNSAVGLIFWATRRNE
FT                   ALLPYLVVANGIGFSATLLSVAIDRLVRGKLALVPKILIVAPASVFIGFEVAASTIGHV
FT                   PHLIGHAGVKVWLAYGSSFIVAGAACAFVSVFVQAARMRTSLETQRREAAEARQAETAA
FT                   RLALLQAQIEPHFLFNTLANVQSLIERDPARATTMLDSLNRYLRASLGRTRKATSTLEE
FT                   ELELVEALLKIATIRLGEERLRYTIDVPDALRALPLSPLLLQPLVENALLHGIEPSVDG
FT                   GEVRIRGTRDGGLLVLSVSDTGVGLGNGGTKLHGGVGLANIRARMISLYGERGRVSVGA
FT                   NADAMRGVTATLQIPIA"
FT   gene            202178..202750
FT                   /locus_tag="Bcep18194_C6686"
FT   CDS_pept        202178..202750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6686"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05736"
FT                   /db_xref="GOA:Q39P80"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P80"
FT                   /protein_id="ABB05736.1"
FT                   /translation="MSAGCGASVQVLTMPHFPAYVYVLFCVLVYIGVKRCFVREVRPVR
FT                   PLLFPVVFVGLGLSSLGHLFPRAGADAYAAAVAMLVVGTAGGWFHARRWRLQFRTGPEG
FT                   MFVRLPGDASLLVTLLLTFAAETFIHYAIATSRPWAATGAFAALSFAVWGGLVGMPLGR
FT                   AINVVTRSIRHANGAPEEGGGSALESR"
FT   gene            complement(202967..204229)
FT                   /locus_tag="Bcep18194_C6687"
FT   CDS_pept        complement(202967..204229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6687"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05737"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P79"
FT                   /protein_id="ABB05737.1"
FT                   /translation="MARSRVAVLVCAAGFAAAQAAVAADDADGDALRLADTATAAPVTP
FT                   GNWRGTFEAAVANYTAASQTGPVTLNDNARVSNTLSYDGTSGNWRVIVSNRFDAGWRAG
FT                   TSQYNAVDTLKQAYVSWQASPNAIVDVGRVNLREGVASGFNPTDFFKAGALRSVVSIDP
FT                   ESLRENRLGSVMARGQLLWSSGSMTALVSPRLDTHPNEATFNPDLGATNARTRYMLSGS
FT                   QRLFGNFSPQWLLYGGEGIAPQLGVNATTLIDDATVGFLEYAIGRGSAVADFSQAASSW
FT                   TSKLATGVTHTFANKLSLTLEYDYDGASASAAAWRALQNDPSRYWRYRDSASIAQELMT
FT                   RRSLFVYASMPDVFVQHLGLTAMARYNLDDHSYFTWLEARYHWPRTDFAVQWQSNHGSA
FT                   RSVYGAQAQSEIVQAIATFFF"
FT   gene            complement(204233..205018)
FT                   /locus_tag="Bcep18194_C6688"
FT   CDS_pept        complement(204233..205018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6688"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05738"
FT                   /db_xref="InterPro:IPR011220"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P78"
FT                   /protein_id="ABB05738.1"
FT                   /translation="MRFPLPILRTAAMLLAIATTAAAAAEPSAQQLLAQSDAVRNPDKP
FT                   FGLTTTLLEFRNGQQTDAEVLKIYSKADPATSQFRTLVQFVAPARDANKLMLKNGNDLW
FT                   FYDPSSQASVRISPQQRLLGQAANGDVVTVNWANDYDASLAGEENVADGEHQTRHCYRL
FT                   HLTARAPDVTYHAIDLWIASDTKRPVKARFFAASGSVLKIAYYRHYQDQLGAARPTETV
FT                   IIDGLDPSWVTVMRYTDYAWRDIPDAWLQRAYLSRFKAD"
FT   gene            complement(205034..206431)
FT                   /locus_tag="Bcep18194_C6689"
FT   CDS_pept        complement(205034..206431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6689"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6689"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05739"
FT                   /db_xref="GOA:Q39P77"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P77"
FT                   /protein_id="ABB05739.1"
FT                   /translation="MSLWVLAFRNLLRNRRRSSTTLLAMVVGLAAILLFGGYARDINYG
FT                   LQTSYVRQGGHLQIQHRDYFLYGSGDPVSYGIADYRKIIDTVLGDPELAREVTVVTPVL
FT                   AINGIAGNFAAGVSRTVSGSGIVVADQNRMRQWNDYGFADRATPLALTGSAANAAVIGT
FT                   GVARVLHLCDALRVPDCRDPVTAAPAGASDLPDDIASLSQAEAAAKPVHRSGLARLELL
FT                   TSNAYGAPNVAELSVIAAQKQGVKQVDDLFVQVHLPQAQQLVYGSGPSAKVTSIVVQLK
FT                   HTADLPAARARIQTLLRTRLAGEPLEVLGFATLNPQYGQVTGMFGAIFGFIAVLIATIV
FT                   LFTVGNTMNMAVMERTHEIGTLRALGLRGAGIRRLFVCEGCLLGLCGAVAGTVLALAAG
FT                   VAINRAGLHWTPPGQTDPVALSVRVWGEFGMIARYALGVTVVATLSAWLPAHRAARLPI
FT                   VDALRFA"
FT   gene            complement(206428..207132)
FT                   /locus_tag="Bcep18194_C6690"
FT   CDS_pept        complement(206428..207132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6690"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6690"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05740"
FT                   /db_xref="GOA:Q39P76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P76"
FT                   /protein_id="ABB05740.1"
FT                   /translation="MAASLSHVTKTYGTGPLAVAAADDASLEILANRFTVLSGPSGSGK
FT                   TTLLNLLGGIDRPTRGAITVAGQRIDAMRENALADFRARHVGFVFQSFNLLPVFSAFEN
FT                   VEYPLTLLGVARARRRDRVLALLDAVGMGDKANRRPGQLSGGQQQRVAIARALVTEPAL
FT                   VLADEPTANLDSATGAAIIALMRTMQRERATSFVFSSHDPQVIAAADDVATICDGRVVD
FT                   TRSATLHEEACQ"
FT   gene            complement(207117..207431)
FT                   /locus_tag="Bcep18194_C6691"
FT   CDS_pept        complement(207117..207431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6691"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05741"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P75"
FT                   /protein_id="ABB05741.1"
FT                   /translation="MLIGCECIDSSPEETIVRPIAETGDEPRMEPMECNAGGRPPTGRD
FT                   PLAAPVRDSARRRPPFVGEECRSSARSAVRRTAPCGRAVAAKVATSIEYPGRCPCWRPA
FT                   "
FT   gene            207513..207962
FT                   /locus_tag="Bcep18194_C6692"
FT   CDS_pept        207513..207962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6692"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05742"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P74"
FT                   /protein_id="ABB05742.1"
FT                   /translation="MSDTRFERGSETARPGFLALCRVVRDPSDPARFAGDADPRRYGDW
FT                   SSAQPALLVIEALHQFAVKASRTMHGAPALMVPAQLRELTLHRVDGYPRLALSGTVAKH
FT                   GDGYRVDVSARNADANMYPAVASGTVFVALMPARVPAFSAPGARP"
FT   gene            207959..208330
FT                   /locus_tag="Bcep18194_C6693"
FT   CDS_pept        207959..208330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6693"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05743"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P73"
FT                   /protein_id="ABB05743.1"
FT                   /translation="MMPATATAAAMITGEQFGVIDVANTAPLFDEHFEQFPVLPGSFSL
FT                   SLAIGMLFDALGIEANRPAPALTLRKVSFICPVRPGERLTARLRRLQQDGARTTAHVEL
FT                   RNANGQGVMDGILSWEHDA"
FT   gene            208327..209055
FT                   /locus_tag="Bcep18194_C6694"
FT   CDS_pept        208327..209055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6694"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6694"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05744"
FT                   /db_xref="GOA:Q39P72"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P72"
FT                   /protein_id="ABB05744.1"
FT                   /translation="MTKLAIVTGGTRGIGRAIVDALIADGHTVYFTYRSNPELADALER
FT                   TYDGAARAFRVDGGDWDAVQAFADRVNAEAAVDVLVNNAGINDDALLIGSPFARYWEAL
FT                   RINLGATMAFCHAFGDGMQARRRGAIVNVSSIAARKPKAGNGAYGASKAGIERFTKTLA
FT                   LEMARFGVRVNAVAPGFVRSDLFERFLASQDAAAFYRQIPMRKILEPDQVARAVLLLAN
FT                   GSLATTGSVVDLGNGENISG"
FT   gene            209081..209437
FT                   /locus_tag="Bcep18194_C6695"
FT   CDS_pept        209081..209437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6695"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05745"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P71"
FT                   /protein_id="ABB05745.1"
FT                   /translation="MKEDIKNIVAQILYLSGPEQVTDSASLFRELNMSSIDYVDLCYEL
FT                   KDKVDNRISLENLWPFNRMLLDPQCHTGTEWTDAGWQQVCDVMSWNGHEKCSLQDLYEH
FT                   FSVNYIEHRIAQFS"
FT   gene            209533..210630
FT                   /locus_tag="Bcep18194_C6696"
FT   CDS_pept        209533..210630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6696"
FT                   /product="Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6696"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05746"
FT                   /db_xref="GOA:Q39P70"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P70"
FT                   /protein_id="ABB05746.1"
FT                   /translation="MSYITGLGIATAAFPDIASLLDVDFAARAPLAPAEKPGDYVRANL
FT                   PFPLVQRMAREDRSLLNPGSRLALQVAAEAFDAASAGRPYTDEERERFAVFTGVEGEDA
FT                   TMAVLTPLHARHGLDGCGYFGEVKADLNPLDMLRLLTTNALYQISKLFGLRGEGYPLQR
FT                   MSLTSLCALEEAHRQIEGGAIDRAVIAAVGDMTSADNVAAFEKMGLLRTTSHPVGIVPA
FT                   FGAVGAVVERTPRDGCAPCAQVLDVHSLYKPDTSVSSADWSRLFARFPGEAALGVPHVV
FT                   LYQNGEPSLGKAERNAVEQAWPNAVTHAYKPHVGYTGRANNLIDLVLAIADPAIPVGAP
FT                   VLVNGIGVSSGLGAILVRKLSGVGR"
FT   gene            210627..211901
FT                   /locus_tag="Bcep18194_C6697"
FT   CDS_pept        210627..211901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6697"
FT                   /product="Beta-ketoacyl synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6697"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05747"
FT                   /db_xref="GOA:Q39P69"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P69"
FT                   /protein_id="ABB05747.1"
FT                   /translation="MKPRSDAIVISAFGAVTPLGGSYAELHAALREGRSGIRRIEKFDC
FT                   STYTTRHAGVPDEGNERVRWPSTRRIGTEQLYGDLAAARLLAQAPFVVRDYAPERIGCL
FT                   VGVDVPATDVQSALELVDKVNGDKSRDALIRVLVSHMRMSEFVSGDATSVFGAIHRHIP
FT                   FSGCALAHVGLCSASLQAIGMGMLALRQGRVDAAIVGGVSGKVNPLNLARLEALDVIST
FT                   DVNLDPRHRSRPFDVRRSGFVLAEGAVLFLLERESAVRARGDTPLARVAGYGASLAAEH
FT                   IVIPHLQSLEMRLAMRRALDDAGCAPADIDYVNAHGTSTVLNDKHESEAIRAIFPTRPA
FT                   IPVTANKSQHGHLIATAGAMEVLNTAIGLRERFIPATINLDEQAQECPVNVVRAPTPSD
FT                   ARRVLKNSFGMGGLAASLVLEGAAA"
FT   gene            211898..213364
FT                   /locus_tag="Bcep18194_C6698"
FT   CDS_pept        211898..213364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6698"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6698"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05748"
FT                   /db_xref="GOA:Q39P68"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P68"
FT                   /protein_id="ABB05748.1"
FT                   /translation="MKFASLLAREANWQIVLHGARLTAEDLRARLRAARRALGALEPHL
FT                   LGRGCLIAVGFSGFDYFLFTLLASTLGCRIVLCDPKMLSAALRQYRLDALAVVATRSIA
FT                   CDGLPVVVLDPALAEAEASGPDAFAWADAGAPRAQIVFMTSGTTSAPKLVVYDEAQLVE
FT                   NALAVGRYLGVQPGDGVLCMFPTHYMYGFSTMMNGLLAGATVWLERASLTAHEVLGYLG
FT                   SGRIRFVPLIRSIAERVCDLAEVTPGMRFDGIVVLNASDRIYAAQVRRLLALGACVWNN
FT                   FGQTESGPRIFALPLTPDDLPHVDSYCFEGVLAPGRPIDPRIELSIVDAQGRPCAPGEP
FT                   GHLLYRTPYAMHGYLLPDGSVRRFTTLESGDLVFRRDDGVVFWVGRRDETVKCNGRLIN
FT                   VSLLHQHFDAFDDIAKSYFLADPQTGALTVFVVPGLTPAGADVDFKARILSRYRAAFPL
FT                   YPRIADVLFVDDLPVTSTGKISLRLLRESA"
FT   gene            213390..214625
FT                   /locus_tag="Bcep18194_C6699"
FT   CDS_pept        213390..214625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6699"
FT                   /product="Indoleacetate--lysine ligase"
FT                   /EC_number="6.3.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6699"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05749"
FT                   /db_xref="GOA:Q39P67"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P67"
FT                   /protein_id="ABB05749.1"
FT                   /translation="MSDRTTRFDSSAVSEALSYDARYAHVLPTGVASYAAFRTLVAIET
FT                   ADDLKRRVLDHLDHDDLAGATFYTTSGTSGDVKLLLNAPARKRPDTTYGRALANALAGT
FT                   AIAPTDRVANLFTAGGFSTLYDGVNRLLEAIGANVLPIGRLDAYGADLPAMLNLIGRAR
FT                   PNVLVGTPTSVLQCLRLLDAHGVDLDVTKILYTGEAFPERKRAIVRRRWPDAACFGLYG
FT                   ATETGFLGYHTPRCAEGHYHVLDDWFFLEEEDGQLLVTSRANPGLAMLRYRLGDRVRVG
FT                   PSVRCTCGEGGSVVVLQGRADQRFKFAGNLVSTELLAQRLAACVGRPLDCQFRLDADAH
FT                   GRDCLTVVLDLGDDELAPLASRLTDALLEIEDVRECIDKGEGRLDVLGRDALRYSARQK
FT                   LPRLIDERHAHV"
FT   gene            214618..216081
FT                   /locus_tag="Bcep18194_C6700"
FT   CDS_pept        214618..216081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6700"
FT                   /product="putative Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6700"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05750"
FT                   /db_xref="GOA:Q39P66"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P66"
FT                   /protein_id="ABB05750.1"
FT                   /translation="MSDDRATVAPAAPATSATSTAAAALASTRASRADRMRQFVAEVRA
FT                   TWLMLYPMVLSSIFGYCMTLFDYRWIRDLPAEDMALLALVNGSVATFLFLLGKSFEESF
FT                   VAVFAKAPREDQGRLFVQSLVFAGAIGVLVVLVLIGTRAPLMTFISGGQFHGERMFGYY
FT                   ALVIGSFPLTLLSTALSAAMRTYGDTKSPARISIACGVVNNILDPLLVFGLFGQHPSLQ
FT                   LFGLALTSWITKSLYLGWCVRCIRPRLRREQVVLPRPGVEWPTQRRLLRIFLPSAALEA
FT                   LTFLANTAVYSLIARYGVRAIGGYGIGFELMTIGFILIKGLSMVFMIRIGHLVRSRAPS
FT                   RAALQSVMLLGVLFTAAISIAFFLLRSLALRFLASDAGVIAVASALLDYVPLFVFSYLL
FT                   TNLVTGCFQILERPARAMALGLFFSWVVTPGAIYLGVTHHLALTQLFALLAGVSVVRQA
FT                   VYLTIFLRLMRRLGAAPAAPPAGAHAAAG"
FT   gene            216126..216797
FT                   /locus_tag="Bcep18194_C6701"
FT   CDS_pept        216126..216797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6701"
FT                   /product="UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6701"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05751"
FT                   /db_xref="GOA:Q39P65"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P65"
FT                   /protein_id="ABB05751.1"
FT                   /translation="MRTNTPAEVNADTYDHYVDTFTLEWNRNLVQRVEHELAQRRIASG
FT                   RLLDVGTGTARTLIELARVPSLAPLGFVGVDYYDDMVRRAEQNVRAEGLEGRIDIRAGD
FT                   VHALPFDDGTFVAVIGRSVVHHWADPVGAYREIFRTLAPGGFALIHEPCSDPAPEALAF
FT                   FNERRAAAGVHPVHLDGKFTVAESIGHLHEAGIGEHASVSKGSGMLAIGFEVLIAKPAQ
FT                   Q"
FT   gene            216812..217984
FT                   /locus_tag="Bcep18194_C6702"
FT   CDS_pept        216812..217984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6702"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6702"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05752"
FT                   /db_xref="GOA:Q39P64"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P64"
FT                   /protein_id="ABB05752.1"
FT                   /translation="MRTDHDLPAPDAARPRAARDESEIDAVSISPDRLSVRGVDLLQLI
FT                   ESVDFPAAILHVLAGRMPDAGDVRALDRALAARLADDGPTDDGLLVAQLARRQRRPEVF
FT                   LVAAIAAGLAAGPRARPVAWPDALSGIGQGDEVATGLGIVAALPRLLAVWRATDDETPA
FT                   RVRPTDVARGFSASVLDCLFGGESSDAQARLFDVLLVALHGGFGLVAPTIALPRFSAST
FT                   YASIDLNLIAGLTGSGSAHVGACSDATRFLASLVGRPPAEIRDRVAQRVQAGDRIPGFG
FT                   HPLLECDPRPAALERHAVRLGVGGAAFDAYRAVCGAMQDLRGLPPNIDAAAAATLLELG
FT                   VPAVLATPVFLFARMPTMLAHALQKKAHPPFGQTRPVARERLAALPKAWI"
FT   gene            218911..219465
FT                   /locus_tag="Bcep18194_C6703"
FT   CDS_pept        218911..219465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6703"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6703"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05753"
FT                   /db_xref="GOA:Q39P63"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P63"
FT                   /protein_id="ABB05753.1"
FT                   /translation="MTTNEILSGGIGLFHAWERQVLALYMDAFTTGSYAGHYLDEAAER
FT                   GWIYGLFIEHAARCHLWVAGDALAGFLLSAEAGYDRKLPVSLRATLGDGPVMSIAELAV
FT                   APHWRSRGLGEALVRRCIGEAAPGYRDIIVRSNSNALAAHRLYQRLGFEPFGSVRVENE
FT                   MLADGRRGVECVDKQYFRYRV"
FT   gene            complement(219549..220151)
FT                   /locus_tag="Bcep18194_C6704"
FT   CDS_pept        complement(219549..220151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6704"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05754"
FT                   /db_xref="GOA:Q39P62"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P62"
FT                   /protein_id="ABB05754.1"
FT                   /translation="MLTLSPMLKMSFYAALVLLVPGPTNTLLLSAGLKLNLRGACRLVA
FT                   AEASGYVIAITVWGFFLWSLATQYPWIVSCVKLISSLFIFYLAVKMWLKGANFGATDSA
FT                   PLGFRALFLATLMNPKALLFSSAIFPESAFRSLEIFLLSMGAFLITLIPIGLLWSRSGR
FT                   LLIMNRAEGRLASIVLRCSSLVLLTFAATLASSVLNR"
FT   gene            complement(220620..220712)
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C6705"
FT   gene            220994..222607
FT                   /locus_tag="Bcep18194_C6706"
FT   CDS_pept        220994..222607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6706"
FT                   /product="Tryptophan halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6706"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05755"
FT                   /db_xref="GOA:Q39P61"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P61"
FT                   /protein_id="ABB05755.1"
FT                   /translation="MSNPIKNIVIVGGGTAGWMSASYLVRALQQQANITLIESEAIPRI
FT                   GVGEATIPNLQKVFFDFLGIPEREWMPQVNGAFKAAIKFVNWRKAPDRSRDDHFYHLFG
FT                   SVPNCDGVPLTHYWLRKREQGFQQPMEYACYPQPDALDAKLAPCLPDGTRQMPHAWHFD
FT                   AHLVADFLKRWAVERGVKRVVDEVVEVRLNERGFISSLSTKEGRTLEADLFIDCSGMRG
FT                   LLINQALKEPFIDMSDYLLCDSAVASAVPNDDARVGIEPYTSSIAMNSGWTWKIPMLGR
FT                   FGSGYVFSSKFTSRDQATADFLHLWNLSDKQPLNQIKFRVGRNGRAWVNNCVAIGLSSC
FT                   FLEPLESTGIYFIYAALYQLVKHFPDTSFDPRLREAFNAEIVYMFDDCRDFVQAHYFTT
FT                   SREDTPFWRANRHDLRLSDAIKEKVERYKAGLPLTTTSFDDATYYETFDFEFKNFWLNG
FT                   NYYCIFAGLGMLPDRSLPLLRHRPESIDKAEAMFARIRRESERLRTSLPTNYDYLRSLR
FT                   EGAGRSRSQPGQAVAAPEIQ"
FT   gene            222607..223692
FT                   /locus_tag="Bcep18194_C6707"
FT   CDS_pept        222607..223692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6707"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05756"
FT                   /db_xref="GOA:Q39P60"
FT                   /db_xref="InterPro:IPR015029"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P60"
FT                   /protein_id="ABB05756.1"
FT                   /translation="MERALGRVGACAATHAAVAACDPLQARALVLQLPGLNRKKDVPGI
FT                   VGLLRDFLPAHGVPSGWGFVEAAAAMRDIGFFLGSLKRHGHEPVDVVPGLEPVLLDLAR
FT                   VTDLPPRETLLHVTVWNPAAADAQRSYSGLSDEAHLLESVRISMASLEAAIALTVELSD
FT                   VPLRSPAFEEGCVELAVYLQKMVDSIVYAYRFISPQVFYDELRPFYEPIRVGGQSYLGP
FT                   GAVEMPLFVLEHVLWGSQSDHPAYLEFKETYLPYVLPAFRAVYARFAGRPALVDRVLAE
FT                   AQAARVRGEPVGAGLAALELVLEILLHFRAPHLKLAERTYEAGQSGPAIGSGGYAPSML
FT                   GDLLTLTRAVRARLHAALDER"
FT   gene            223765..225465
FT                   /locus_tag="Bcep18194_C6708"
FT   CDS_pept        223765..225465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6708"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6708"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05757"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P59"
FT                   /protein_id="ABB05757.1"
FT                   /translation="MTQKRTANEHDSNHFDVIILGSGMSGTQMGAILAKQKFRVLIVEE
FT                   SSHPRFTIGESSIPETSLMNRIIADRYGIPELDHITSFYATQRYVASSTGIKRNFGFVF
FT                   HKPGQEHDPKEFTQCVIPELPWGPESHYYRQDVDAYLLQAAIKYGCTVRQKTSVTDYHA
FT                   DKDGVAVATAQGERFTGRYMIDCGGPRAPLATKFGLREEPCRFKTHSRSLYTHMLGVKP
FT                   FDDIFKVKGQRWRWHEGTLHHMFEGGWLWVIPFNNHARSTNNLVSVGLQLDPRVHPKTD
FT                   IPAQQEFDEFLARFPSIGAQFRDAVPVRDWVKTDRLQFSSSACVGDRYCLMLHANGFID
FT                   PLFSRGLENTAVTIHALAARLIKALRDDDFSPERFEYIERLQQKLLDHNDDFVSCCYTA
FT                   FSDFRLWDAFHRLWAVGTILGQFRLVQAHARFRASRNERDLDHLDDNAPYLGFLCADME
FT                   GYYQLFNDAKTEVEAVSAGRKPAGEAAARIHVLINEREFAKPMFGFGYCITGARPQLNN
FT                   SKYSLVPAMKLLHWTQTSAPAEVKKYFDYNPMFALLRAYVTTRIGLALK"
FT   gene            225489..226610
FT                   /locus_tag="Bcep18194_C6709"
FT   CDS_pept        225489..226610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6709"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6709"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05758"
FT                   /db_xref="GOA:Q39P58"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR037338"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P58"
FT                   /protein_id="ABB05758.1"
FT                   /translation="MDDVQFKLQQADAGAHPAGAYDATTRLAASWYVAMRSDDLKDKPT
FT                   ALTLFGRPCVAWRGATGRAVVMDRHCSHLGANLADGQVKDGCIQCPFHHWQYDEQGQCV
FT                   HIPGHSTEVRRLEPVPRGARQPTLVTAERYGYVWVWYGSPQPLHPLPEIAAADVDNGDF
FT                   MHLHFAFETTTAVLRIVENFYDAQHAHPVHALPISAFELKLFDDWRPWPEVESLARAGA
FT                   WFGAGIDFTVNRYFGPLGMLSRALGLNMSQMNLHFDGYPGGCVMTVALDGEAKYKLLQC
FT                   VTPVSDGKNVMHMLISIKKVGGPLRRATDFVLFGLQTRQAAGYDVKIWNGMKPDGGGAY
FT                   SKYDKLVLKYRAFYRGWVERVVAGERQGVSRRS"
FT   gene            complement(226659..228674)
FT                   /locus_tag="Bcep18194_C6710"
FT   CDS_pept        complement(226659..228674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6710"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6710"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05759"
FT                   /db_xref="GOA:Q39P57"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P57"
FT                   /protein_id="ABB05759.1"
FT                   /translation="MQRITRSAIRRSAWTASGTALTLGLFACGGVDSSSTPVTQQDFGY
FT                   TTLNLITKDGLKFKDMDKSGQLEPYEDWRLSADVRARDLVGRLTLAEKAGLMMHGTAPV
FT                   LNDTTGAGTGSAYDLAALKTLINQRGVNTYITRMSADAHTMADQTNQIQTLAEQSRLGI
FT                   PVSISSDPRNHFQYTLGASAGSSGFSQWPETLGFAAIGDAALTRKFGDIARQEYRAVGM
FT                   TEALSPQADLATEPRWSRINGTFGEDADLARTQVQAYIEGFQGGSNGIQANSVIAVVKH
FT                   WAGYGAQKLGFDSHNYYGRYATYPGNNFAYHLKPFEGAFAANVGSVMPTYSEPDMTVTV
FT                   DGITLEPVGGAYDKALLTDLLRGKYGFKGVIVSDWLIADDCDANCINGVSSGSPSFVGL
FT                   GMPWGMEGATRVQRFVRAVNAGIDQFGGDDDPSDLIDAVNRGQLSEDRLSESAYRVLLQ
FT                   KFQQGLFDHPYVDADAAGKIVGNADFQAQALDAQRRSMVLLQNNGKLLPMTASGKKVWL
FT                   YGIDPAVARQYGYQVVDTPQAADVAILRVSTPYQTLHPNYMFGSMQHEGSLAFVDGSAD
FT                   YEAIKQAALAPKSIVSVYMDRPAILTNVQDKATAILANFGVTDAALFDVLTGKGQPQGK
FT                   LPFELPSSMAEVAAQREDVPHDTAHPLYPFGYGLTY"
FT   gene            complement(229041..229955)
FT                   /locus_tag="Bcep18194_C6711"
FT   CDS_pept        complement(229041..229955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6711"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6711"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05760"
FT                   /db_xref="GOA:Q39P56"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P56"
FT                   /protein_id="ABB05760.1"
FT                   /translation="MKRLPSLNALQVFDIVARHGSFTRAAEHLCLTQGAVSRQILALES
FT                   FYQFALFKRTPKGLTLTAEGELLLPTVRESFARIEEVSMRLSRRRTELALKVPTCMMQW
FT                   MLPRIMRFQAEHPELQVQITTTWDHQVDFRMEPFDAAVIYAAGAGPDMHAIPLFEERLT
FT                   PVCAPGLPDRQPLASLDDLAGHTLLHPTRDHRDWKRWLDHAGAPHVDSTRGLSFETLDL
FT                   ATHAAIDGYGVAIGDRTLVDESVAAHRLVMPFDLSLPTGMGYFFVYPDGAEQQQKIQLF
FT                   GGWIADERKSAVGVAGGAGGAPA"
FT   gene            complement(230005..230730)
FT                   /locus_tag="Bcep18194_C6712"
FT   CDS_pept        complement(230005..230730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6712"
FT                   /product="L-glutamate ABC transporter ATP-binding protein /
FT                   L-aspartate ABC transporter ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6712"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05761"
FT                   /db_xref="GOA:Q39P55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P55"
FT                   /protein_id="ABB05761.1"
FT                   /translation="MISISNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPFQQGEILVNDQSVGDRKTNLSKLRSKVGMVFQHFELFPHLSITENLTLAQVK
FT                   VLGRGKDEANEKGLKLLDRVGLKAHAHKFPGQLSGGQQQRVAIARALSMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELAQEGMTMMVVTHEMGFAKKVAHRVIFMDKGAIVEDDRKDD
FT                   FFSNPKSERAKDFLAKILH"
FT   gene            complement(230771..231427)
FT                   /locus_tag="Bcep18194_C6713"
FT   CDS_pept        complement(230771..231427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6713"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6713"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05762"
FT                   /db_xref="GOA:Q39P54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P54"
FT                   /protein_id="ABB05762.1"
FT                   /translation="MIEFTFQDIAWNLLLAARWTVLLSLITFVGGSVAGFALLAMRISA
FT                   SAALRRFVILYVELFQGTPLLMQLFLGFFGLPLIGIDVTPWVAASVVLTLNASAYLTDI
FT                   WRGCVDAVPRGQWNAAASLGMTWTQQLRYVVWPQAWKIALPPTVGFLVQAVKSTALTSI
FT                   IGLTELTKTGNIITNAVFKPFPIYAMVALLYFAMCFPLTWYARVLERRYRVAKAR"
FT   gene            complement(231424..232188)
FT                   /locus_tag="Bcep18194_C6714"
FT   CDS_pept        complement(231424..232188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6714"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6714"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05763"
FT                   /db_xref="GOA:Q39P53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P53"
FT                   /protein_id="ABB05763.1"
FT                   /translation="MTYVFDFSDFGLYAGMLARGIGVTLGLTAASTVLGGLIGTTGAWV
FT                   ALAGPRWARALVAAYVELIRNTPFLVQLFFIFFGLPGIGVHIDEAQAAVLAMTVNLGAY
FT                   AVEILRAGIESVPHGQVQAARALGLHGRQVFGHVVLPQALANVYPALLGQVLIVMLGSA
FT                   VVSQISVPDLTYAANYIQSRNFRAFEIYIVVTAIYLLLSIALRMLLNRVGRRLFSGRTQ
FT                   RGAAAAPQRARFARFTWRARSPETRLPTERAR"
FT   gene            complement(232232..233056)
FT                   /locus_tag="Bcep18194_C6715"
FT   CDS_pept        complement(232232..233056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6715"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6715"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05764"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P52"
FT                   /protein_id="ABB05764.1"
FT                   /translation="MNAMSQATRRVQRLLARTVLLCACAGTAGLAAFAPLAHADALDTI
FT                   AKSGVVRIGVFEDYPPFGSIGPDMKPLGYDIDMANLIGKALNAKVELVQVTGDNRMAYL
FT                   ADRKTDMLLSVGQTPERAKVIDFSNAYAPYYLAVFGPKSLAVKGNADLAGKSVAVARGT
FT                   LEDLSVSKVAPPSATIKRFDDPNGAIAAFLSGQAQLLVVGNDVGATIIARHPSIDPEQK
FT                   FSLFSSPDHVGLNKNEPRLMQKVNDAIAGARKSGTLNALSQKWLHAALPADL"
FT   gene            complement(233108..234178)
FT                   /locus_tag="Bcep18194_C6716"
FT   CDS_pept        complement(233108..234178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6716"
FT                   /product="ABC spermidine/putrescine transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6716"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05765"
FT                   /db_xref="GOA:Q39P51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P51"
FT                   /protein_id="ABB05765.1"
FT                   /translation="MTQLILQNVTKRFHQAYAVDHVDLSVPDGKLVCFLGPSGCGKTTL
FT                   MRIIAGLETPTSGTLTFAGRDLTRVPANQRDFGMVFQSLALFPHMTVAQNIAYPLRLRK
FT                   TDKAAQARRVAELLELIQLPHMADRLVTQLSGGQRQRVAIARAIASSPRLLLLDEPLSA
FT                   LDAKLREAMQVEIRLLQQRLGITTIMVTHDQREAMTMADEIVVMEKGRIQQVGRPLDIY
FT                   RDPVNEFVADFIGLGNILPVACDGDDAIVLPGGQRLAIRRAPDAPRATDGVRLLIRPED
FT                   VCVRPGQPASAPNTLAGTITFVRDVGASIEATIDCRGFTLTAATTPRETPDLHVGMPVL
FT                   AELPAHACKLIAARGA"
FT   gene            complement(234219..235061)
FT                   /locus_tag="Bcep18194_C6717"
FT   CDS_pept        complement(234219..235061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6717"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6717"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05766"
FT                   /db_xref="GOA:Q39P50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P50"
FT                   /protein_id="ABB05766.1"
FT                   /translation="MNALLLRAPMPGRLGRVTGGLATLVLLLASLPILTMITMSFGASG
FT                   TLEFPPREFSLHWYRAAWQTFVSSDAGSAQSMGAALTTSLVVAVATMLIATAVSVPAAY
FT                   ALSRYRFRGKALVEQLVALPIVYPLVMLGLALLIVFNALPVELGIARLVVAHVILTLPF
FT                   TVKNCAASVASIGPDFEEAACLMGASPRRALVDVVLPLMRPGILAGMLFAFIVSFNEFT
FT                   VTFFLYSIDTMTLPVWLYSRTVSSLDPTVFCFAVFTVAIDFALIWMLEKLVGDKGVAL"
FT   gene            complement(235058..235981)
FT                   /locus_tag="Bcep18194_C6718"
FT   CDS_pept        complement(235058..235981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6718"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6718"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05767"
FT                   /db_xref="GOA:Q39P49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P49"
FT                   /protein_id="ABB05767.1"
FT                   /translation="MASLSSPHDAGPAGVATAGAGADAPALPGVPPWLLLAPILAFLAV
FT                   LAAATVTVLRMSVGVSGDEWRTFTLQNYLDLADPYFTKSLWLTLRLAFESMVCAVLLAI
FT                   PVALAMARTESRLARRLLLAGVLLPLLVNLLLQGYGWLVMLGPAGLLNRALLATGVIGR
FT                   PLQLLYREHGVLLGLIQTAFPLAVLPLSSALRAVSRAYDEAAATLGASRWQTLRHVTLP
FT                   LAMPGLVSGALLVFAYNASAFAVPLLLGGRRVPMLAVLVHDQVAPLLNWPAASASGVVL
FT                   MGATLVVMAVSQRLVRALQRADEVNR"
FT   gene            complement(235986..237083)
FT                   /locus_tag="Bcep18194_C6719"
FT   CDS_pept        complement(235986..237083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6719"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6719"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05768"
FT                   /db_xref="GOA:Q39P48"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P48"
FT                   /protein_id="ABB05768.1"
FT                   /translation="MQHFKAGRRQVIKTLGTALAASALPMPFISTAKAQTSSFAGKTLR
FT                   LLTWSDDTGAAALRNIAESFSKQTGARVIADRADGTSGMVAKVKAAGERPTYDVITLAG
FT                   VGASGLADAGLLAKPDLNRLPNLKDVAPQYRTGANGFGIGYLLWSDGLIYNTATVKSAP
FT                   SSYEALWDPKYAGRLFLPPPEWAEAVDLAIIAAKLAGGSQQNIDPGFRKLAQLKDRVMT
FT                   LGENPNQVADLFRTGSLDIGGIYSPAFFPDQIRKPDYKMGVTYGMKEGFATQLMFTVIP
FT                   KAHPGDLDLIHAFINHSLDAGVQGRMAADVLNGPVNGKAVIPAASRAFVPSPQQIAEKA
FT                   VLHDDKALAAVQPAWIKRYTGLFSA"
FT   gene            complement(237233..238705)
FT                   /locus_tag="Bcep18194_C6720"
FT   CDS_pept        complement(237233..238705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6720"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6720"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05769"
FT                   /db_xref="GOA:Q39P47"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P47"
FT                   /protein_id="ABB05769.1"
FT                   /translation="MNTTPDLAFDPPLHTRHFIDGAWRASVDGATLPVVDPSTEAVLAD
FT                   VSAGSEADVEHAVQAASRAYPGWKRTTGAMRAALLRAIARGVDARRTRLATLQSLNNGK
FT                   PLAEAEIDVADVIATFDYYAGLAERLDTDGETEIALPDADHRAWIRREPAGVAALIVPW
FT                   NFPMVTTAWKLAPALAAGCTVVLKPSEITPLPELELAAIAAEAGLPPGVLNVVTGTGHD
FT                   VGARLCAHPRVAKVSFTGSTAVGAQVMKTAADTIKGVGLELGGKSSIVVFDDADLDHAV
FT                   ELVTGGGLFNAGQMCSATSRVLVAASLADDLIARLAQRIDATVVGPPFAPGVQMGPLTN
FT                   RAQYERVQRHIAQGRADGARLVTGGNALDGPGYFIRPALFADVPADSSLWCEEIFGPVL
FT                   CVRAFDTEDEAIAAANDTEYGLVATVVTRDTARARRVADALEAGVVWINTPQLIYPQTS
FT                   WGGYKRSSIGRELGPFGLAAFQEIKQVMMPAG"
FT   gene            complement(238702..240396)
FT                   /locus_tag="Bcep18194_C6721"
FT   CDS_pept        complement(238702..240396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6721"
FT                   /product="Acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6721"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05770"
FT                   /db_xref="GOA:Q39P46"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P46"
FT                   /protein_id="ABB05770.1"
FT                   /translation="MNHPATVSSIAGARKATAAPCHARPRTCGEALVDLLERHGVECVF
FT                   GIPGVHTVELYRGLAASSIRHVTPRHEQGAGFMADGYARVTGRPGVCFIITGPGMTNIA
FT                   TAMAQAYADSIPMLVISSVNARRELGSGDGRLHELPSQRDVFAGLTAFSHTLLDAADLP
FT                   QVLARAFAVFASARPRPVHIEIPLDVIVMPAPALSDAPPALPARPAPDANALAAAADLL
FT                   AHARRPLILAGGGAIHAAAELRELAERLHAPVALTINAKGLLPAGHPLLIGSTQSLPAT
FT                   RAAIRDADVVLAVGTELGETDYDVTFDGGFAIDGRLIRIDIDAQQLMRNARAEIAIAGD
FT                   SQLALGALSTRLHETPAPTPDAGWGAPRVAAVRAAIAATHDSAAQSQALLIDTIVATLP
FT                   GAIIAGDSTSPVYVGNFTHDAPAPRSWFNSSTGYGTLGYGLPAAIGAKLAAPARPVVCL
FT                   IGDGGLQFTLPELASAVEARLPVIVIVWNNHGYGEIRKYMVARDITPVGVDPYTPDFQV
FT                   LARGFGCAAHTAATPGALAAALRDAAARAIPTVIEIDEATWFGQVQR"
FT   gene            complement(240495..240782)
FT                   /locus_tag="Bcep18194_C6722"
FT   CDS_pept        complement(240495..240782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6722"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05771"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P45"
FT                   /protein_id="ABB05771.1"
FT                   /translation="MRRLRLAPVHPPARHSCAIHAPAARYAPAAQPPALIGGNLVDSLP
FT                   FPARHVDAVMQRRDVRATRVATRASVKIRSPPPAPRIDAAMHGTHAAHEN"
FT   gene            240939..244385
FT                   /locus_tag="Bcep18194_C6723"
FT   CDS_pept        240939..244385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6723"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6723"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05772"
FT                   /db_xref="GOA:Q39P44"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P44"
FT                   /protein_id="ABB05772.1"
FT                   /translation="MRCTLCGSENPPGARFCQECQAVLSRTCPHCGHDVAPVARFCSNC
FT                   GTPLAAPTAASPPSRPSGREPPPTPVHYTPDHLAERIRAEHAAMAARGEPAGERKTVTA
FT                   LFADMAGSTALIHDLDPEVAHRLIVPVVELMMEAVHYYEGYVAKSLGDGILALFGAPIA
FT                   HEDHAQRALFAALRMQQAMRQHGDRIRLQEGIPLQIRVGVHTGEVVVRSIRTDDLHTEY
FT                   DPLGHTIHIASRIEGIAAPTSILVSESTHKLAEGYFEFKALGATQLKGIPAPLRVYEVL
FT                   GLGALRTRLQLAAHRGLARFVGRETEMEHLNRARETVSAGQGRVVGVAGDAGVGKSRLF
FT                   HEFKERSRRGALVLETFSVSHGKAYSNLPLIELLKNYFQITTQDDERRCREKVIGKALT
FT                   LERSFEDLVPYVLYLLGIGEGGPVLVEMDPQIRRERTFDAIRQLLARESRNQPVHLLFE
FT                   DLQWLDRETEAFLTYLIDHVPDARILLLVNYRPEYQPAWVRAAHGSTLRLEPLGPADAQ
FT                   GLLAALLGEDRTLVPLKQLILEKTEGNPFFMEEVVQTLVEERSLLGEAGRYRIVETPAT
FT                   LHIPTTVQGVLAARIDRLPIDEKELLQALAVIGHEFPFSLIRRICGEETARDDELRRLL
FT                   AHLEAAEFIYECPAFPEVNYSFKHALTQEVAGRSLLTERRTTLHERTAHAIEVLFPTRI
FT                   ADYCSELAHHYSQSGNVPKAVEYLHRAAQQALRHAAHHDAMNHLGAALALLKGLPDTPM
FT                   RAHSELALLLSLGPVLMDVRGYGANEVGEAYRRALELCERTGEASQRFATQLGLRIHHG
FT                   VRGEHALGLELGMQMLRTAREANDPGLLIEAHSALGSCLFFLGDFGATRTHAEQALALY
FT                   DPDQHQAHAFAHGVDPGIRALCFLMLTLWIQGYPDQALTRSVEALALAQKLAHGPSLAF
FT                   SLTYTAHLHQLRREPMLAAERAEAVIAVSTEHGLPYWLAWGTLLRGWATSVQGSLQDGI
FT                   AQMRLGLDAQRAAGGEDQRPYALALLADSYWRADDEKAARGMLDEAMAIVEKSGEHCYE
FT                   AELYRLTGICLAGTVTTAPERDDEAIDCFHRAIARARRQGARALELRAASDLARLLQRQ
FT                   GRADEARQVLSDVYACFTEGFDTSDLQEAKALLDALGAYAG"
FT   gene            244462..245511
FT                   /locus_tag="Bcep18194_C6724"
FT   CDS_pept        244462..245511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6724"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6724"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05773"
FT                   /db_xref="GOA:Q39P43"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P43"
FT                   /protein_id="ABB05773.1"
FT                   /translation="MTTTHARRRHDGPRKPITLALQGGGMHGAFTWGVLDRLLEDGRLD
FT                   IEGVCATSAGAMNAAVLACGLLKGGEDGAREALHDFWEAVARSAERYNPLRWVPWLKGT
FT                   HSFGLDHSPLYAFTDMMLRVFSPYQFNPNNLNPLREVLESQVDFDALRKHCPIRLYLCA
FT                   TNVETGKIRIFTGEDVCADAVLASACVPTLFQAVAIDGEYYWDGGYMGNPAIYPLIYNC
FT                   ATRDVVIVHINPLVRRGVPITAAEILNRISEISFNSSLMREMRAIAFVTDLIQQGTIKR
FT                   GEMKEMLIHSIRADDALSALSVSSKYNADWGFLSELHDHGRREADAWLAHHYGNIGQRS
FT                   SIDIRREFL"
FT   gene            245512..246189
FT                   /locus_tag="Bcep18194_C6725"
FT   CDS_pept        245512..246189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6725"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05774"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P42"
FT                   /protein_id="ABB05774.1"
FT                   /translation="MHGGNVGVGRACAAATGQGANVNQTQERFVALWSGSGGIHAEEVY
FT                   RLLAEGYAEPMRHYHTLAHVKRCLRHVDLARGAMPDPDAVELALWFHDVIYVPGAKNNE
FT                   QRSADWFRHLAAGRIGACDRICAMILATTHVGIAAELDTRFVCDIDLAVLGASRSRFRE
FT                   DGRLLRAERPDLDDRAYDLHERSILRWLLVRPRIYLTDFFYTRCESSARRNLSWRLALP
FT                   IQE"
FT   gene            246572..247282
FT                   /locus_tag="Bcep18194_C6726"
FT   CDS_pept        246572..247282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6726"
FT                   /product="Chitin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6726"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05775"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P41"
FT                   /protein_id="ABB05775.1"
FT                   /translation="MNKIIRRVAASVMPRSLAGVALLVAAAGAHAHGRLTEPPSRIVLC
FT                   TQGQNPDCPVDAWHANAMENGKFFPATQSGLSDPFAPADAKNAAPPIDGEIAGASTNGP
FT                   LPVLNEQSPGRWQKIPLRPGALQNFKWEFSAVHKTRRWNYFITRADWNPSEKLTRAQFE
FT                   PTPFCTIQNPGQPYWDPNANLVPQQPTIHQCRLPMRSGYHVILAVWEVADTAMAFYQVV
FT                   DATFTHGDTTRSPF"
FT   gene            complement(247380..248783)
FT                   /locus_tag="Bcep18194_C6727"
FT   CDS_pept        complement(247380..248783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6727"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6727"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05776"
FT                   /db_xref="GOA:Q39P40"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P40"
FT                   /protein_id="ABB05776.1"
FT                   /translation="MTVNAATQASTRTAQVVTRVYARLLLVGFALVPAYLIAYLYFFQD
FT                   PSLKFENHAFHELAIAAATLEGAFVTYVCWRCYRLSGEPLLRWLTLGFLGFSLVYALHG
FT                   AFTGMAHHNIWLFLLYGPASRLTMSILIFVGQLTYSRKADSAATRADPRIWLPWLALFG
FT                   LVDVAVAVIAFSPMAGNLWVRLSMEGGALLLSVVNVVALVVRRIRSPLMTIYGISVTSF
FT                   ALSSLAFILGRPWNHMWWLAHAIFAAGFFLLSFGVVQAFQTTRSFSKIYSQAELFARLR
FT                   EAMARTERALQALQRTNEKLEHLAATDPLTGATNRRQFIESVEAEIHRAKRNGAPFSLL
FT                   ALDLDHFKAINDSYGHQAGDQVLQRFVDKCVDAIRPYDGVARVGGEEFMVLLPQAALDT
FT                   AQSIGERIRAAIAGAPFEAGIGEPIKVTVSVGASEFGRDGETIDAILRKADERLYRAKH
FT                   LGRNQVVAG"
FT   gene            249595..250692
FT                   /locus_tag="Bcep18194_C6728"
FT   CDS_pept        249595..250692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6728"
FT                   /product="chitinase family 18"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6728"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05777"
FT                   /db_xref="GOA:Q39P39"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P39"
FT                   /protein_id="ABB05777.1"
FT                   /translation="MKSNQTGFMKRSTLRGALALLLAGSFFGTGSGAAAAGGTSTGTAP
FT                   AFVYSPYKDATISMNWNTNVISTNVTGQLSPVLSVLPTGVRTMTLAFATGECGSENWAG
FT                   VDGGAMAAANVPLFTAANVNYVISTGGAAGMFTCGTDAGMTAFINRYASSNLIGIDFDI
FT                   EGGQTQQVINDLVQRVAVAQQNYPGLRFSFTLATLAPSQQGATTASSWGPSAPDSFNVY
FT                   GDWVMQAIQAYGLKNYTIDLMTMDYGSASAGNCVVASGTCQMGQSAIQAAMNLHDHWGV
FT                   PYSQIELTPMIGGNDVAGETFTPADVDTVAQFVKQNGLVGVHFWSFDRDVDCPPGAASS
FT                   TCNSIGGVGTLGYTNRFANDLAPGQ"
FT   gene            complement(250925..251926)
FT                   /locus_tag="Bcep18194_C6729"
FT   CDS_pept        complement(250925..251926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6729"
FT                   /product="Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6729"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05778"
FT                   /db_xref="GOA:Q39P38"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P38"
FT                   /protein_id="ABB05778.1"
FT                   /translation="MTKDEWRAVKATLPNGPTGNVTLALWLADIALLAAAWMLWLAGGL
FT                   GRPAALVLAMLALIHLYLIMHEALHNAASRSHGCNEAIGHLCGWIIGLPYLPRRRTHLG
FT                   HHAWTAHPSRDPENRKMIQKFSVMTERGARTLEFIWRHWIPMMAFNHFLSHWITPFLQR
FT                   DTPANRAKSNTEIAFSAVYVAGYAAVGALAYRAGVLGSLIAFSTILWIVLLMAVELLNL
FT                   PHHAEIPLLADDAARPPLWEQDVVSHSCANVPVWSRWVILNFNLHVAHHAYPWLPWYDL
FT                   PRAQRHLDAVSAAEVPRQTHEWAFAVTKRRRPLLELMGHFFDKRGASSGGGR"
FT   gene            complement(251963..253012)
FT                   /locus_tag="Bcep18194_C6730"
FT   CDS_pept        complement(251963..253012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6730"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05779"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P37"
FT                   /protein_id="ABB05779.1"
FT                   /translation="MNSIGSNMAGRNSVKPNDSGHRQLRIRRGTVSDTSRICALFEREY
FT                   GDSSHPCLDAGYVRSAVSNKSELWFVAEEETQAAIGCMSVSYNAQNRSWEYGRAMISRH
FT                   HRHLGVLSALMQSAIDTMPAADHDLAFAIARTDIALRALQRHVDGVVVGHDGSPDSAHG
FT                   VREHHVIAIEKFRSPRFRHGLPRSPIFRESEVLRSAIFEPLGLAGTPEPYPDTCFWGHG
FT                   DDCSDGFTFRADERADAIYLCQHVGGPFMTERDVAADLLRFLKRRSTATYVGAIVLADK
FT                   LTLVKAMLDAGFRITAYLPAWHWSRGARYDCLLLARRDDGFASKNGLDEHIDMLDAAYR
FT                   EIGQRILSA"
FT   gene            253696..254577
FT                   /locus_tag="Bcep18194_C6731"
FT   CDS_pept        253696..254577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6731"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6731"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05780"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P36"
FT                   /protein_id="ABB05780.1"
FT                   /translation="MSARSFASFVLMLLLAACGGDSDSSVPGSAFAAASARAAQAAAWK
FT                   PLVPGTSWQWQIDGNRINETVLDGVNNPRKMFDVDMELTDAGTIRRLKAKGIYVVCYME
FT                   VGGREDTRGDAGKFPDSVLGNPVEGYEDHERWLDIRQTAILMPLMLARLDQAKQKGCDG
FT                   IEPDLDDSYRQETGFPLTRDDQLRYNTALIAAAHDRGMSMGLKNGSGIAAAMAKVADWA
FT                   LNEQCNRFHECGDYASFIALNKAVFNVEYTRPDGMKLADFCPADNQANFDGILKLSSDT
FT                   LSALPRAACRFE"
FT   gene            254666..254956
FT                   /locus_tag="Bcep18194_C6732"
FT   CDS_pept        254666..254956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6732"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05781"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P35"
FT                   /protein_id="ABB05781.1"
FT                   /translation="MSRGSRGTGRTRRRFLSGEAAAISRARTRAMFCVNVDGLASLSED
FT                   VCRIESCLAERDRFDSEVMTTLASRRARTDRAEPADARVARSRRHDVTTHG"
FT   gene            255151..255723
FT                   /locus_tag="Bcep18194_C6733"
FT   CDS_pept        255151..255723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6733"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05782"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P34"
FT                   /protein_id="ABB05782.1"
FT                   /translation="MTAPIAKKIMIIRHAEKPDDNGKPYGVNANGEQDKESLIPLGWQR
FT                   AGALVALFDPARGPLQSAVLAKPGVLFAAGVAPHAKSRRPTETVTPLSQRIPLKLDTTY
FT                   TKGQEADVATAAQRSQGVVLICWQHEDIPAIAAHLPLSNGPVPSKWPGERFDIVWVFDL
FT                   QPGTGRYAFSQVPQQLLAGDLPSVIAS"
FT   gene            complement(255887..257071)
FT                   /locus_tag="Bcep18194_C6734"
FT   CDS_pept        complement(255887..257071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6734"
FT                   /product="outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6734"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05783"
FT                   /db_xref="GOA:Q39P33"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P33"
FT                   /protein_id="ABB05783.1"
FT                   /translation="MKNSTMKKFALSALSLSLLGVAGVAHAQSNVALYGVIDTSITYVH
FT                   GNSGTGNNLWQMGSGNLSGSRWGMKGSEDLGGGLKTVFQLESGFNSGTGRLGQGGRMFG
FT                   RQAFVGLQSSQYGTVTLGRQYDPIVDLVQGVTGDNYFGGIFATPGDVDNNDNSLRVSNT
FT                   VKYTSPVLSGLQVEAMYGFGGVAGSTGSGLTYAIAAAYNNGPLGIAGGYFYTNNVNGVA
FT                   RATGWSGSSDAIFDGPINSGYLSAKSIGIAQVAGQYAIGPVTLGLGYSNAQYRRDGDSL
FT                   AGFANTQKYNTGRAFVTYQASAPLLLGIGYAYTKASGNVDAKYHQVSVGADYSLSKRTD
FT                   LYLIGAYQHASGQQQVVNASGQLVTQDAQASIGSYGYAGTKSQEIVALGLRHKF"
FT   gene            257681..258844
FT                   /locus_tag="Bcep18194_C6735"
FT   CDS_pept        257681..258844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6735"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6735"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05784"
FT                   /db_xref="GOA:Q39P32"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017741"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P32"
FT                   /protein_id="ABB05784.1"
FT                   /translation="MSSRQKESAIVNAIAAADSYDVVVVGAGIVGLAHAYTAALKGLRV
FT                   CVIERDAACVGASIRNFGFVTVTGQHAEHSWRRARASREVWADVAPQAGIDVLHKGLHL
FT                   IARRPEAMHLIDAFMQTGMADGCRVLTPGEAAAVAPELRLDGAQGVLHSPHELRIEPRT
FT                   AIPQLAAWLAERFDVRFRYGEMVHEVRTPTVRTSRGVVHAERVIVCGNADSRHLYGDWF
FT                   ARHKVRLCQLQMLRVRPRRPLALHAAVMSDLSLLRYSGFAALPAADALRTRLKAEEPVC
FT                   LGYGIHLIAVQSADGSLVVGDSHEYGAAPLPFATQEIDAQIVRLLHETLEMPELDIVER
FT                   WTGSYPSAADADCVIEVPDDATRVVVVTSGAGMSTGFGIAQDVFAAW"
FT   gene            258857..259597
FT                   /locus_tag="Bcep18194_C6736"
FT   CDS_pept        258857..259597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6736"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6736"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05785"
FT                   /db_xref="GOA:Q39P31"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P31"
FT                   /protein_id="ABB05785.1"
FT                   /translation="MSSAHQKDSGGQWAATRSDRRDAKDSRSPSIECAWHSDDSWSEDG
FT                   TLRKITVTRCQCTACARTVWTTHRPADELPGLDRRSQIDTGFDAEPLEQVQQILGGDVA
FT                   RCTFRIRASAETGDGRMKDRQPGLQFIAWIALRRGVDRPLGLAHEAAGRLAAGDLTRQL
FT                   AVQRSDVIGATLDSLNGINSGLTKLFAGVHVATGTIHLAAGEVAAGDLDLSRRTEEQAA
FT                   SLQQTAASMTELAQTVRQNAERAR"
FT   gene            complement(259973..260311)
FT                   /locus_tag="Bcep18194_C6737"
FT   CDS_pept        complement(259973..260311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6737"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05786"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P30"
FT                   /protein_id="ABB05786.1"
FT                   /translation="MPASHDDTRDADRSGGVCARHRRITRPARPNESTIRSTAAAPGRA
FT                   GASVQYGALLADRRHDANHDVVDQRDVEHRAITRGRPHLRGELQRGDFESRAVGAPPAT
FT                   WRPDVVVD"
FT   gene            260368..261156
FT                   /locus_tag="Bcep18194_C6738"
FT   CDS_pept        260368..261156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6738"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6738"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05787"
FT                   /db_xref="GOA:Q39P29"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P29"
FT                   /protein_id="ABB05787.1"
FT                   /translation="MQQASSEPLRYRVEQQVARIHFNRPDALNALDVPTARGFAQACRA
FT                   AAGDPTVRAVVISGEGRAFSVGGDLACMREDPVDGAALLIDPMHEGIGLLAEMDAPVVA
FT                   SLAGLVAGGGLGGALAADLAIAGAGARFSFAYTQVGVSPDCSTSWQLPRVVGLRHAMEI
FT                   ALLGDRLDAEAALRLGLVNRVVPDDALEQEVDALAQRLAAGPTRAYGETRRLLRASFDR
FT                   PLDVQLDAERKAFLRCARTEDFTEGMSAFFAKRAPWYCGR"
FT   gene            261263..262861
FT                   /locus_tag="Bcep18194_C6739"
FT   CDS_pept        261263..262861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6739"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6739"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05788"
FT                   /db_xref="GOA:Q39P28"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P28"
FT                   /protein_id="ABB05788.1"
FT                   /translation="MIVRSEAPCKTVPASPFDAGACVPNSLEHWAADRPDDIAIVDGDT
FT                   TLTFRAWNDAADRAARGLLDLGAQPGDIIAIRSQIRHEWQIVHAAAAKLGCSVLPFNWR
FT                   LTTVETRFVLEDSRATFLVFDDDDPAVCLAASEGLPLKARISLGAGQAPDVVRFANLID
FT                   TPAPTHLFSTGRPPLIIYTSGTTGRPKGVAMIRAEVTPEMLEYVQSIEAVDPQRAGAVT
FT                   LLTLPMHHGAGPNLCWNALRAGNPIVMMRRFEPEAALAVIERWRVNHWTVVPTMLKRVA
FT                   SLAPDVLARYDISSIRSIRVGAAPVPSTVREWTIGHFGHVLHEGYGATEVGMIAHLRPE
FT                   DMQRKPGSSGLPHRHVHIRIKDESGHALPAGQVGAVWVKSPVVIDRYLNGPMLGRDVLD
FT                   SDSYFAVGDAGWLDEDGFIYLSDRIKDMIISGGVNIYPAEIEAAMITHPAVQDVAVIGI
FT                   PDDEFGEAVKAFVELRPGMSLDADTLQAFIQPLLASYKRPRTIEFVAELPRSTMGKVLK
FT                   RELRNPFWKNQERSV"
FT   gene            262858..263658
FT                   /locus_tag="Bcep18194_C6740"
FT   CDS_pept        262858..263658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6740"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6740"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05789"
FT                   /db_xref="GOA:Q39P27"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P27"
FT                   /protein_id="ABB05789.1"
FT                   /translation="MNQEQTLFDLEGRVALVTGAGQGVGKGIAQMLAAFGASVVVNDYF
FT                   VERAQDVAGEIEAAGGKAIAVQADVTDYAGVERLFDTANRHLGGVDILVNNAGNSGAQP
FT                   DRRDSRKPFWDTEPADWQRFLGVNLDGVMNCCRHALPGMVERQRGRLITIISDAGRCGE
FT                   GHGLEAYSAAKAGAAGLTRGIARSAGRYGITANNIAISATETPAITAALDNAEFMKKVL
FT                   ASYVIRRVGQPTDIAAMALFLASDASSWITGQTYPVNGGFSFSM"
FT   gene            263668..264435
FT                   /locus_tag="Bcep18194_C6741"
FT   CDS_pept        263668..264435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6741"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6741"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05790"
FT                   /db_xref="GOA:Q39P26"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P26"
FT                   /protein_id="ABB05790.1"
FT                   /translation="MNEPLVLTERRGPILIVTINRPQAKNACDAATARAMNDAADLLDA
FT                   DDSLFVGIVTGAGGTFSAGADLRAVARGEAASTPERGGFGIFRRPPSKPVIAAVEGVAV
FT                   GGGMELCMACDLVVAASDARFGLPEVRHNVLAIGGGLFRTVRRIPYNIAMEFLLTGEMQ
FT                   AADTMQRWGFVNRITEPGAALAGAIELAERMLVNGPTALAATKQAVRASIDWREDDAWT
FT                   LQMPIANRALESEDRKEGVQAFLEKRKPVWKGR"
FT   gene            264438..265418
FT                   /locus_tag="Bcep18194_C6742"
FT   CDS_pept        264438..265418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6742"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6742"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05791"
FT                   /db_xref="GOA:Q39P25"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P25"
FT                   /protein_id="ABB05791.1"
FT                   /translation="MRGLPSRITQRLRLPLIAAPMLRVSGPDLVITACLNGVVGAFPTA
FT                   NARNLDELDAWLTRIVATLAQMPGRAAPWCPNLIMHRDAGRLRDEVALIVRHCVEMAIT
FT                   SVGSPAPVIPALHAAGCLVFADVASIRHARRAIEAGADGLVLLTAGAGGQTGWLNGFAF
FT                   VRAVRAFYDGPIVLAGGVSDGAALFAARALGCDLAYMGTRFIATDESLASDAYKTMLVG
FT                   SDADDVMLTRAVTGLPASMLRPSLVAAGLDPDALDESITPERARVLFGQAKDTERPARW
FT                   KDIWSAGHAVGGVSGVQSVEHLVATTEREYDAARERMAAITGGAR"
FT   gene            265415..266260
FT                   /locus_tag="Bcep18194_C6743"
FT   CDS_pept        265415..266260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6743"
FT                   /product="Acyl-CoA dehydrogenase-like protein"
FT                   /EC_number="1.3.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6743"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05792"
FT                   /db_xref="GOA:Q39P24"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P24"
FT                   /protein_id="ABB05792.1"
FT                   /translation="MTIDFGPSWMDEDLELYRTSVRRFVESEMLPGDEAARKRGHVCHE
FT                   IWQRAGEPGFLCTDIPDRDGGGDGDFRHETVLYEEMARRSLTGMCPSIHSIVAHYFLNH
FT                   GTETQKHVYHAAHGARRDRRRAGDDRAGRRLRPAGIANARRTGRRSLRAQRHEDLHHEW
FT                   PPGGRPARGREDRSGETRGRHVDPDRRDRGLPRFPRRASARQDRAEGAGHLRAVFRRRT
FT                   RADGSRARRCRRAGLLPDHVGPAVRAADHRRDGGRCDGGRVRRDARLRAQSRSVRAAGG
FT                   "
FT   gene            265746..266474
FT                   /locus_tag="Bcep18194_C6744"
FT   CDS_pept        265746..266474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6744"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6744"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05793"
FT                   /db_xref="GOA:Q39P23"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P23"
FT                   /protein_id="ABB05793.1"
FT                   /translation="MYTTPRMARGEIVGALAMTEPGAGSDLQALRTRAERVGDHYVLNG
FT                   TKTFITNGLLAGVLLVVAKTDPAKRAGGTSILIVETEDCPGFRVGRLLDKIGLKVQDTC
FT                   ELFFDDVRVPTDRVLGGVDGQGFYQIMLDLPYERLIIGVMAAAAMEGAYDATLDYVRNR
FT                   EAFGRPVAELQNTRFKLAEIATTIKATRCFIDRCVGDLVAGRLDIATASMAKLWGSEQQ
FT                   NRVVDEYLQLFGGYGFMNEY"
FT   gene            266597..267016
FT                   /locus_tag="Bcep18194_C6745"
FT   CDS_pept        266597..267016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6745"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05794"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P22"
FT                   /protein_id="ABB05794.1"
FT                   /translation="MLPLLDPALYAETGTDVLPGAPALRAVRAPGGQISFPPQRYGCRV
FT                   SGASGAELEDVLLTGRGRLRAFATVHIHPKPVPAVPFTIVEVALEDGPVVRGLLSATQA
FT                   LPIEHGAVLVTRLEETVDEAGQAVRALRFVAADPA"
FT   gene            267041..268192
FT                   /locus_tag="Bcep18194_C6746"
FT   CDS_pept        267041..268192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6746"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6746"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05795"
FT                   /db_xref="GOA:Q39P21"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P21"
FT                   /protein_id="ABB05795.1"
FT                   /translation="MVKTLSELRPVYVVGVGWHRYQEPTGTPYVQLGLTAVRQALQDAR
FT                   AQWAAVDTSYVGTGRLGIASGRPMLSHLGSNEGSIVHIENASASGSAAFRHACIEVAAG
FT                   LADIGLAVGVDKIDGPTQIALTKTGISDLARDAIAPFTHYALLTDAYMARYGVGIDEIA
FT                   RVAVKNHRNGASNSNAHRQKVRSLDDVLNARAVSGQLTTLQCCPVGEGAAAVVVASEEG
FT                   IRRHGLDAARAIRVASSAAISETVYPAGVDFDAELTRRVGSCAMQQAQVHPVDLDVLEL
FT                   HDAFAIEELQYIEALGLCNPGDAARKLKAGAYDIGGEMAVSPSGGLIAMGHPLGPTGIG
FT                   QIGEITMQLRGEAGARQHRGAKTGLAHMVGLGAVAYAHVLRRD"
FT   gene            268167..268811
FT                   /locus_tag="Bcep18194_C6747"
FT   CDS_pept        268167..268811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6747"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05796"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P20"
FT                   /protein_id="ABB05796.1"
FT                   /translation="MRMYCGVTERMQISTDPPGATSPSPASRRPADARLVYPFSRGRAP
FT                   GAMRELAFGVRWIRLPVLLHIGVWVIADGNGWAIVDCGMFTAETVAAWESLLDTLSRRV
FT                   PDSALVLPAHGLPFRGLHLRLAQLAAGHANGLQRLRGALAEPVRVVDLLGALFRCTLDG
FT                   SAWQLRLASGECIAHLNRLIAQGEVEAARDAGGVDWYRLTDRSMRAGTRAG"
FT   gene            268882..269259
FT                   /locus_tag="Bcep18194_C6748"
FT   CDS_pept        268882..269259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6748"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05797"
FT                   /db_xref="GOA:Q39P19"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P19"
FT                   /protein_id="ABB05797.1"
FT                   /translation="MTSMQVRSDFYIDGCWQPPAGQRKLDVISPHSEARIGQAPEGTPA
FT                   DIDAAVAAARRAFDHGPWPRLASSARAAHLRRFAQGIRARSAEFAVAVSREGGFPIATS
FT                   EHVHVLRAADFVDYYADLIER"
FT   gene            269284..270045
FT                   /locus_tag="Bcep18194_C6749"
FT   CDS_pept        269284..270045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6749"
FT                   /product="Aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6749"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05798"
FT                   /db_xref="GOA:Q39P18"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P18"
FT                   /protein_id="ABB05798.1"
FT                   /translation="MQFDARVRHLPVGVVGAIVPWNIPILGALSKLGPALAAGCTTVLK
FT                   PSPDTPLSSFLLAEVARAADLRPGVFNLVSAGTAGSVRLVEHPGVDKIAFTGSTAVGKQ
FT                   IARGCADTLKRCSLELGGNAAAIVLDDAPLELVAQGLLLTGLINNNGEACIAQRRIFVP
FT                   EALQSRFVDALHASAQAVQVGDPEDPKTQLGPLVTKAHAERVRGYIEIGKDEGASMISG
FT                   GGTVPGLGRELGPEGLAEYLETQVVLRPLAH"
FT   gene            270204..270338
FT                   /locus_tag="Bcep18194_C6750"
FT   CDS_pept        270204..270338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6750"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05799"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P17"
FT                   /protein_id="ABB05799.1"
FT                   /translation="MLNLSGARPDGTTSLSRNGQAVAGQFFRQSSFATHSLAHWNNAT"
FT   gene            270387..270803
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C6751"
FT   gene            270595..270960
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C6752"
FT   gene            complement(271037..273835)
FT                   /locus_tag="Bcep18194_C6753"
FT   CDS_pept        complement(271037..273835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6753"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6753"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05800"
FT                   /db_xref="GOA:Q39P16"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P16"
FT                   /protein_id="ABB05800.1"
FT                   /translation="MASRRDANMKSLSRPFAAPLDMSVAAPAPFASHADTGAHLDARIA
FT                   AKLSPPTAGATDISRVAPRDLVCSAQSATLTLVRAPAGFGKTTVMTQCFARFGRLGFDT
FT                   GWLTLDQGDNDPSRVLHVLNLCLLRMGGERPTSGNMPSIEDVTLAVFDRIAAHATPFVL
FT                   FVDEFEAIHDQGVIALFQEIVDRLPRHGRIVIGSRSQPHLPLGRLRTQGKLLELDAEQL
FT                   RFSLAETDRMLNGQTGMALSVEDLDHLQRKTEGWPAALRLASLALENRDATRALIDRFS
FT                   GSHEAIAEYLIEDVLGSLSEPVQAFLLRCSVLRQFSVPVCSALNPGVDGEHMLQTLEKA
FT                   GLFVVRVDAHEPAYRFHSLFAEFLRAQLVRRHPDRVPGLHLAASHWYERNGYPVPAIDH
FT                   ALDAEAFVCASTLLQRHAIDFLAQGRLRLLARWFARLPAGCVADHAEVGIVHAWTVCLT
FT                   RGPGEAMALLGASGWLSASSDTVRAHASACHVALLATLDRVEDAYDEGRCCLAALPNAH
FT                   PFAHSSLVNLVANVATTMGHRDEARRLLGAAKSLGDPQSVLNRMYSEATEGLLDLQEGH
FT                   LRLATARFHLAATIAGGHEATGFTDGNAWAGLLYARALYEADRVSEAEPLLNVYVPLAR
FT                   DIGLPDHAIAGYAMLARLAFQRGDIDPAFLLLAQLERLGHDRRLPRVVASAHLERARLL
FT                   LLQGNAEASRSQLDLAEAAAEPWARIEALRFPAHEVETLTIAKLRWQLHFGDPDAAARA
FT                   LAQARGAAAADGRRWREMKLRVLECLASLRARHERDALAAAAPLIGTLCAEGFVRMLVD
FT                   EGPLAAQLALRCQADGATRARDPLLEEYLHACIAPFDVEREAPPASVPEDGTALPAESL
FT                   TRKELRVLQLLAQGYSNGALAEKLFVSDSTVRTHLRNINAKLNVPNRTSAVAAGRRLGL
FT                   VD"
FT   gene            274569..275588
FT                   /locus_tag="Bcep18194_C6754"
FT   CDS_pept        274569..275588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6754"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6754"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05801"
FT                   /db_xref="GOA:Q39P15"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P15"
FT                   /protein_id="ABB05801.1"
FT                   /translation="MADVSKVDGSIAMHFVREAIRVARARGIDVERILLASDIESAFVD
FT                   LDFARVTPQHYGRMWLLLAEQMDDEFFGMDSHAVRAGSFALACRCALGATSLEHALHRF
FT                   THFYRVAMDDLWPSVERRDGRACLVLTSRAGTPRPFALCMMFVILIGVSSWLAGRRIPI
FT                   TDVEFGVAVTDHVDEYRMLFGAATRFDGTRTFVAFDETFLDLPVIRDAASLAVFLHGAP
FT                   SNILRRYRDRGSVSARIRQHLRGIDVAEWPDFTGVANAMHVAERTLFRRLSAEGRSYQH
FT                   IKDELRRDMAVHLLGNSTLGIGDIAAQLGFSEPSAFHRAFRKWTGEGPGAYRATVTKG"
FT   gene            complement(275721..276185)
FT                   /locus_tag="Bcep18194_C6755"
FT   CDS_pept        complement(275721..276185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6755"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05802"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P14"
FT                   /protein_id="ABB05802.1"
FT                   /translation="MSGSCDEGMPGRRAAGVVAAFRMSDLWFASTPRRTFRQSLHRPMP
FT                   VAAGDARLLSQARVGDLPARTASVSNVEVLSAYSKRGASSIFGTPYMNARPTLLNGCAR
FT                   SMPRRLHRGARTPCPPSSSSSLARLSTRHCGFRCASIPACPGWRWRPSSS"
FT   gene            complement(276182..277693)
FT                   /locus_tag="Bcep18194_C6756"
FT   CDS_pept        complement(276182..277693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6756"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6756"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05803"
FT                   /db_xref="GOA:Q39P13"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P13"
FT                   /protein_id="ABB05803.1"
FT                   /translation="MLNESLATTDHAPLRRYEHLYIDGAWVKPIDGELAESIDPATGQP
FT                   WAIAPMGGPQDIDRAVEAARTAFHGTWRSTPGHVRAALLRRLADLFSAAIPELAIIESR
FT                   DNGNLVREHRASLTAQVQWYQWFASLADKAQGATIPIDDSVHAFTTRVPIGVVGAIIPW
FT                   NAPLLATCLKVGAALAAGCTVVVKPAEQTPVSALELARLVHEAGFPPGVFNVVPGYGRT
FT                   AGAHLVKHPDVNKISFTGASQTAKHMVRDGADNLKRFTFELGGKAPHILFADADLDNAI
FT                   NAATASAWRLTGQSCALGSRVLVERPIYDRVVEAFRTRAKAVRVGLPSIDSNHMGPQSH
FT                   ETQLAKTLSYVDAGKQDGAELVTGGRRITTPELAAGYFVEPTVFAGVTNQMRIAREEIF
FT                   GPIASLIPFDGEDEAIAIANDTPYGLTAGLWTRDVGRAHRVSNRIDAGMVWVNTYSFLR
FT                   WSTPYGGFKASGWGRENGIDALDPYLETRTTVISTTGQFPNLYED"
FT   gene            complement(277867..278661)
FT                   /locus_tag="Bcep18194_C6757"
FT   CDS_pept        complement(277867..278661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6757"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6757"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05804"
FT                   /db_xref="GOA:Q39P12"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P12"
FT                   /protein_id="ABB05804.1"
FT                   /translation="MQITLNGKVAVVTGAAQGIGRAIAKQLAESGADVVVNDIDEQRIA
FT                   AAVAAIKAEIPGAKVRGAAADLSTAAGCDRLVTQVPDCDILVNNAAIFETADFFDIPDA
FT                   AWQRYFDVNLMSGIRLSRAYLPAMGKRDWGRVVFISSECGISTPPDMLHYTMTKTALLG
FT                   ISRGLAKRMAGTGVTVNAVLPGPTLSEGVQTFLEAEIRRTGKTIEEQGAELVNALRPSS
FT                   ITRRFQSVDEVANLVLYTCSPLASATTGAALRADGGVADTPI"
FT   gene            complement(278917..279171)
FT                   /locus_tag="Bcep18194_C6758"
FT   CDS_pept        complement(278917..279171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6758"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05805"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P11"
FT                   /protein_id="ABB05805.1"
FT                   /translation="MPDARMNAGGAPRKCIVAGDVKSAPDMQRTARCQDDSCVAAKSIR
FT                   AARAFRTLETWPRRSGHTTCTIRAPAFIGKPHAMPICTI"
FT   gene            279230..280678
FT                   /locus_tag="Bcep18194_C6759"
FT   CDS_pept        279230..280678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6759"
FT                   /product="MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6759"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05806"
FT                   /db_xref="GOA:Q39P10"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P10"
FT                   /protein_id="ABB05806.1"
FT                   /translation="MKFERGAVASAPVSTDVTATIAAHVAQVANGHLSAADTEALRRLF
FT                   LDNFIVSQWGVTRPWTGQIAEWTRRFANTGASPVPGCEWTAEASVAALVHGTASHSYEL
FT                   DDTHNATLSHPGAAVIPAALAVAADIDASQAQLFRAVAAGYEAMALVGIAAGGLETVHR
FT                   GFHPTAIFGTFGAATACAALYAFQRGEPVTDALLIRAWGHALSQASGSMQFSAEASGGE
FT                   VKRVHAGFAARNGVLAAAFAQMDAVTAPRLAVEGVYGLAALFGGPLQAVVPSARLQIHE
FT                   ISFKPYACCRLFHSTIDALGELTDNFSVPTAGLREIVISGPQLIADQHMLARPTSTMAA
FT                   QYSCPYIVGATLAYGPYRYDVYDDAFLDDPQIRRIAGLVRFELSEALTQYYPTRFATGA
FT                   AIRFEDGAARSAIVIDSVGTPARPLTVDQILAKGDGLASRAPASAATGTQLAALLWDDA
FT                   QGSRALAQAFARASHEAGRQWRQS"
FT   gene            280663..281253
FT                   /locus_tag="Bcep18194_C6760"
FT   CDS_pept        280663..281253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6760"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05807"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P09"
FT                   /protein_id="ABB05807.1"
FT                   /translation="MEAIMSIESTTPSTPDVTRKPLHARHIAFEAFRRSDGLFEVEGQV
FT                   TDRKPQDFTPPSGLRVVPANEPIHDIGVRIVFDLDMIVRAVSTFIRAYPYRECPGGGES
FT                   LQALVGLRIGAGWNGEVRKRLPPGDTCTHLREILMPLATAAIQAVNPLRSQALLDATDA
FT                   GGKPLKIDSCYAYGASRELVMQRWPAFHRPVRD"
FT   gene            281283..282215
FT                   /locus_tag="Bcep18194_C6761"
FT   CDS_pept        281283..282215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6761"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6761"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05808"
FT                   /db_xref="GOA:Q39P08"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P08"
FT                   /protein_id="ABB05808.1"
FT                   /translation="MQRTAFPMDPLSDILSLLKPGSQFHAGLDAAGAWSFAFPEYEGIK
FT                   FAAVLQGGCWAIIDGVEAPIRFEKGDCFLLNRGRRIVLSTDLALEPQDSTAVMDAVARE
FT                   GIAVHNGGGEVLLISGFFGFSDRYAAMPFDALPPLISTPRMSSQAEVLRWSLDQLTSEL
FT                   RDPQPGGALVSNHLMHLMLVQVLRLHLMTSPDGAADGWFMALSDRRIGAAIGAIHSNPA
FT                   HHWTLEELARVAGLSRTIFAQRFKDLVGATTIHYLTRWRMLTAANRLRSGDDTIASIAF
FT                   SLGYESESAFCTAFKRTMCCSPTQYRRQP"
FT   gene            282577..283032
FT                   /locus_tag="Bcep18194_C6762"
FT   CDS_pept        282577..283032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6762"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05809"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P07"
FT                   /protein_id="ABB05809.1"
FT                   /translation="MASKDMSLEAKIGRLVDGHEITTLMSKYCHGIDKKDEAIFMSIWA
FT                   DDGVYELPRGQTSGIDGIRQLVHKVWREVPKCHHHITNPLIDIDGDRATAKTDVIYYRQ
FT                   TDDGVLQLLSGTYAFRFARIAGEWKTTYLKFASFDTVSPVFKENIGG"
FT   gene            283194..283556
FT                   /locus_tag="Bcep18194_C6763"
FT   CDS_pept        283194..283556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6763"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05810"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P06"
FT                   /protein_id="ABB05810.1"
FT                   /translation="MNHDATPDSGQLPKGFEDLEPFLAAWSTPTSHERWIRRAAMPYDE
FT                   IVRFYDAMFARAEEATAYLEQFPLDDMPEPAGNLFRLLLSLCHASVAVEMHQAPGIKHA
FT                   PPQHALQIVTGFQPHG"
FT   gene            283610..284854
FT                   /locus_tag="Bcep18194_C6764"
FT   CDS_pept        283610..284854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6764"
FT                   /product="putative dioxygenase"
FT                   /EC_number="1.14.12.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6764"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05811"
FT                   /db_xref="GOA:Q39P05"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P05"
FT                   /protein_id="ABB05811.1"
FT                   /translation="MNNPMDFNGSFTESVGLETGAVPTSIYTDAAQYEVERERIFRRAW
FT                   LMVGRVERIPKPGDFFVKQLAVLNASVIVARSEDGTIRAFHNVCAHRANIVEHRASGNA
FT                   KRFVCRYHSWGYDNAGQLAHVPDESGFFGLDKKKCGLTPVALEIWEGWIFINLATEPEL
FT                   SLAEFLGPIADALTGIEYQNPDHPIVLRGEFNANWKAVAENFSEAYHVASIHPKTLAPF
FT                   YIGQQNPFGRPISVRLHGPHRSMSWWLNPIAQPFAKSKVAQWLFSADHSVTGTRKAGQV
FT                   NSVVEHKGVNPTKHEHWASDVNWFFPNWHLQISANQFWTHEFWPTSASTTVWEARFYYK
FT                   KATTVRERLQLEHFTSHITDSMLEDLGNIESMQVGMASGAKPVIYFNESEVLCRHGIEQ
FT                   VVKWSAAPTAKGALD"
FT   gene            285085..286056
FT                   /locus_tag="Bcep18194_C6765"
FT   CDS_pept        285085..286056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6765"
FT                   /product="ferredoxin-NADPH reductase"
FT                   /EC_number="1.14.12.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6765"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05812"
FT                   /db_xref="GOA:Q39P04"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P04"
FT                   /protein_id="ABB05812.1"
FT                   /translation="MTSGVGGLTVRVAAKREEAVGICSFELVSTDGQPMPAFSAGSHID
FT                   VAVPGGPTRQYSLCNAPEEGHRYQISILRDPNSRGGSAGMHDRVQVGDALAISVPKNNF
FT                   PLAHDATRSLLMAGGIGVTPILCMAERLAAIGAPFEMHYCSRSRARTAFLDRISRATYA
FT                   RHVQFHFDDQPDTPAFDIAARLARPESGTHLYVCGPTGFMDAVLGAARAAGWPEAQLHY
FT                   EFFAAGERVAADSDRFEVEVASSGQVVTVEEDESIVQALARVGIEIETSCEQGVCRTCE
FT                   TRVLAGEPDHRDVCLTPAERADNDRLMPCCSRSKSARLVLDL"
FT   gene            286108..286938
FT                   /locus_tag="Bcep18194_C6766"
FT   CDS_pept        286108..286938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6766"
FT                   /product="Hydantoin racemase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6766"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05813"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P03"
FT                   /protein_id="ABB05813.1"
FT                   /translation="MGIRMVWQAENRSNDADFGGVRETYGAMLKFAQQIARPDTEITLR
FT                   YMEDAPRAFANNLLYPRAVTKVQVVNKVVDAEKEGFDAALAGVCIIDAYSQECRQAVRM
FT                   PVLGGAESTMLMAQLVGKKFAWVTIAPAFIEPFEAHIRLHGWEHRAIRNQPVRALDPSC
FT                   WPAIVDAANGKPDRWIEMFDEAAQACVRDGADTVLCGCNPGGALLALAGYTEVRGTGVP
FT                   VIVGPAAMVKLAESMVDLRRSIGLTKSEAVAGAYRTTPPHILEELQAMGKKLLA"
FT   gene            287205..288317
FT                   /locus_tag="Bcep18194_C6767"
FT   CDS_pept        287205..288317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6767"
FT                   /product="outer membrane protein (porin)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6767"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05814"
FT                   /db_xref="GOA:Q39P02"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P02"
FT                   /protein_id="ABB05814.1"
FT                   /translation="MITWFGDRHLSSTQKLFAFGIAMLPACACAQSSVTLYGTLDVGLL
FT                   FTNKTLGSTAQGNAGKQFSLINAGLEPSAFGLQGKEDLGGGMKMTFKLESGVSLVNGGF
FT                   DNSNGNFFGRQAWLALDGAFGQLKAGVQYSPFVLAIYESDPRNAGQFGTAFSVYADQTF
FT                   SGTFNPNAVTYTSSQFAGFSTSIMYAPGGMPGDFRAGQQYSVAVRYQYSGLVVNAAMYD
FT                   SSEGKNNAGLTTFQQPFSGRMIGVLYNFGAFTAKGSFTSYKVPTTVANGVASGGGNNVW
FT                   NVGFDCYVLPQLNINSGLWYVRDPHDSANHGLVGALTARYFLSKSTSLYAEIGAANNHG
FT                   HERLGLSIDNALYGVPGTTVGAVLGINKRF"
FT   gene            288478..289782
FT                   /locus_tag="Bcep18194_C6768"
FT   CDS_pept        288478..289782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6768"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6768"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05815"
FT                   /db_xref="GOA:Q39P01"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P01"
FT                   /protein_id="ABB05815.1"
FT                   /translation="MSDLFSAEPHRPLADALRPTSLDDVIGQAHLLGAGMPLRRAFESG
FT                   KPHSMIFWGPPGVGKTTLARLTAQAFDCEFAALSAVLGGVKDIRAVTARAQQLFDEAGR
FT                   RTIVFVDEIHRFNETQQGALLPSVTSGAVVFIGATTENPSFEVNRALLSRARVYVLKPL
FT                   GDDALRALFVRAHETALGTLSFDDDALGKLIDQADGDARRFLNLLEQVRTASASAGVTT
FT                   IDGRFVEHATTSGARRFDKGGEHFYDQISALHKSVRGSNPDAALYWLCRMLDGGTDRRY
FT                   LARRIVAIAYDDIGLADPTGLRIADDAAKTSDRLGAPEGDLALAQAVLYLACAAKSNAG
FT                   GMALMQARAFVRQDQPRDVPAHLRDVRAELTQALGHAYRNPHDERDGYAAGESYLPDGM
FT                   REPYWYEPAPRGVEARIAERLDGLRRLDREAGKRR"
FT   gene            complement(290016..291215)
FT                   /locus_tag="Bcep18194_C6769"
FT   CDS_pept        complement(290016..291215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6769"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6769"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05816"
FT                   /db_xref="GOA:Q39P00"
FT                   /db_xref="UniProtKB/TrEMBL:Q39P00"
FT                   /protein_id="ABB05816.1"
FT                   /translation="MSTLDQAPVSGKFGLLRAAEAVTNWRALAMSAFALVASMLMGMLT
FT                   IQVLGHSPVLGLLFIIATFAVSLIGYSAVGIVLMRDAQAESVGFVDALLQATFSVHRLL
FT                   GIGVLLVAGWILLLLALLIVFLVCKIPGVGPLLYAIAYPVAAIVAGAIFAGMGYVGYPL
FT                   AAPAIWQGNSTLQTAARLLQIGRRQLLGVIVRMFGLLLLVGVLSAIVFGILGTGAAIAS
FT                   SISAATGTSPLGGLMGTLGGLGGLGRHASAYGLGADAAGGGFDYRSMAYLGAYGFGNGL
FT                   LFAIGLVIPFLTFVNGTCLIYLQTVSGVDFSATEEKLSQHVADAKRHAEQARERAADHL
FT                   AKARDSHAAGTASAAGTASLPMSDTESPAADAATACAQCHKPMAADDLFCGECGARRHA
FT                   "
FT   gene            complement(291245..291979)
FT                   /locus_tag="Bcep18194_C6770"
FT   CDS_pept        complement(291245..291979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6770"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05817"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ9"
FT                   /protein_id="ABB05817.1"
FT                   /translation="MHCATTAHLNEAPEKTDMTIQKTLAAACAVTLLASGCATQNGTGG
FT                   ISSESVLRCTALGAGGALVGALIGGTKGAIGGAVAGLAACAVIEVATRQTKTAAEVDRD
FT                   YRASNRNNLPPYAKIDAYTTVVTPRSAVKTGEPIKLASQIRAVSGTNEPVQEVKEVVTV
FT                   YAPSGEQFKRGEKVVNATPGSGEFDNSFTLKLPSGAPQGTYTLKSQVYLNGKPGSTRQS
FT                   SIQLAQVDGVTVVALLDAPAAH"
FT   gene            complement(291948..293321)
FT                   /locus_tag="Bcep18194_C6771"
FT   CDS_pept        complement(291948..293321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6771"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05818"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ8"
FT                   /protein_id="ABB05818.1"
FT                   /translation="MTACTHCGTDLPGGLKFCKQCGTPVAAIRTEAAGAPCRSCHAVLT
FT                   PNQRFCNKCGTPVASADDAGAIEVEVPAPPVEPAWQPAYGAVESAHEPAHGAVDAQDTQ
FT                   TDISVESLVVNTADTVSDRANAPLQSHDAAATAAHMTAADHRGDAVAASHVSPVITDAQ
FT                   PAAAGASANIEAALVDDETNGVEAVLKPHDASDADVTSASAEPMRPASGVVPRPISQTA
FT                   TTIDDTSAKLKIIAAGVAVAIACAGGAFWWHGRQASAPATPEPVAASTIPAFTADAASG
FT                   VTGSGSVTAGAVVATMPTDAPASAPIDTATAAAAMTSPASGPAVVTNIATAPVPATPPA
FT                   SNAPPASANAQQPSPFAKLQDDTPSPTAPTAVAEVPRSKPHPTPPVRPSTAANPAAPAV
FT                   DGLLKRAQGDLSRGQYDKAIATAESVLAIEPGNRPAKTLIDKAKARQMDALRNNSTLE"
FT   gene            294426..295934
FT                   /locus_tag="Bcep18194_C6772"
FT   CDS_pept        294426..295934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6772"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6772"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05819"
FT                   /db_xref="GOA:Q39NZ7"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ7"
FT                   /protein_id="ABB05819.1"
FT                   /translation="MLVDELHSRKNEVIDPSALRARLRDGALLETRAWLASGWQEGTDG
FT                   RSFPVTNPATGDILARVASLGAAEVEQAIESSALAQQGWQKRTSHERAKLLRAWFDLIL
FT                   ANADDLALIMTSEQGKPLAEARGEITYAASFVEWFAEEAKRVYGDVMPHPQGDKRILVI
FT                   RQPIGVCAAITPWNFPAAMITRKVAPALAAGCSIIVRPADLTPLTALALAVLAERAGIP
FT                   AGVLQVVCGPSREIGAVLTASPVVRKLSFTGSTEVGRVLMSQSSGTIKRLSLELGGNAP
FT                   FIVFDDADLDAAIEGAMASKYRNSGQTCVCANRFLVQAGIHDRFVEALTRRVQALKVGN
FT                   GIEPGVQQGPLIQKSACDHLNQLIDDAVSKGARIVTGGKGHPLGGTFFEPTVIADATPA
FT                   MRLAREELFGPVGPVFRFDDEAEAIAMANDTEYGLAAYLYTRDNSRIWRVGEALEYGMV
FT                   GLNTGVISNEVAPFGGVKQSGLGREGSRYGIEEYLEIKYMCSQV"
FT   gene            295964..297130
FT                   /locus_tag="Bcep18194_C6773"
FT   CDS_pept        295964..297130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6773"
FT                   /product="Iron-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6773"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05820"
FT                   /db_xref="GOA:Q39NZ6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ6"
FT                   /protein_id="ABB05820.1"
FT                   /translation="MEMSPQSMLFETVPSILQEWGCVRRLGQVMAAWTERRHVLIVTDA
FT                   GLHNAGVLEPAKASLAAEGFRVAVFDEVVADPPESVVSRCVEFARGAEADIVIGLGGGS
FT                   SMDIAKLAAVLTVSRQSLAEMYGIGNVKGARLPLVQIPTTAGTGSEVTNISIVSVNETT
FT                   KMGIVSRQLYADKVILDAELTVGLPRSHTAATGIDAMVHAIEAYTSKHKKNALSDALAR
FT                   EALRLLVSNLIPACENGHDRHAREAMLLGATLAGQAFANAPVAAVHALAYPLGGHFHIP
FT                   HGLSNALMLGPVLRFNAEAAASHYSELADVVSVGGTGDATARTAAFIAFLEDLMDRSGA
FT                   PRRLRDVGVTQASLPTLAADAMKQQRLLLNNPVVVTESDALRLYEQAY"
FT   gene            297252..298646
FT                   /locus_tag="Bcep18194_C6774"
FT   CDS_pept        297252..298646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6774"
FT                   /product="Flavin-containing monooxygenase FMO"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6774"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05821"
FT                   /db_xref="GOA:Q39NZ5"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ5"
FT                   /protein_id="ABB05821.1"
FT                   /translation="MAARMKIAGIDDFVVLEKRPDLGGVWLDNSYPGAACDTESHLYCY
FT                   SFHPHLRVSAMYAGRNELLHYLKSLATRFDLAEHLRFDTEIRSAEWDASASVWRFELND
FT                   GSRMTSRFFVPAWGQLNRPMIPAVRGLADFNGEYFHSAEWRHDVDLTGKRVASIGNAAS
FT                   AVQYVPLIAPKVDHLTVFQRSANWIMPRNQIVFSTEQLDTYEREPHLFEESRKSLHAFR
FT                   ESGFERTRMGSNAQLEGKSLALAHLHRQVPDPVLREQLTPDYEYACKRILRSDDYYPAL
FT                   MRDNVALETAGVESFVDEGIVTRDGRLLPFDVVVFGTGFESQAFQGSLQVRGTDRTLAQ
FT                   AWADGPEAYLGMTVPGFPNMFMLYGPNTNLNHNSIVSMLEIQQNYIIDAIGGMASAGVK
FT                   AVSVDSGVFDAYNDKLQSAMAGSAFSAGCSSWYKNAQGKVINNWPGTVDEYRAATQWDQ
FT                   SVFAAI"
FT   gene            298659..299642
FT                   /locus_tag="Bcep18194_C6775"
FT   CDS_pept        298659..299642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6775"
FT                   /product="Esterase/lipase/thioesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6775"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05822"
FT                   /db_xref="GOA:Q39NZ4"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ4"
FT                   /protein_id="ABB05822.1"
FT                   /translation="MTSVHWLPLTEVADDARDAVRAFRELGGRHYGSFSVDQSRVNFVR
FT                   ACELNGLTGDEAVVHEDIDVPVAGGSIRVRLYRPPAGASADGNPLVVFIHGGGWVIGSV
FT                   DTHDGICRHLARHGGCAVASVEYRLSPEHRWPVPLEDCEQALDYLTANAAALSINASRV
FT                   ILAGDSAGGNMATLIANAASVAGPAIIGQVLFYPVTDLTASLPSYRRIQGGFPLVAESM
FT                   LWFREHYVPDGTPFDLPRLSPLLHAEGRRQPPMFMATVGLDPLCDEGIAYASCAARAGS
FT                   QVEHHHLPGHHHGIVTAARAIPAARYLLDRAASFVRRLAEKDGCDA"
FT   gene            299983..301473
FT                   /locus_tag="Bcep18194_C6776"
FT   CDS_pept        299983..301473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6776"
FT                   /product="Flavin-containing monooxygenase FMO"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6776"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05823"
FT                   /db_xref="GOA:Q39NZ3"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ3"
FT                   /protein_id="ABB05823.1"
FT                   /translation="MTKNQADSCSPEHVEVLIIGAGISGIDAACHLRMNLPDRSFAILE
FT                   AMDGFGGTWWTHRYPGARSDSDLYTYAFGFRPWQGRSIATADEIHSYLGDVIKEYDLGS
FT                   KIRYGHRVQTVSWSSEQKRWTVEVSRNDTGEHFSITTDFLWLGAGYYDHRQGFTPKWNG
FT                   FDRYKGTVIHPQHWPEDLDYAGKRVVVIGSGATAATLIPAMAGTAAHVTMLQRSPTFFT
FT                   AVPWTHQLDATLRELSLPEEWRSEILRRAHLKQTFDLINLAAANPDAVRDWLINETRQQ
FT                   LPEGFDVDKHFNPGYRPWQQRVAAVPEGDLFTAIRDGKASVVTDTIESFDENGITLASG
FT                   EHLQADIVVTATGFDMSAFGQIAFHVDGDPVDMTKRVSYRGMMIEGIPNMAFIYGYYRS
FT                   SWTLRADLVCEFTCRVLAHMDKVGAKTVEPRLRAEDADMQRLPWTDPNNFNAGYVMRSQ
FT                   HQMHSRGDRMPWQHHFEYEEERQTIPELSPDAEVLVYR"
FT   gene            301506..302456
FT                   /locus_tag="Bcep18194_C6777"
FT   CDS_pept        301506..302456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6777"
FT                   /product="Lipolytic enzyme"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6777"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05824"
FT                   /db_xref="GOA:Q39NZ2"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ2"
FT                   /protein_id="ABB05824.1"
FT                   /translation="MALDLHLAGFLESLAGSGAKPLPQSSPEEARGLMQHLARAVRAPE
FT                   AVVDVHGVEDLTVPGATGSLRARLYRPTQERNLPTVVYLHGGGFVIGDLDTHDNICREL
FT                   ARGANAVVVSVDYRLAPEHPYPAAADDAIAATKWVIANAGELGGSDVVAVAGDSAGGNL
FT                   AAVVTQQLHADGISLSAQFLIYPAVAQDRAGFPSFKENGEGYFLDLETIAWFERHYVLD
FT                   GTDREDPRLAPIRAKDLAGLPPAVILTAEFDPLRDEGEAYGRLLHASGVKVDTIRCDGM
FT                   IHGFFDMGAISPGAQAWIEKGIASFRKVLGGAQHH"
FT   gene            302679..304298
FT                   /locus_tag="Bcep18194_C6778"
FT   CDS_pept        302679..304298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6778"
FT                   /product="Glucose-methanol-choline oxidoreductase"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6778"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05825"
FT                   /db_xref="GOA:Q39NZ1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ1"
FT                   /protein_id="ABB05825.1"
FT                   /translation="MKNSFDYLVVGGGSAGSVLASRLTEDPDVTLCLFEAGGTGDGWPI
FT                   NVPAALVLMVPSRLNNWAFETVPQKGLQGRRGYQPRGKALGGSSAINAMVYTRGHHADY
FT                   DDWAALGNEGWAWNDVFPYFKRSEHNERLGNEWHGRGGPLWVSDLRTGNPFQGRWLEAA
FT                   RQCGLPITDDFNGAEQEGVGIYQVTQKNGERWSAARAYLFPHMKARGNLTVETGAQVRR
FT                   IVFDGKRAVGVEVTRGGNVETVWAKKEVILSAGAFQSPQLLMLSGVGPKDELERHGIKV
FT                   VADLPGVGENLQDHPDFVVSYKTNSLDALGVSVRGGIKTLRDIRQYRASRDGTMTTNFA
FT                   EGGAFLKTRPDLERPDVQMHFVVGPVSDHGRKVQLGHGISCHVCLLRPKSRGSVKLRSA
FT                   DPLDAPLIDPAFLEHADDIEVLLEGYKLTRRLMAAPAMSQFVTEDLFASRSRSDDDIRA
FT                   LLRERTDTVYHPVGTCRMGNDALAVVDAELRVRGTEGLRVVDASIMPTLVGANTNAPTI
FT                   MIGEKASDLIRRISRFPVAMSA"
FT   gene            304911..305600
FT                   /locus_tag="Bcep18194_C6779"
FT   CDS_pept        304911..305600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6779"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6779"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05826"
FT                   /db_xref="GOA:Q39NZ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NZ0"
FT                   /protein_id="ABB05826.1"
FT                   /translation="MHSLILIADDAPEMASTLDTCLTRNGFRTFQTNTSQAVLATQLNL
FT                   KPDLVILDVRELCADTLDMLARLRRQSDTPIVVMSACDLDGERLRALHAGADDYIVRPF
FT                   NPDVVVARLLTMLRRSGALAPERRLRVGALEVDTESYRVGVRTSSGEAPVSVTLVEFRL
FT                   LAHMARLPNRAFTRIELLNACMTDVSTSTRTVDSHMTRLRKKLVAAGASGILECVHGVG
FT                   YRLQKAG"
FT   gene            complement(305950..306924)
FT                   /locus_tag="Bcep18194_C6780"
FT   CDS_pept        complement(305950..306924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6780"
FT                   /product="Glycosyl hydrolase"
FT                   /note="contains BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6780"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05827"
FT                   /db_xref="GOA:Q39NY9"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY9"
FT                   /protein_id="ABB05827.1"
FT                   /translation="MTMNRKVLSLSASIVVFGALLGGMQSAVSASELKPVPAVQSSIAT
FT                   QSPVLDATWAGQRVVSVGANGIILLSDNRGATYRQAKAVPVSSTLTSVSFIDARTGWAV
FT                   GHWGAILKTTDGGETWEVQRLATTEDRPLFGVHFIDADHGVAVGLWSLILVTDDGGKTW
FT                   TKKEAVLPNGKKSDLNLFGLFSNSNGEIFATAEKGQLFISKDKGNTWENVETGYKGSFW
FT                   CGVALPNGVLLVGGLRGTLMRSEDNGHTWSRATLDTKNSITALASRGSTVLAVGVDGLQ
FT                   AQSTDDGKTFQRLNTQTGTTYTAALPSPGDKWLVFSRDGVVAQ"
FT   gene            complement(306941..309340)
FT                   /locus_tag="Bcep18194_C6781"
FT   CDS_pept        complement(306941..309340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6781"
FT                   /product="efflux pump, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6781"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05828"
FT                   /db_xref="GOA:Q39NY8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY8"
FT                   /protein_id="ABB05828.1"
FT                   /translation="MNQTPVPDAARPSKLLRILHSLENTLFGHRRLVLGLLVLFTVVMA
FT                   CFAVKLRMDAGFEKQLPLGHEYTQTFNEYRGDLLGANRLIVVVKARKGSIWTPDALKRL
FT                   YEVTQAVTFLPNVSRSSVQSLWTPNSFVNEITEDGFRADPLIPGTVTPDQLDSNTVGAI
FT                   SRSTAQGGFVGSLVSRDQSSAMVTADLNELDAKGERVDYVAFDQALEAQLRSKFEDSNY
FT                   EIQIIGFAKQIGDIANGASSVLKFCAIALLLTALAVYWYCRSIRLTILPLTCSLVSLVW
FT                   QFGTLHLLGYGLDPLGVLVPFLVFAIGVSHGVQQINFIVREISHGKSVEQAARSSFSGL
FT                   LIPGTLALVTAFVSFVTLILIPIPMVRELAITASLGVAYKIVTNLVMLPLAASMLKVDG
FT                   NYAKNAELHAARRGRVLRVLAKVAIPRNAAIILLAAVVVFCVAAWESRDRVVGTLQAGA
FT                   PELRADARFNKDSVSIASSYDVGLDWISIVFEAPPQSCNNVEVGAYQDRFVWSMRAVPG
FT                   VLSVVSFSSLLRQYNEGYNEGNPKMSAIPIDPDNYSSLAGEVARTPGVMRKDCSMTAVN
FT                   IYLADHKATTITQVINAAKHFRDTNKLPGVKIRLASGNAGVLAAVNDEIERSELPMMLY
FT                   VYTTIVLLVLVTYRDLRAVLACCLPLTIGTFIGYWFMKELQIGLTVATLPVMVLAVGIG
FT                   VDYAFYIYNRLQLHLANGVGIVKALEQSILEIGTATIFTAITLAIGVATWSFSELKFQA
FT                   DMGKLLAFMFIVNMVMAMTVLPAFAVWLERIFPRRRPARAPGLLAH"
FT   gene            complement(309348..311054)
FT                   /locus_tag="Bcep18194_C6782"
FT   CDS_pept        complement(309348..311054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6782"
FT                   /product="protein of unknown function DUF1302"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6782"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05829"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY7"
FT                   /protein_id="ABB05829.1"
FT                   /translation="MATTTSLQPRSSVVFVRAAISALVALGCGSAHAFTFTIGNVEGSF
FT                   DSTVSAGVGIRTASPSSNLVSPTYNAATGAQTGGGRLGQLSGLSDQGDINYGKGDPFTS
FT                   YLKGSHELLLKMPSQGLTFMARGTWQYDYSGTHTTGATSGQNLFYNPPPSLNGGLSSDA
FT                   EKNIRFKPRLLDLWVSKQFNVGDQIARIRVGNQVVSWGESIWEVGGVNATNAIDVNRAS
FT                   QPGAQVKEFILPAPILSVASGVGHGVNVEGYIQSNWNQNYLPPVGSYWSNQIVGPGNNA
FT                   YGVSTVHPKNGGQYGFSIRYQPAGTDLNLGFYTIAYHDKFPQVSLSSTGGTIFRFPEDR
FT                   HMIGVSANFPVGDWAIGTELSYRPRDAVPLNPASGCVAQGGNCWVDEKRFQWHLTTLYS
FT                   LQPGNSGAFLKLLGAQTATLTTETVIIAYPGLHKSYGGSPISPGALLWGNEFNDLFATG
FT                   ALNSPGSAQGTKYSGGIDVDFNWVYDGTVIPGWQVNPGIYVRYGLFGNTPNVNAQFMRG
FT                   VTAMNLYVNFIQNPANWQVALNYTRFMGPTNPLANPLRDRDFVAIVASRNF"
FT   gene            complement(311071..312636)
FT                   /locus_tag="Bcep18194_C6783"
FT   CDS_pept        complement(311071..312636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6783"
FT                   /product="protein of unknown function DUF1329"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6783"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05830"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY6"
FT                   /protein_id="ABB05830.1"
FT                   /translation="MTWSSVIQQNKVQAHPNSFRIANKRTGLSVPSSVFTMHNPLAGAR
FT                   HLVKVKEIAVVKTHAFKKSASLIRSAAKLSVIASAVAMSLTGALAEGTDASHTPSGAEI
FT                   AGTASGIPAWTPVGNVGSGWSYGKRRADFFKYKSDKPLYTIDASNVDKYADKLNPGQIA
FT                   LLKNLKGFTMPVYPSRRTCGVPDFVAENTKNNAGFAKMNADGSELSDAHLPGYPFPAPK
FT                   TGAEVMWNAKLHYRGAGVEMRDIITVVSPRKGASDWIKNVSDAWIYQPWGDKAGTTFAK
FT                   VNQVEGNAYYAYKSPAAIAGQAAIFTTYAGKPTEVFYYFPGQRRTRRMPSYAYDAPQIG
FT                   FDNQYNMDEALVFSGQTDRFSWKLLGKKEMIVTYNDLGMYDFSDKFEDAYGPDFVNPAK
FT                   RRYELHRVWVVEATVKQGMRHTAPKRLFYVDEDSWNYLGAVDYDAQGNISKVREGYVIP
FT                   VYETGSCDTLAFAQYNLVDGRYLVDGSMLAAGRDAKWSVDSSADQHYKPSFYNADNLRA
FT                   LSER"
FT   gene            complement(312795..313775)
FT                   /locus_tag="Bcep18194_C6784"
FT   CDS_pept        complement(312795..313775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6784"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6784"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05831"
FT                   /db_xref="GOA:Q39NY5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY5"
FT                   /protein_id="ABB05831.1"
FT                   /translation="MAIIQVQQIMHENPLHARAPHEPRYEDGSAFCDGNYVPITEATVP
FT                   LVDAGFLHADAAYDVVTVSRGNFFRLDDHLTRMEESSAKFFLENPFNRDQVKEILHNLV
FT                   RNAGLKDAYVWWCVTRGPLSVDRRDRGAMKNAMFAFAVPFFFQADDEVRTRGSNLLISK
FT                   LYNRISAKAVDPTAKNFHWMDMKLALFEAMTQEKDWAVLVDESDNLTEAAGANVFFAKN
FT                   GELYTPAEGCLLGITRQSVFDIAAELGIKVNIGKYTATQLREADEAFTSSSAGGIMPVS
FT                   AIDDQPLGNRNGPGPISEKIHNLYWEKRWAGWHAQPAEYFSSVPA"
FT   gene            314341..315801
FT                   /locus_tag="Bcep18194_C6785"
FT   CDS_pept        314341..315801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6785"
FT                   /product="Aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6785"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05832"
FT                   /db_xref="GOA:Q39NY4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY4"
FT                   /protein_id="ABB05832.1"
FT                   /translation="MPIFEAEHLRKAFIGGRWVAPANGGVEHDIINPATGEVSGVLLFS
FT                   DEADVNLAAEAARDAFAAFSNTPLVERLKLLERVIGAYTERLQDMADAITLEMGAPMDA
FT                   ISRPLQAALGLWHLHTTLEVAKQYPFERTQGTSRIVKEPVGVCGLITPWNWPMNQVMCK
FT                   VAPALVAGCTIVLKPSQNAPYSAIVLAEILEKAGVPPGVFNLVQGAGQRLGRAIASSPL
FT                   FDMVSLTGSTSAGVEVAQAAATTIKRVTLELGGKSANIILDSENFQQGVTHGVLQMMAN
FT                   SGQTCTAPSRMLVPAHRLEEAEQIAVAACGQVVVGDPRDPGTTMGPMANQRQHQKVQEM
FT                   IRVGIDEGAMLLSGGLGNPSGLERGYYVKPTVFSRVNNRMKIATEEIFGPVLVIIPYRD
FT                   ESDAVTIANDSPYGLSGYVYGDSIEQAERVARKLRTGMVHLNGAAVDIAAPFGGYKQSG
FT                   NGREWGYAGIEEFLETKSMFGATPGAVS"
FT   gene            complement(315944..316543)
FT                   /locus_tag="Bcep18194_C6786"
FT   CDS_pept        complement(315944..316543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6786"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6786"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05833"
FT                   /db_xref="GOA:Q39NY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY3"
FT                   /protein_id="ABB05833.1"
FT                   /translation="MTRVRAALRRQDFVDAAVEVIAAHGVAGATTRRIAEAAGCPLASL
FT                   HYVFHTKDDLFDAVYESLFDLLAMNAPADSEFRSFGELAGWQLRKMVEWLVQHPSYARA
FT                   QSELIQWAERHRPDFALKTYVQTLERTIAYLGKCAPQVNHGAIESVARMSIILIDGLLN
FT                   SWQGDTNIHQLRANLDHASSALEAFATSLSSSTVQA"
FT   gene            complement(317129..317758)
FT                   /locus_tag="Bcep18194_C6787"
FT   CDS_pept        complement(317129..317758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6787"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6787"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05834"
FT                   /db_xref="GOA:Q39NY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY2"
FT                   /protein_id="ABB05834.1"
FT                   /translation="MQRVRAEVRRQDLVAATVAVIAEHGVKGATTRRIAEAAGCPLASL
FT                   HYVFHSKDELLFAVYESLIDLIRSDSPEAPEHGTLADLAEFNLRSVMAWFEANPAYAKT
FT                   QSELYTWALRHQPDMAIGALRISQEGARAMLASAEPRADAKALDAIARLSIALVDGLLF
FT                   SWFAQEDSKRLAVDVDHASKMLAAYATTLLDARPAAKTPRKSVRKQ"
FT   gene            317870..318133
FT                   /locus_tag="Bcep18194_C6788"
FT   CDS_pept        317870..318133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6788"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05835"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY1"
FT                   /protein_id="ABB05835.1"
FT                   /translation="MSCTDVEPPWRRGKSRSQGRAAHDRSTGASRCPANIAKPMRLGSM
FT                   LREPGAHAFIGHRPGSSSGAPFVQRHLRSGFDAAVSGDTQMR"
FT   gene            318534..319397
FT                   /locus_tag="Bcep18194_C6789"
FT   CDS_pept        318534..319397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6789"
FT                   /product="beta-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6789"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05836"
FT                   /db_xref="GOA:Q39NY0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NY0"
FT                   /protein_id="ABB05836.1"
FT                   /translation="MRMSNLIAVLGLGAMGSAIATSLIAEGEKVVVWNRKAEKAQRLHE
FT                   LGARVADSATAACDQADVIVVVTATPIDLAADFEALGERMKGKTVVNLATGRPSEVQVL
FT                   DQIVRGAGAKFISGTIQCFPPDIGRESAVFLLGGDEKIWNEVEPLLRKIAPQSTYVSAR
FT                   PDVPNVLDAGLTGTFVFGAGAAFLEGLRFVVNSGISIDEIRDLIPTYIAGQTHFIEGLF
FT                   ESVAASDYQPRGADLDIYARATGLFQQAQEDIGQPPRILKALRERILASIAEGSGDRGY
FT                   AALFNH"
FT   gene            319418..320296
FT                   /locus_tag="Bcep18194_C6790"
FT   CDS_pept        319418..320296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6790"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6790"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05837"
FT                   /db_xref="GOA:Q39NX9"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX9"
FT                   /protein_id="ABB05837.1"
FT                   /translation="MSLQRLSSDSTPEDLANAVRQDGGAIVKNFLGSDLLAQIQRTLFD
FT                   TLQSAPNGVDDYFAGTQTRRVSRLFARTDWMAEVALHPLYLGAARNILQTPIKIWSGEN
FT                   QIDIAPDIQVGVTQAIQILPGQGLQPLHRDDSVWLWRHPNYGREARFQVMVAVSDFTAE
FT                   NGATLVIPGSHKWDDERSPKQEEAVSAEMSAGDALFFIGSTYHGGGKNTSDAPRTGLTM
FT                   SYDLAILRQEENQYLTLPIERVKRYPEELQRLLGWTYGTTFAGFVERNGQMSDPNDLLK
FT                   MKDFLEVGHFD"
FT   gene            320473..321690
FT                   /locus_tag="Bcep18194_C6791"
FT   CDS_pept        320473..321690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6791"
FT                   /product="Major facilitator superfamily, (MFS_1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6791"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05838"
FT                   /db_xref="GOA:Q39NX8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX8"
FT                   /protein_id="ABB05838.1"
FT                   /translation="MRARGRFDASSRFRIRANDKESIVNYEIKGIRKIALLYTGAVVWT
FT                   PTYLLPFNIEESMARFGLSESTAGWLASAVLLCLALSIIIFGRHMATLNKRTGALAAAA
FT                   LAVLSTCAMFSHNFYVFVAAKLVLGAALGVSCVCAYGVIAHVKHPEKVAAQVAVAMAII
FT                   FSCAMYVVPIVNVKIGNIGVDAVQLAVVVAALFFGAFMHPAVNASEENVAKDAIKSSDV
FT                   RGILLSAFFIYVSQTALMGFAAEVAATRGVEAEQLGILFMVNAAFQLPVGVAVNWLGDR
FT                   FGLFKPIAFGLALLIACSLGMYCVGGRWAFLVATALVSAGATLIAPYMVGALSQMDTSG
FT                   RSTATCASAINLGLAVGPAIAGMVFTVAGLRAVGWLSVGLLVVPIFLTSVAIRQFKSRH
FT                   SEAVIA"
FT   gene            321896..322585
FT                   /locus_tag="Bcep18194_C6792"
FT   CDS_pept        321896..322585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6792"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05839"
FT                   /db_xref="GOA:Q39NX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX7"
FT                   /protein_id="ABB05839.1"
FT                   /translation="MELKYYLYCLADLALITTSLVYGVKLLKRRNGLLGFEWLVTTFSA
FT                   SNLMLNALTGEHVFLSVSLFCDAFSRGFGVPVITIVGMMAVTHRHKPSLFTDVLYVVGA
FT                   LAGTVVVWTADFMVGPKPYFYLVMWSLFSVYLVYVVGKLLRIGDKRNAVSVIVALVATQ
FT                   IIASTYDFYHIPGDHDHMIFYIFALLSWSYLSVSLYYAYCALERAQEKATNFNRRYTLG
FT                   SLERNPQ"
FT   gene            complement(323198..324103)
FT                   /locus_tag="Bcep18194_C6793"
FT   CDS_pept        complement(323198..324103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6793"
FT                   /product="beta-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6793"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05840"
FT                   /db_xref="GOA:Q39NX6"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX6"
FT                   /protein_id="ABB05840.1"
FT                   /translation="MANTVTAQAISVIGLGAMGAALAEALLAADHRVTVWNRTASKSAA
FT                   LGEVGAQVAHSAAEAIDASQVVVVCVLDYGASDSLLRTPDVAARLKGKTIIQLTTGTPE
FT                   DAREASEWAREHDVAYLDGTIGCYPKDIGTSDGSILYAGSRSTFEALRPTLANLSGHAL
FT                   FVGERFGNAAILDGAVVGSFSLGAALGFLYGAAVCDAEGISLDTYLSLALARRPFVEDT
FT                   LQTCVQMIKKGNYSGSQATLDSWAAGIGQLVAYSQESGTDSSYPQEVLARLQQAVAKGH
FT                   GQHELAAVFECFRKPLANRG"
FT   gene            complement(324657..325925)
FT                   /locus_tag="Bcep18194_C6794"
FT   CDS_pept        complement(324657..325925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6794"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6794"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05841"
FT                   /db_xref="GOA:Q39NX5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX5"
FT                   /protein_id="ABB05841.1"
FT                   /translation="MDRLAKKNEWFARAEKVIPGGMYGHQSVKYLTEDFPLYFAKAKGT
FT                   HLWDVDGNKYIDYVCGYGTNLFGYGNERIEQAAALQLQKIDTATGPSEVMVQLAEALTQ
FT                   QVSHADWAMFCKNGSDATSMAMVISRAYREKRKILVARGTYHGASPWNVPYTTGITKED
FT                   RAHIVYFEYNDIESLNAAVKSVDGDVAAIYATPFRHEVLYDQFFPSIEYAKECRRLADE
FT                   QEALLVVDEVRTGLRLSRDCSWSDWGVHPDLSCWGKAIGGGYAIAAVLGSDKAREAATN
FT                   VFVTGSYWLSAVPMAAAIETLRLVRETDYLEHTKRLADKLRAGIAEQAERHGFELKQTG
FT                   PSVMPQMLFAGDDELVSRGRAWASEVIKNGAYLHPWHNMFFTASHTDDDIARTLEATEV
FT                   AFGAIKQKAVAVSRLDILDTVQR"
FT   gene            complement(326207..326647)
FT                   /locus_tag="Bcep18194_C6795"
FT   CDS_pept        complement(326207..326647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6795"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05842"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX4"
FT                   /protein_id="ABB05842.1"
FT                   /translation="MRADRVEHDPRRALPALRSAAFGLESARQFTGPCVDDSRARALRI
FT                   LPPARISLPLPCMDRASEHARTYHNLPQRNLPAEVHRRPLSAHPHLDHPASLLETLSGD
FT                   FHHADQVSPPLSARQPTAVVQLASSPITVACRARRKSIAVRG"
FT   gene            complement(327215..328090)
FT                   /locus_tag="Bcep18194_C6796"
FT   CDS_pept        complement(327215..328090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6796"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6796"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05843"
FT                   /db_xref="GOA:Q39NX3"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX3"
FT                   /protein_id="ABB05843.1"
FT                   /translation="MNANIQNIQDSLPTVSKQTSAQEIVSLMNQYGGVRIKNYLTQEQV
FT                   ANINREVDAPLERLREGSSHENELIKEFHGTYTKRLTNMVTHSKTFGDVLDDELFHELG
FT                   EVLYREESGDWWLSTAQVIDIGPGNTAQMLHRDVGNFPPLCALGINGPTVFTNLMIALT
FT                   RFTEENGATRIIPGSQNWDEDYFDSKGTPDMTIAAEMDAGDALLFSGKVIHGGGANVTQ
FT                   NERRRGLTIPMQPSYLTPEEAYPFIVDMDTVRRLSKRVQRIIGFRSQYPAGTPGLWQVD
FT                   YDDIATHLGL"
FT   gene            329000..329512
FT                   /locus_tag="Bcep18194_C6797"
FT   CDS_pept        329000..329512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6797"
FT                   /product="protein of unknown function DUF1452"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6797"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05844"
FT                   /db_xref="GOA:Q39NX2"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX2"
FT                   /protein_id="ABB05844.1"
FT                   /translation="MREANHPSRARPGTRDRASADPRAVMVRHPVTRAFERFASHVTVW
FT                   AGSPIAFGSAVALTVLWLVTGPFFHYSDAWQLVINTGTTIITFLMVFLLQRNQNRDSVA
FT                   MHLKLDELVAVTHAASDRLIGIEDASEEELRAMAQTYLDLAKRVAARDDKQDDGRDRKQ
FT                   ADHSSKS"
FT   gene            329922..330173
FT                   /locus_tag="Bcep18194_C6798"
FT   CDS_pept        329922..330173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6798"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05845"
FT                   /db_xref="GOA:Q39NX1"
FT                   /db_xref="InterPro:IPR021446"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX1"
FT                   /protein_id="ABB05845.1"
FT                   /translation="MPMGGKRAFKRHRFRCFRRGASFSDFAIHCQEGNAMHAFTNLSPL
FT                   VSLIAGILILVVPRLLNYIVAIYLIVIGLLGLFGGHFH"
FT   gene            complement(330190..330462)
FT                   /locus_tag="Bcep18194_C6799"
FT   CDS_pept        complement(330190..330462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6799"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05846"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NX0"
FT                   /protein_id="ABB05846.1"
FT                   /translation="MLDRPAAHGNVLACARHRLAAGEHGSAGNKRSPGALTPYASATVT
FT                   PEYFSVTFNKVKPLNPDEAAPADALLGRTRLTVPSDSVEVRVEHL"
FT   gene            330513..330881
FT                   /locus_tag="Bcep18194_C6800"
FT   CDS_pept        330513..330881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6800"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05847"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW9"
FT                   /protein_id="ABB05847.1"
FT                   /translation="MQADYFLSKRTDVYAQMVYQRGTKGAGLGASIYNGDINAFPSSKV
FT                   SQTAATVGLRHSFQASQVSSCIGGTNGLDSRFDGSHEQHLRTSTPMIRVSVRVRHRQGP
FT                   CRSLVELPSCRKFPRVVK"
FT   gene            331181..332803
FT                   /locus_tag="Bcep18194_C6801"
FT   CDS_pept        331181..332803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6801"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6801"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05848"
FT                   /db_xref="GOA:Q39NW8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW8"
FT                   /protein_id="ABB05848.1"
FT                   /translation="MEKIWLDAYPPEVPAEIDSGAYRNISALIEQSFSKFHANPAFACD
FT                   GKQITYGELDVLSRSLAAWLQSRGLERGARVAIMMPNVLQYPISICAVLRAGYAVVNVN
FT                   PLYTPRELQHQLNDSGAEAIVILDGCTATLDAIIAHTQVKHVLVAAQGNAAAAEQTPSP
FT                   HVKFDDAIEEGRRGKFVLASPSPDDVAFLQYTGGTTGVSKGATLLHRNIVANVLQTDVW
FT                   LKPARDWRPDVTQFITVAALPIYHIFALNVCCLLTMHTGGLCVLVPNPRDIGGMIQSLA
FT                   GYKVTSFPGVNTLFNAMLHHPEFSRLDLSNLLLANGGGMATQEAVARRWKEMTGAPIID
FT                   GYGLSETSPCVAINPVAGREFNGTIGLPLPSTEVSIRDDDGKELPPGAAGELCIRGPQV
FT                   MAGYWQRPDETAKVMTADGFFRSGDIASISEDGFVRIVDRKKDMILVSGFNVYPNEIEE
FT                   VVANHPGVFEVAVIGVPDEHSGEAVKLFVVRKDPELTFDDLMAFCKGQLTGYKRPKSIE
FT                   FRDSLPKSNVGKILRRELRVPNN"
FT   gene            complement(333297..333749)
FT                   /locus_tag="Bcep18194_C6802"
FT   CDS_pept        complement(333297..333749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6802"
FT                   /product="Thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6802"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05849"
FT                   /db_xref="GOA:Q39NW7"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW7"
FT                   /protein_id="ABB05849.1"
FT                   /translation="MTVTGFIPLPVASEIRPAPPLLSGTDATRSSIPACVRVDGHRSHL
FT                   RDPQHLKLHGLTVDDIGPWELNEAFACQVLYCRDKPGIGPARYDVNGGSISIGDPYGMT
FT                   GARLVGHALIEGKRRGARYVVVSMCVGAGWAQPACSKLSDGTRRCP"
FT   gene            complement(333746..336937)
FT                   /locus_tag="Bcep18194_C6803"
FT   CDS_pept        complement(333746..336937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6803"
FT                   /product="Cytochrome P450"
FT                   /EC_number="1.14.14.1"
FT                   /EC_number="1.6.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6803"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05850"
FT                   /db_xref="GOA:Q39NW6"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW6"
FT                   /protein_id="ABB05850.1"
FT                   /translation="MKSSSLVPQPPLKPVIGHLMEVLGPSPLAKMMDLARTYGPVYWFE
FT                   VFGQGYYVVSGQTLVDEVCDETRFQKCVHQSLLELRPAIGDGLFTAFGDEPNWAKAHRV
FT                   LMQAFGPLSIWSMFDKMVDIADQMFLHWERFGPETPVDVSDHMTRLTLDTIALCAFDCR
FT                   FNSFYREDQHPFVDAMVNTLSEAGKRELRPKLVSKLMVKRSRQFDADIEVMRSLATKMI
FT                   EDRRKNPHVNEESMDLLDRMLNGIDPVTGEKLDDENIVFQMITFLIAGHETTSGLLSFA
FT                   TYFLLKNPDILQKARDMVDEVVGSETPRIEHLARLRYVEQILMETLRIWPTAPGFAVKP
FT                   LADTTFGGKYAVSPDDIIMILTPMLHRDVSVWGEDVEAFRPERFAPENAEQLPPNSWKP
FT                   FGNGARACIGRPFAMQEAHLVLIMLLQRFDFSFADPDYELDVAETLTLKPAGFRVNVKP
FT                   RARGALKVPDTALHARSNAQSPSVAPVQSIAPGEDLSNLLVLFGGNTGSAESFARRIAG
FT                   DASRHGFHATCAPLDDFAGKLGGYPAIVIVTASYEGQPPDNAKSFVPYVEALDEGALDG
FT                   VHFSVLGCGNKQWARTYQAIPKRVDEALEKAGATRVHFRGELDSGGDFFGEFDRWYTEM
FT                   WNRFAISAGKEIPVIQHDDVALKVSFAGSSREKVLNLGDMAHASIVDNRELVDISVAGS
FT                   RSKKHIELKLPEAMTYRSGDYLAVLPRNAKNNVDRVLRRFRVSWDTQVVIEGTSSNPRL
FT                   PLGQAIGCGELFSSYVELAVPATRSQVSSLAAATRCPPEKVELERLSADGFECEILGKR
FT                   TTVMDLLERFGSVDLSLEKFLDMLPALKARQYSISSSPLWKADHVTLTVAVVDAPALSG
FT                   NGRHEGVASSYLARLNTGDSLSVAVRPSNARFRPPAEPDLPMILICAGSGIAPFRGFLQ
FT                   ERALQKQRGENVGTSLLFFGIDDPDVDFLYRDELDEWARCGVVEVMPAYSNRPEEGARF
FT                   VQDKVWLERERISALFSQGATVFVCGDGKNMAPAVRATLGRIYQETTGENDESASAWID
FT                   TMEREHGRYVADVFA"
FT   gene            337029..337658
FT                   /locus_tag="Bcep18194_C6804"
FT   CDS_pept        337029..337658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6804"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6804"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05851"
FT                   /db_xref="GOA:Q39NW5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW5"
FT                   /protein_id="ABB05851.1"
FT                   /translation="MPPDVSPNTADPRFQRSYDALVRAVTELLDDAPLNTLSIAQLVQR
FT                   AGVARPTFYQHFPDLQAAAQRAALVRLDNAFAFVEEQGKLLNQPNDAFIKSMEVETALI
FT                   LEHLHTHQSFYLTVFNDAATSAFFDELVTFVSGRILPPYEGVRTEAEQDCLTVLGGGLV
FT                   WTAVHWLRQGAARETPTVMAKRMAKTAVTILDAFGLTLGFTQAGAA"
FT   gene            338233..338421
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C6805"
FT   gene            complement(338591..339049)
FT                   /locus_tag="Bcep18194_C6806"
FT   CDS_pept        complement(338591..339049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6806"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05852"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW4"
FT                   /protein_id="ABB05852.1"
FT                   /translation="MATVNAVRRSKREIGKRPSLASNINPAHIERRRPDRRTTSATPCQ
FT                   SDIPGRIGRKHAVDFHLVIAHAFLLPRTGWVKRCKRTAQMHERNNFLEHSRIDLDGDHH
FT                   AGARSAPRIPLCRLRPHVVDGQPGRAQPVQAAGNLTGTGCQCHGEIPA"
FT   gene            339065..339925
FT                   /locus_tag="Bcep18194_C6807"
FT   CDS_pept        339065..339925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6807"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05853"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW3"
FT                   /protein_id="ABB05853.1"
FT                   /translation="MTKPSGRPAMQTSASKKTTVVFASVNQAIVDVSRQCPSAVRAAVG
FT                   LLLVASVLSGCAPLSASAPTDPQQQFAAEQRNANALYSKKVLAYKPMFENPGGYGRAQI
FT                   LEAYEAVLQQYSVAAIAYARTIYPQARQTLPPSLQPLPAPSGPVTLAVVNRDYEHVLGM
FT                   DVALWEMDMAANFGRPSRLPIPKYTGPVLIMPPAPPFPPLQDVRDPKFARLVSMTKKID
FT                   DAQKADLAREQGAIEQQYAEQAAWRARHPTGQYDNLDPRTGLPYAAPQQETQRWCMMNG
FT                   GRVPC"
FT   gene            340533..341135
FT                   /locus_tag="Bcep18194_C6808"
FT   CDS_pept        340533..341135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6808"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6808"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05854"
FT                   /db_xref="GOA:Q39NW2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW2"
FT                   /protein_id="ABB05854.1"
FT                   /translation="MRASKRQQVVDKAGELFSRHGFHPVGIDWIIAEADVARMTLYHHF
FT                   AGKDDLIKAVLEQRYTFIMESIAAKLGPMPHAAARLKGIFDWYGTWFRSPEFAGCLFER
FT                   ALAEFGATCPKVTDVAVRYRDDLLALMEQLLSEIVPRRQARQLAGVYVMLLSGATADAR
FT                   AIGDPRAAARAWQAAEMLLNESKVATESTRKARSRHA"
FT   gene            341545..342378
FT                   /locus_tag="Bcep18194_C6809"
FT   CDS_pept        341545..342378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6809"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6809"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05855"
FT                   /db_xref="GOA:Q39NW1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW1"
FT                   /protein_id="ABB05855.1"
FT                   /translation="MAAARPVAAIRPRASGQPDRGRPEPIPDFGTDVPPPAAMDQPKRI
FT                   LIVEDDADIADVLSLHLRDERYEVVHSADGAEGLRLLEQGGWDALILDLMLPGVDGLEI
FT                   CRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDA
FT                   LARDSRIDAGTLDVAGLAIDPIAREASVDGARIDLTPREFDLLYFFARHPGKVFSRMDL
FT                   LNAVWGYQHEGYEHTVNTHINRLRAKIEADPAEPVRILTVWGRGYKLAAPGQRDA"
FT   gene            342378..343883
FT                   /locus_tag="Bcep18194_C6810"
FT   CDS_pept        342378..343883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6810"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6810"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05856"
FT                   /db_xref="GOA:Q39NW0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NW0"
FT                   /protein_id="ABB05856.1"
FT                   /translation="MKLTLTQRLSLVFSVLLLACSGASAWLQIRANDMREQEVVQGLSR
FT                   DLAANIVNSVTHSAPLMDANGLRPDAVRTLFGQLMGVNPSVEVYLLDNAGRVKGDDAPP
FT                   GHVKRDRVDLAPVQRFIAGEPLPILGDDPRSPDARKVFSAAPLQRAGQPPSGYIYVVLL
FT                   GEAHDRLAARVDAGNVLRTTLWSMALVALLGLLAGLTAFSFITRPLRRLTDAMRRFDAN
FT                   GTPDTQPPVPRSRPGRRGDDIVVLESAFAQMADRIGDQWRALTHQDQQRRELITNISHD
FT                   LRTPLTSLHGYLETLSLKSDTLAETERRRYLSIALAQSAKVGRLAQALFELARLESGGV
FT                   QAEREPFSLVDLVQDVFQKFELTAQARGVTLHARIPPRVPVVSADLGMIERVLTNLLDN
FT                   ALRHTPAHGEVEVALEPRGDRVLVTVADTGEGIPAARRDGLFQRPQRPMSGGAVTSGGL
FT                   GLLIVHRMLALNGSSIRLVDRAGRGAVFEFALAVATPAVGDGH"
FT   gene            complement(343912..345012)
FT                   /locus_tag="Bcep18194_C6811"
FT   CDS_pept        complement(343912..345012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6811"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6811"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05857"
FT                   /db_xref="GOA:Q39NV9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV9"
FT                   /protein_id="ABB05857.1"
FT                   /translation="MPRSALLTPTTARAARLPDVEMTHALHQQRFTPAKLAVLLDVAAQ
FT                   AGLDPVAVLDGTGLTPAAVADPFTLTSPLQFLTAARNAVGRYDGSDLGVRVGHRLHVTS
FT                   YGMYGYAMLCSESLAHAFESAVKYHRLANGMLAIRWVEQGDTASWQFPDRHEVALPDLD
FT                   EPLYRFLIDMQFALHVTIIKDVMGAWCVPARAQFAQPQPTHAALLADALECPIAFDQPH
FT                   HVLSYPAAWLTRAPQLANPITAAQVSSHCASLLDELRSQAGITRRVYQELTRTPGQFPD
FT                   IDAIADILCITSRTLRRKLEAEGTSYSELLASVRKALAIDYLSTTTLSTEDIALALGFS
FT                   DAVGFRHAFKRWTGVTPNDVRRKRGG"
FT   gene            complement(345142..345597)
FT                   /locus_tag="Bcep18194_C6812"
FT   CDS_pept        complement(345142..345597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6812"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6812"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05858"
FT                   /db_xref="GOA:Q39NV8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV8"
FT                   /protein_id="ABB05858.1"
FT                   /translation="MPERISFGQLPARLLDVVLNVEEYANHTGHDFKLVELVRARVSQL
FT                   NGCAYCLDRHIKEGIHAGENPLRYNLLPVWHETPALYSPKEQAALRWAEALTLISEHAI
FT                   DDALVDATRAHFDRDELATLTLIVAQINTWNRLAKPFAWEAGVFQAG"
FT   gene            346134..347768
FT                   /locus_tag="Bcep18194_C6813"
FT   CDS_pept        346134..347768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6813"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6813"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05859"
FT                   /db_xref="GOA:Q39NV7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV7"
FT                   /protein_id="ABB05859.1"
FT                   /translation="MTKRHWTGSYGSIPAEIDPDRFPSVSALLDDAMHRYADRPAFHSY
FT                   GRTLTYADVDRLSTALAAYLQQVVGVRKGDRVAVMLPNVLAFPVAFVAVAKIGAIQVNV
FT                   NPLYTARELEHQLNDAGVEVAVVCGGSMGTFAEVVGGTRVRTVLSVGRGDLGVVDAPAG
FT                   TCDALPPGSIPLADAIAAGEALAFEPVALGGADLLLLQYTGGTTGLSKGAALSHRNLVA
FT                   NIEQFGAIVPAAREPGEEVVVTAIPMYHIFALTVNFLSYFAIGAQNWLIANPRDMDGFI
FT                   DVLKAARPTVFVGVNTLYAGLAGHPRLTEIDWSRLKLSAGGGAAVIDVISSRWKAVTGN
FT                   FIREGYGLSETSPVVSFNPQAIDSFTGTTGLPLPSTDVKLLDDQDNEVAIGSAGEICVK
FT                   GPQVMGGYWQKPDANAAAFTADGYFRTGDVGVFDEAGFLRIVDRKKDMIIVSGFNVYPN
FT                   EVEAVATGVPGVAECACIGVPDARTGEAVKLFVVLAQDAIVTEEQLVAHCRESLAGYKV
FT                   PKLIRFVDRLPKSTVGKILRRELSRTD"
FT   gene            347882..348940
FT                   /locus_tag="Bcep18194_C6814"
FT   CDS_pept        347882..348940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6814"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6814"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05860"
FT                   /db_xref="GOA:Q39NV6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV6"
FT                   /protein_id="ABB05860.1"
FT                   /translation="MTGSDSLSAQPGPAAGRALPSPSATVPISLVNGFLASAGVQRDVV
FT                   ERYLRGAGIPIELLGEPHARVTEEQFSTLYRTLAIDLDDEMPGIFSRPLRGGTLKYLCL
FT                   SLLDARNLETALHRFGQFFHILLDDFFVESKRDGLVAQAVLRPNDAIGPIGALGQELML
FT                   KLVHGVCSWLIGQKIPLLQIEFACPRPRHAVDHLYFFTGAVQFDCERTLMRFSADYLDA
FT                   PIRQSKRNLRKFLARAPGDWIFESFSEQLVCHRVRQYLSEALPDLPVIDQAAEHLHCSV
FT                   RTLSRHLAAEGTTFQVLKDELRRDIAIQRLTDTPDTIAAIGADIGFDDPSAFHRAFRHW
FT                   TGSTPGTYRRRA"
FT   gene            complement(349028..349675)
FT                   /locus_tag="Bcep18194_C6815"
FT   CDS_pept        complement(349028..349675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6815"
FT                   /product="protein of unknown function DUF330"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6815"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05861"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV5"
FT                   /protein_id="ABB05861.1"
FT                   /translation="MSFPIRARTIALGAGAVIALTACASNPVHYYTLVSPATATSTSTS
FT                   TTPTTAHAAAPLAINVLPVGIPAQLDQQQMVVRSGTGTAVILDNERWVAPLGDELRAAL
FT                   SSALVEQLGARNVTGLPRPSNQTVMSIRTQVRRFDAWPGSMAQFEADWVVGVQQDAPGT
FT                   RISCSTRLNEAAPGSYADMVRVQQRMIEQFAARIASTVRSFGNGRPACPSDS"
FT   gene            complement(349672..351342)
FT                   /locus_tag="Bcep18194_C6816"
FT   CDS_pept        complement(349672..351342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6816"
FT                   /product="Paraquat-inducible protein B'"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6816"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05862"
FT                   /db_xref="GOA:Q39NV4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV4"
FT                   /protein_id="ABB05862.1"
FT                   /translation="MNPASGPQGLEPHDPPVTRNRARLSLVWLVPLVAALIGLSMVIHA
FT                   WLSVGPEITITFNTAQGLEAGKTPVKYKDVVIGTVTAISLSDDSSHVVATVSFVKNARN
FT                   LIRDDTRFWVVRPRVGMSGVSGIDTLFSGAYIGMDTGRSENSRKAYTGLETPPTVINGT
FT                   PGTSFALRATDLGSLDIGSPVYYRHLMVGHVASYKLDMQSRDMNLQVFIDAPYDRLVTT
FT                   DTRFWNASGMDLSLDANGLKLKTQSVATIVGGGIAFATPEDSDAAAARAGRLFTLADNE
FT                   TAAMAVPDGPSQLIRLRFEQPLRGLAVGAPVEFSGIDMGKVVSTQLDFDRTTRRFQSIV
FT                   MVKVYPYRLGPVIEKLQKTEGNGNPRAAQFLAGLVEHGLRAQARTGNLLTEQLYISFDF
FT                   VKNAPKVPFDANATPLTLPTVPSTFDKLPEQLADIVDKINKMPLDSIGKHVDSSLTNLD
FT                   ATLKQVNGQLLPSTTRMLDQANQTFGTLRQGIADDGPLQENLTNTLTEVQRTARSLRTL
FT                   TDMLGRRPESLLRGTGADHAPSAPVAPSTSPVQQEPRQP"
FT   gene            complement(351339..351986)
FT                   /locus_tag="Bcep18194_C6817"
FT   CDS_pept        complement(351339..351986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6817"
FT                   /product="Paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6817"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05863"
FT                   /db_xref="GOA:Q39NV3"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV3"
FT                   /protein_id="ABB05863.1"
FT                   /translation="MSLPVRASQLGMVGCHACGLVCRTRTSAAQDAHSHGAEAERCPRC
FT                   GSALHARRSNSLVRAWALLIASLIFYIPANLLPVMRTTLLGSHSESTILSGVVVFWKGG
FT                   SYGIASVIFIASVVVPCTKFLAIGTLLVTTGRRSVSAMRERTVLYRAVELVGYWSMLDV
FT                   LVVAIICALVKFGPLSEIEPRAGILFFGMVVILTMLSAMSYDPRLIWDAEEA"
FT   gene            complement(351983..352630)
FT                   /locus_tag="Bcep18194_C6818"
FT   CDS_pept        complement(351983..352630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6818"
FT                   /product="Paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6818"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05864"
FT                   /db_xref="GOA:Q39NV2"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV2"
FT                   /protein_id="ABB05864.1"
FT                   /translation="MREQHESMDTFPTLIACEHCDSVYRRRALAPHEVARCERCSAVLF
FT                   RSSWLDIDRWLALAIAASVVFAIANLCPIMRISVQGLHSEATLWQSALALAHGFAAPIA
FT                   IPTALAIVVVPFLQIATLIWLLAFARAGHRAPAFGPLMRLLVALRPWSMIEVGLLGILI
FT                   AIIKLSSIMQIIPGAGLWATAVLMVLIPLIAGHDARQLWDWVVPVETSGGRP"
FT   gene            complement(352755..354329)
FT                   /locus_tag="Bcep18194_C6819"
FT   CDS_pept        complement(352755..354329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6819"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6819"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05865"
FT                   /db_xref="GOA:Q39NV1"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV1"
FT                   /protein_id="ABB05865.1"
FT                   /translation="MAIFELMIALLLAILVLHYVGHKLGLPPAVALIIGGGFIAFLPGL
FT                   PEVHIDPELVLVIFLPPLLMDSALGISLDHLRRHMLGVGALAIGAVLFTTVVVALVTHW
FT                   LVPSLPWAACAALGALVAPPDAVSARAALQQVKLPRRLLILLEGESLFNDATGLVLFRF
FT                   AVAAGVTGLFSPAEALGSFTLLALGGVLIGAVVGGAWVILMRHLDEDSLVIAASPLCAW
FT                   GSYLLAERFHVSGVIATVTTGLICAWFQHRVLSASARLYGTGFWTVTIFILEAFVFLII
FT                   GSSLHELIQRGDGLDAMLAEMGVPVLIVVVSVIVARFAWVYVSDAALILLRQLGVTRFH
FT                   PLGLADATVLSWAGMRGVITLALAASLPDSFPGRDFILVTAIAVILATVLVQGQTLGAV
FT                   IRWTGLAAPESDKPRLSMSEAEAVIAKVQYELMAKRAYNAAGELVHPMLLDIHKHKAED
FT                   MARYARHADEYKSELDARSDTVLELIAAGRTELMRLYRAGDIDEHTLHELTRDLDLEEL
FT                   RAISAKA"
FT   gene            complement(354467..355000)
FT                   /locus_tag="Bcep18194_C6820"
FT   CDS_pept        complement(354467..355000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6820"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05866"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NV0"
FT                   /protein_id="ABB05866.1"
FT                   /translation="MRAARYEMSNQANVSSSIDGDSRELERIDDPPVGCGKLIPIDAIE
FT                   PEQRWRHMMHALNTCSDGTRINRLRRDCVVDSRRKMPSGDRSKCSAAIDILDQPTASTV
FT                   VLSWRDSTGGHYGYQNWHKGFARRPGLCAMSGMPITPGDEIFRPSVRNGRPTNWSAMIL
FT                   AIHISCIDFARITK"
FT   gene            complement(355104..355361)
FT                   /locus_tag="Bcep18194_C6821"
FT   CDS_pept        complement(355104..355361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6821"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05867"
FT                   /db_xref="GOA:Q39NU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU9"
FT                   /protein_id="ABB05867.1"
FT                   /translation="MNACHGSRLRVAMIVGLLTIAVVLTIATGWFVVYGLLLAVSSAAT
FT                   DNPVAVVIRETPSYLMLAAVLLTALVATVVDLVRLARRTG"
FT   gene            complement(355358..356047)
FT                   /locus_tag="Bcep18194_C6822"
FT   CDS_pept        complement(355358..356047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6822"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6822"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05868"
FT                   /db_xref="GOA:Q39NU8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU8"
FT                   /protein_id="ABB05868.1"
FT                   /translation="MNPLILIAEDDPEIAEILDAYLAHDGFRTYRVGHGQAVLDVQPVL
FT                   KPDLILLDVRMPQKDGWEVLVELRRRVDTPIVIITALDREIDRLQGLRFGADDYITKPF
FT                   NPAEVVARIRAILRRLETASSGRFIKVGNLEIDTQSYLTTVRTDSGETGVSLTLTEFRL
FT                   LAHLAGSPNRVFTRSELIDACLADVDALERTVDSHISRLRKKLECAGASGTPEVMRGVG
FT                   YRLRSTQ"
FT   gene            complement(356161..357603)
FT                   /locus_tag="Bcep18194_C6823"
FT   CDS_pept        complement(356161..357603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6823"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6823"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05869"
FT                   /db_xref="GOA:Q39NU7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU7"
FT                   /protein_id="ABB05869.1"
FT                   /translation="MRSLILSAAVSAALALSACSMAPKLVKPEMPVPTAYTTAAAADQH
FT                   ANAADLGWRTMFGDRRLQRLIELALENNRDLRLAALNVQAAEAQYGIQRSARLPSIGAG
FT                   ASFTRQRTAADSQSNPPLLENTQNQYGVNVGLSAFEIDLFGRVKSLSDAAFARYLATDH
FT                   GRRAVQIALVGSVANAYFAERLAQEQRALSERTLNDWRQSLDLARRLKLADQASGVDIA
FT                   QAEGQVASASADLEARSRAVEQAGNALRLLVGTDLPKNLPDPLSLERQPVMTQLPAGLP
FT                   SELLYRRPDIQQAEQNLVAANADIGAARAAFFPRLSLTSSIGFLSPGLGSLFDGGQRVW
FT                   SFAPQVTLPIFQGGRLRSELNLAEVRKSSAVVEYERSIQTAFREVADGLAGRETFSRQI
FT                   DAQSRVVKSAERRTDLVNLRYRAGIEDRLELLDSQRQLYAARQALLDLRNAELDNAVAL
FT                   YKALGGGLTDTDVPPANNVANN"
FT   gene            complement(357608..360751)
FT                   /locus_tag="Bcep18194_C6824"
FT   CDS_pept        complement(357608..360751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6824"
FT                   /product="Hydrophobe/amphiphile efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6824"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05870"
FT                   /db_xref="GOA:Q39NU6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU6"
FT                   /protein_id="ABB05870.1"
FT                   /translation="MSQFFIRRPVFAWVIALFIILLGLIAIPELPVARYPSVAPPTVTI
FT                   TATYPGATPQTMTDSVLSLIERELSGVRNLLYFESASDTSGQAKITATFKPGTDSAMAQ
FT                   VEVQNKLKSVEPRLPPVVRQNGVIVESASTGFLLFVGLKSESGRYDENALADYMARNVV
FT                   EDLRRVEGVGKVQLFGSEQAMRIWVDPQKLITYGLSMNDLTTAVAQQNVQIAPGSLGAA
FT                   PALPGQRVTVPLTAQGQLTSPEQFAKIVLRANANGSKVVLGDVARVELGPQSFTFVNSE
FT                   NGKPATFAGVQLAPGANAVKTAEAVREQLDMIAKTMPAGMTYSIPFDTAPFVKISIEKV
FT                   IHTLIEAMVLVFLVMYLFLQNVRYTLIPAIVAPVAMLGTFTVMLLTGFSINVLTMFGMV
FT                   LAIGIIVDDAIVVVENVERLMVEEGLSPKDATIKAMKEITGAIIGITLVLTAVFLPMAM
FT                   SSGSVGVIYQQFTMSMAVSIMFSALLALTLTPALCATMLKPVEHGHHEKRGFFGWFNRR
FT                   FDRMTNWYETRVGKLVGRTGRVMLLFVAISTALVFGFRMLPSSFLPEEDQGYFMTGFLL
FT                   PSDSTVERTGDVVKTLEKHLASRPGIESSISIIGYGFSGLGSNAALNYAVLKDWDKREG
FT                   ATAMDEAMRAQAAMGGVTEGTVMSLLPPAIDGLGTSSGFTMRLQDRANQGYAALKAAEA
FT                   KLLELAAQSKVVTGVYPDSLPAGTSVKLDIDREKAEALGVSFTTISDTLSAAMGSTYVN
FT                   DFPNAGRMQQVIIQADAPARMQIENVMKLYVRNATGGMVPLSEVVRPVWSETPLQLVRF
FT                   QGYPSARISGGSAPGYSSGAAMAEMEHLAAQLPPGFTVAWTGQSLQERESASQAPMLMA
FT                   LSMVVVFLVLAALYESWAIPLSVMLVVPLGLIGALGAVMLRGMPNDVFFKVGMITVIGL
FT                   SAKNAILIVEVAKQLREEGMGLIESAVQASKLRLRPILMTSLAFGLGVVPLMIATGASA
FT                   ETQHAIGTGVFGGMVTATVLAIFFVPVFYVFVMSIQERISAWRASGKKPATVTHEHEG"
FT   gene            complement(360772..361929)
FT                   /locus_tag="Bcep18194_C6825"
FT   CDS_pept        complement(360772..361929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6825"
FT                   /product="Secretion protein HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6825"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05871"
FT                   /db_xref="GOA:Q39NU5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU5"
FT                   /protein_id="ABB05871.1"
FT                   /translation="MKNQKRACYGAVCALVAAMLAGCGPSEQQAAAPATPVAAMTLAGA
FT                   PLDLTEDLPGRVAAVRIAEIRPQVSGIVQRRLFSQGTEVREGQPLFQINPAPFKADMDT
FT                   AAAALQRAEAALARAKVQTTRLKPLVEADAISRQVYDDSVSQRDQAAADVAQARATLAR
FT                   RQLDLKFATVEAPITGRIDQALVTEGALVASSDSQPMARIQQIDQVYVDVRQPAASLES
FT                   LRGALAAQPDTAGNGLPVDVLRDDDSRYDVKGRMLFSGVNVDPGTGDVLLRVLVDNPKR
FT                   ELLPGMYVRARIPRGHYENALTVPQQAIVRAGGKPQVWVLDAKSQAHLKAIEVGELTNR
FT                   SYRIKSGLQAGQKVVVEGMERLSDGATVTATAWKAPEAVKTASSH"
FT   gene            complement(362350..363489)
FT                   /locus_tag="Bcep18194_C6826"
FT   CDS_pept        complement(362350..363489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6826"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6826"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05872"
FT                   /db_xref="GOA:Q39NU4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU4"
FT                   /protein_id="ABB05872.1"
FT                   /translation="MKLSGLGRKIAVSMAELALGIMLVVVLMVYGFYYVMFRHWSEVCY
FT                   QSSWFPSNSEWLWLGTTILIGLVIAIIVSTRLAHRILVPLNSVADSIRRVAKGDLTARA
FT                   VAGDRSIREAALIADDFNALAAQLQRMTDEQAFWNAAIAHELRTPVTVLRGRLQGLAEG
FT                   VFQPGEALFRSLLTQAEGLTRLIEDLRVISLAESGHLSVSLQATDLTTHVKAVVEMFED
FT                   SLAAAGQHMVLDLDMRAVHCDPFRMRQALLALLENARRYAVPGAIRIHTRVENGACHLQ
FT                   VEDEGPGIPADYAAQIFDAFRRVDDADSSQKGGSGLGLAVVAAIAQAHGGAASCRPTVR
FT                   GGTVFELRWPDSPASPRIAPSNRKDAPSATQRAVDTDPR"
FT   gene            364222..364920
FT                   /locus_tag="Bcep18194_C6827"
FT   CDS_pept        364222..364920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6827"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05873"
FT                   /db_xref="GOA:Q39NU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU3"
FT                   /protein_id="ABB05873.1"
FT                   /translation="MMDFRSPDIGLSVALLAWATGTYGLKFVRKRNPLLGVAWWVVTAS
FT                   SVNALVFMATGWSCASGVAHFLDTFTRGFGIPVIAAAGMMAVTHEYRPMAQQVVMLCGI
FT                   AAVGTMALMTLEFVDVVLPYFYVAMWALLALYLAYFVVRLVRAGEAWHAMTTTLALVLS
FT                   LIVAYVDDLYKMPGNAHGAVFSFPVLALLTWSYFAVAIYYAYCALDRTRHVERAGAARL
FT                   LRWHEFTSFE"
FT   gene            364931..365608
FT                   /locus_tag="Bcep18194_C6828"
FT   CDS_pept        364931..365608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6828"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6828"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05874"
FT                   /db_xref="GOA:Q39NU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU2"
FT                   /protein_id="ABB05874.1"
FT                   /translation="MSEDLAKCGINVEDPSAHAVRATPRRGKKGDGETRERLLRAARTI
FT                   FAEKGYAAASIERIAIEGGYTRGAFYSNFRDKTVVLLELLKRDHDDVGRELMRIVEACH
FT                   DREVTERAMHAYFRQRYRQPDACVMWMEAALLAVHDPSFRVRFAAFLNERRDRVAARAS
FT                   GRAEPSDGRLPLPVELLTLGLTGLGDDVLPDGASGRWHLTDAWIDAAVTRVFAGSPCGE
FT                   PMA"
FT   gene            365671..367149
FT                   /locus_tag="Bcep18194_C6829"
FT   CDS_pept        365671..367149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6829"
FT                   /product="Amine oxidase"
FT                   /EC_number="1.4.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6829"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05875"
FT                   /db_xref="GOA:Q39NU1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU1"
FT                   /protein_id="ABB05875.1"
FT                   /translation="MNRKPRPDAQTRRNLLRLAAVGAASLAAGEVSLAHAANAVTGNDG
FT                   VLDVAIIGAGLAGLTAARDLKRAGCESFVVLEARDRVGGRTYNHDLGGGRISEAGGQWF
FT                   GPGQTAIVDLARELKVDTFDTYYAGKTVFLADGARVAQDTQGTVGGNPVIAARLNAMAK
FT                   HVPSAAPWKAPNAAALDTMSLGAWLAQQGLTNEEKFSFSLAARLSLGTAPAQLGLLHYL
FT                   ATINSANSDYDQLESIKGGAQESRFVGGSQVLSIRMANELGERVKLSCPVRKIAGWNRE
FT                   VVELTTDQGVVRARRVIVALNPALCNQVVFDPPLPDGRAQLQRRWPAYAPMRKTVHVYD
FT                   RPFWRDDGCNGQVIPVNSPLLWAYDNSPPDGSIGVINGFIAPGALASDAKVAEQTLSAI
FT                   YAQALGDKALRPTQFHDYDWGKVDPWSLTCIHPIPPGFWTKWGEYLHPPVGRLIWSGTE
FT                   TADIWAGAMDGAVRSGHRAALQVLGALAHRTKEA"
FT   gene            367150..368028
FT                   /locus_tag="Bcep18194_C6830"
FT   CDS_pept        367150..368028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6830"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6830"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05876"
FT                   /db_xref="GOA:Q39NU0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NU0"
FT                   /protein_id="ABB05876.1"
FT                   /translation="MKRAWIIGVVVVAAVSAAGVLFGRDLYGYYRFGKALDREVDALKA
FT                   DAGPWPQPQETCFICHGPRGQSGNGGYPALSGQPAAYLEAQLRAFASDRRPDPSMGPLA
FT                   RGMDEQQMKLLAAYFARQAPVQNEKIRVDAALAARGMTVVQARSCVACHGAGLAGNERA
FT                   PRLAGQGEAYLADQLVAFRAGKRHDETGAMNGVAAALSDEDIRAVAHYLASIVPAHAAA
FT                   ATASTDRAPRLANHDEADLVKQITAIKTGNRADSASAMHAAVARLSGDDIRAVAYYLAN
FT                   VSSGHEGGSVR"
FT   gene            368289..368960
FT                   /locus_tag="Bcep18194_C6831"
FT   CDS_pept        368289..368960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6831"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6831"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05877"
FT                   /db_xref="GOA:Q39NT9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT9"
FT                   /protein_id="ABB05877.1"
FT                   /translation="MTVPIEQPTRKRRTSSAAPTGAQPEGLRAQGVRTRKLIVRVARKL
FT                   LLEGGALEFSQRAVAQRAGISVSNLQYYFPTRLAVLRAVMEPEIEAYLTELKRALESGA
FT                   SPRETLDALLGMALENAKDVKGTALWAHFMSFASIDPECARLIDEWYASLTQAITALVR
FT                   SVNPSLKAADGEHVAMLLVAMADGLALQYTMGRQTEGLDARFLASVYNLVEGKASGGKS
FT                   R"
FT   gene            complement(369086..369886)
FT                   /locus_tag="Bcep18194_C6832"
FT   CDS_pept        complement(369086..369886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6832"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05878"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT8"
FT                   /protein_id="ABB05878.1"
FT                   /translation="MSGACVEIPVDISSRFNVLGYPNGGYLTRLAAETLGGRSAHPDLL
FT                   SINASFLGHPVSGPATARIIDFGSTKSLSRATLSLMQDGDLKAFYVATFTDFSRTTGAS
FT                   ASHCAGPQLPVTPYHACVRIDTLAFPDPMRSFISQFNLRLAPGVLQNSVPESTATIEGW
FT                   ISLEDEASSTLASLALFADAFPPPIYNIIDRTEWQSVPTIEYAVHVKANPGPGPIHARF
FT                   LTKEVRNGLLVIDGELRDMDGRLVAESRQLAKFRGTFGTPSRAS"
FT   gene            370268..371866
FT                   /locus_tag="Bcep18194_C6833"
FT   CDS_pept        370268..371866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6833"
FT                   /product="Amine oxidase"
FT                   /EC_number="1.4.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6833"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05879"
FT                   /db_xref="GOA:Q39NT7"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT7"
FT                   /protein_id="ABB05879.1"
FT                   /translation="MAGAFRSVRNDVPNGPPIVRHPDGWLPSEFHCSSEHTMPKKSFPN
FT                   GAADLHRRQWLKYAGASAAVVGTLAIGARQASAGEGGPSGNAGDVLDVAIIGAGLAGLT
FT                   AARDLRQAGCESFVVLEARDRVGGRTLNYNVEGGYVTEVGGQWIGPGQTAVADLARELE
FT                   VGTFPSYYDGKTVILGGEGRVAVDLKGTFGTDEAISSKLSTMSRDVPSGAPWTSPRVGE
FT                   LDKLSVADWMVKQDIKPEDRIGWDGSCTLSGGAPPVKMGLLHFLSMINSASCDYTQLDS
FT                   IKHSAQETRFIGGSQILSTKMAAHLGDKVRLSTPVRRISNWDRDVVTLHTDHGDVRARK
FT                   VIMAIHPALCNQVQFEPPLPERRASLQRAWPAHSPARKTAMVYRRPFWREKGLNGHIFQ
FT                   AGGPVIWAYDNSPPGGEIGIINAFVRNAMLPSDRKAAQRMLTEIYAQAWGDDALSPVSY
FT                   HDHDWSRVDPWTITCVSAIPPGFWSAHGDGLHLPCGNLIWSGTETANIWAGYMDGAVRS
FT                   GHQGALQALNGLRRA"
FT   gene            371877..372533
FT                   /locus_tag="Bcep18194_C6834"
FT   CDS_pept        371877..372533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6834"
FT                   /product="Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6834"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05880"
FT                   /db_xref="GOA:Q39NT6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT6"
FT                   /protein_id="ABB05880.1"
FT                   /translation="MKKRILLAVAGLVAVSLVIFGPSLLNLYRLQQFVAASEDAYRADG
FT                   GPWPHQTDTCLGCHGDKGTSLEQGYPSLAGQPASYVAAQLHDFASGKRANPNMAPLAMS
FT                   LSETDIKSLSDYYARQPARRNRYFEADPQLAAQGKLLVEKAACAACHGARLTGQAQFPR
FT                   LAGQGHDYLLKQMDAFAAGTRTEATGTMQRVTAALSQKDREAVAQYLASLNPEQE"
FT   gene            372568..373257
FT                   /locus_tag="Bcep18194_C6835"
FT   CDS_pept        372568..373257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6835"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05881"
FT                   /db_xref="GOA:Q39NT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT5"
FT                   /protein_id="ABB05881.1"
FT                   /translation="MDTRTLVLCLASALLATTTAIYGWKFLKKRNYLLGIEWFIVTVSS
FT                   SNALIYFATHFELSGLISHFLDAFSRGFGMPIVAVAGLMAVTRGYKPSGWQDVALFAIS
FT                   AVGTVVLVSGVVGKALPYFYVAMWGLLTIYLAGFVRKLLAAGERFHAMTSTVAMVTSFA
FT                   IACIYDFYPIPGDAHNVVVNFYVFALVTWSYVTVVLYYAYCALERAGQAHDASRLRSTR
FT                   NGNRRLA"
FT   gene            373822..374655
FT                   /locus_tag="Bcep18194_C6836"
FT   CDS_pept        373822..374655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6836"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6836"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05882"
FT                   /db_xref="GOA:Q39NT4"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT4"
FT                   /protein_id="ABB05882.1"
FT                   /translation="MDDVKRRAFAEDGAVLIEGLLNEEQLAQCRRAFDWGIENPGPMAS
FT                   SMLDGTEFRSHVDNANPYAKQRLDELVDTLPLGRLFADLWGSKHAWYFAEELFLKQGGK
FT                   GARSLWHQDTSYLPWAGMHFGNAWISFEAVPKRNALEIVRGSHRGVRHDGTTFQNVDDP
FT                   TEPLHGGGVWPRMPDIEAERRADPGKYDILSWATKPGDVLLLHPGVLHGGGVVDPDFPD
FT                   RHTLVLRFFGDDATFSPLPDNSASGFTPAGILFVEEIASLKAGDPFRAPCFRQLV"
FT   gene            374674..375087
FT                   /locus_tag="Bcep18194_C6837"
FT   CDS_pept        374674..375087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6837"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6837"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05883"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT3"
FT                   /protein_id="ABB05883.1"
FT                   /translation="MATTSKRQPIIPPGFKAWYDTYHFAPATRVGDTIWVSGQVGIGAD
FT                   MRPGDGVQAQARIAFESLKAILVEAGASLADVVELMTFHTDLRAEVEAFGAVKDEYFPD
FT                   RYPSWTAVGVTQLALPELCVEVRAVAVVGSGAV"
FT   gene            375456..376817
FT                   /locus_tag="Bcep18194_C6838"
FT   CDS_pept        375456..376817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6838"
FT                   /product="protein of unknown function DUF1329"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6838"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05884"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT2"
FT                   /protein_id="ABB05884.1"
FT                   /translation="MKKHTIGTVSAIAAALLMMAGSAMADDLTAVGAERGASKDGSIPA
FT                   FAGRQEPQSGWEYGKTRGDFWKHRSEKPLYSIDAANVDKYASMLSPGQIALIKQRKGYR
FT                   MDVYPSHRECQLPEFAEQNTKTNLTAAKLASDGETLEAAVLPGVPFPQPKTGAEAILNY
FT                   ENRYRGIGIEWPLDVTTISPRPGGGEWIDGIGPQVFYFPSGKTGKSGPKDVDQLSLAAY
FT                   FSATSPAALAGQAFVQRQYFNKDSETYYYFPGQRRVRRMPAYTHDAPLIGFENQYLIDE
FT                   ANMFNGSIDRFNWKLVGKRDMLVPYNAFGMYKFKSKLHDVATPDGIASANRRYEMHRVW
FT                   VVEATVKPSARHVASKKVFYLDEDSWLALIGEDYDAQGKLWKVRESYPIPVWELGGTCD
FT                   NEPMAQYDLLNGRYVMDSSTIGQGKDIRWYQEINDPRFKSDFFTAESLRSVSER"
FT   gene            376896..378737
FT                   /locus_tag="Bcep18194_C6839"
FT   CDS_pept        376896..378737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6839"
FT                   /product="protein of unknown function DUF1302"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6839"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05885"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT1"
FT                   /protein_id="ABB05885.1"
FT                   /translation="MKASNIVRHTTVSIAMLGAATSTAYGYEFTLGDGSVQGSWVSNLT
FT                   AGGGIRTKSPSCSLTGDPNAYGCGAAANTNQWGYGDEGDLNYRKGQPFSTYVSATSELL
FT                   LKMPSEGLKFMVRGTGMYDFLAGRTARTPLSSTAAAQVVYNAQLLDLWAQKDFTINGHS
FT                   AHVRLGNQVINWGESMFAQSGINATNSLDTQKLLIPGSQLKQALLPAPMLSLAADLSHG
FT                   FSTEAYYQFQWNGNRIPPVGSYWSLANVVGRGAEPFTINANNPNLVGPGVGTIANAIGG
FT                   GAAAGNQDTLNAIKNGLVNGAFAGPPFNDLGIPVSTQLPAKYRPQFGVKFNYSPRSFDA
FT                   NFAFYYLNYTDKSPVLSTLANGTAQWSYLQNRQLFGASANFGIGPWAIGTELSYRPRDA
FT                   VALSSCYGAGGPTDLITNGVQGVNCQQWADKKKLQLDVNGLLALTRSEYPFLKLIAADS
FT                   ATLTWELTWIYYPGLGSDVTRTVGGQPVTQVPAAGYFPWLNNNSGLGYPITQGQGTSSS
FT                   VGATIDFNWTYDGSLIPGWQVTPGVTFSTGLYGYTPTFTANYMQGAKSVNVYVLFNQNP
FT                   PTWQAGINFAAFFGGHQSVGNPYADRNFIGVFATRNF"
FT   gene            378801..381161
FT                   /locus_tag="Bcep18194_C6840"
FT   CDS_pept        378801..381161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6840"
FT                   /product="exporter, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6840"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05886"
FT                   /db_xref="GOA:Q39NT0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NT0"
FT                   /protein_id="ABB05886.1"
FT                   /translation="MLNRLVSRLERLFFGHRAIVLAAIGLFTVAMAVFAMQLRMDAGFE
FT                   KQMPIGHEYIRTFQQYRNDLLGANRITVVVRAKHGSIWTPDGLTRLYKVTQAVTYLPNV
FT                   DRIGVRSLWTSNAFVNEITDEGFRAEPIISGTITPDQLTPEIVEKIRRATTLGGYVGTL
FT                   VSHGEDSAMITAELNERDSAGKVLDYVAFNHLLEQKIRQPFEDAGYDVQIIGFAKQIGD
FT                   IADGAKGVLGFCAIALLLTALAVYWYCHSVRFTVLLILCSLTSLVWQFGTLKLLGFGLD
FT                   PLAVLVPFLVFAIGVSHGVQQVNFIVREISHGHSSYEAARRSFSGLLIPGVLALITAFV
FT                   SFITLLLIPIPMVRELAITASLGVAYKIVTNLILLPVAASCFNFTKRYADSALKRGERR
FT                   SAWLRPLARIAQPKYAGATVALTLVVFALAAWQSRDRVIGTLQPGAPELRADARFNRDA
FT                   TAIAGNYDMGLDWLTVAIESTGKACDNPAVGLYEDDFAAAMRTEPGVVSVQSYSGMLRA
FT                   YNQGYNEDYPKMNVVPIDPENYGAVSVDVGRVKGFMEADCTMSAVHLFLTDHKATTINR
FT                   ILDDVKQYRASHPFPGITVRLAAGNAGVLAATNEEVADSELPMMLYVYGAILILVFLAY
FT                   RNWRAMIACCAPLSVATFIGYWFMKELQIGLTVATLPVMVLAVGIGVDYAFYIYNRLQV
FT                   HLASGQTIVKAVQHALLEVGVATIFTAITLAIGVATWSFSALKFQADMGKLLAFMFLVN
FT                   LLMAMTALPALASVLERRFPRRKPARAPGLFSH"
FT   gene            381191..382156
FT                   /locus_tag="Bcep18194_C6841"
FT   CDS_pept        381191..382156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6841"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05887"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS9"
FT                   /protein_id="ABB05887.1"
FT                   /translation="MIKTLVACIGLCAAAAAFAQSRGTVAEWAAKPAHAWPAPTHMMLT
FT                   DATRAGSRVVAVGDHGIVVLSDDDGKTWRQARRVPVAATLSAVAFADAQHGWAVGQWGT
FT                   ILATDDGGETWTTQRLDTSVDQPLFSVLFTSPQDGFAVGLWSLMLQTHDGGKTWAKVTL
FT                   PKPPGGGKADRNLYHAFGDRKGALYISAEQGTVLKSTDGGANWRYLQTGGKGSLWTGVA
FT                   LPDGRVVVGGLLGSLYQSIDGGERWTAVDSRTRSSITDLVAAGDGLIGVGLDGLVLKQP
FT                   AGAAPVEVAQRPDRATLTAALPARGGTPMLFSQDGVLTSR"
FT   gene            382213..383610
FT                   /locus_tag="Bcep18194_C6842"
FT   CDS_pept        382213..383610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6842"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6842"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05888"
FT                   /db_xref="GOA:Q39NS8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS8"
FT                   /protein_id="ABB05888.1"
FT                   /translation="MSNMQYGIQDDSTGQAMRFDTAQADRALRTYRPIGGWIERPDDLQ
FT                   PQLEGDVHADVIVVGAGFAGLSTALELTARGASVVVIEREFAGFGASGRNAGYLAGGQG
FT                   LEYDLFVKRVGREQAKRIVGFYDEGVAYVERKLVEHGIDCDYRASGIIRASVHPSQEKR
FT                   LREDMETGIALGSPAQFLDGAAMRARGIPPAFLFGCHFPGGGTLDPGKYVLGLRRAALV
FT                   AGVRLYENTALLDFDANETVRIRTARGSASAPVLVLATNAYTPQLGLLGNKVMPLRVSA
FT                   LETGPLSDAQLAALGWPNREGIVTPHFTMESHRLTARNTLLLTTKRLDYVYGSRTPNVP
FT                   DDAAYRALLATLHARFPQLGDVPVRACWSGYISVASDALPVVGATGAHGNVFYTAGCSG
FT                   HGVGTQSLIGQVLANRISGAESPLLDALTHRTPAMPPEPLRWCAIKAVLGMANLMDERV
FT                   NRHARRG"
FT   gene            383639..384349
FT                   /locus_tag="Bcep18194_C6843"
FT   CDS_pept        383639..384349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6843"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6843"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05889"
FT                   /db_xref="GOA:Q39NS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS7"
FT                   /protein_id="ABB05889.1"
FT                   /translation="MRAGTDCRNATLTTNTMTDTKAHHGGRSRRTPNAASTGSDLDGLR
FT                   AQGLRTRNTIVRVARELLLEGGPLTFSQRAVAAGAGISVSNLQYYFPTRLAVLRAVIEP
FT                   VIEAYLGELKGLIDSDASPDDVIERVLARSLRDAKDAQYVALFRHFLSFAAIDPECLKL
FT                   FDDWYGTLTREVAKLLRTVNPAFDAADSLHVATLLIAMADGLTLQTGTARLTQRLDAMF
FT                   MEIARCLIYDRQRD"
FT   gene            complement(384387..385571)
FT                   /locus_tag="Bcep18194_C6844"
FT   CDS_pept        complement(384387..385571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6844"
FT                   /product="putative regulator of polyketide synthase
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6844"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05890"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS6"
FT                   /protein_id="ABB05890.1"
FT                   /translation="MRQGAEIALNVQTEWLQELDKENVATSPTMSDPVLAAAVRRINRN
FT                   GLIHWATANLENPCAPVSRFLSADMLSSAQELVRRGLTDLVFVAARSSQSVVWQRWMDL
FT                   AFTLTQDPVELREFLAVSSRSIAAFIDTNMVGMAEFMRAEREARLRGTHADRRELVTQI
FT                   VEGTTIGAQEASRRLGYTLEQRHHAAIVWSEEADIELGLLERAADALAQCAGTRNALVV
FT                   VANTATLWVWTYHDGKPLDMPSLQRAINALPGVHMAVATAGSGMEGFRHGHLDALATQR
FT                   LLGRLHAGVGVVHADSMSLIALMTNHMESLQQFVTNTLGNLASADKSLRDALRAFLAEG
FT                   CSVTDAAEKTHVHRNTLLRRLERAESLLPRPLAQQRLHVAAALEVLHWIASDPN"
FT   gene            385781..387307
FT                   /locus_tag="Bcep18194_C6845"
FT   CDS_pept        385781..387307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6845"
FT                   /product="Flavin-containing monooxygenase FMO"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6845"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05891"
FT                   /db_xref="GOA:Q39NS5"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS5"
FT                   /protein_id="ABB05891.1"
FT                   /translation="MTVHTLPSTEHVDVLIVGAGLSGIGVARQLETDRPGTSYIILEAR
FT                   GATGGTWDLFRYPGIRSDSDMHTYGYGFKPWANKKAIAGADAILSYLRETATEYGIDRH
FT                   IRTNHKVIHASWSSAQALWSVDVERVDTGERKTIQARWFFSAAGFYHHDEGHTPKLDGI
FT                   EQFSGPVVHPQHWPEDLDYGGKRVVVIGSGATAVTLLPAMAGKARHVTMLQRTPTYVVS
FT                   LPSEDIIANTLRKVMPHTWAYALVRRKNIAIARFIWHFCRTRPKTARRLIRFMTKRQLP
FT                   KGYPVDVHFNPPYNPWDQRLCAVPDGDLFKSIRDGHASVVTDRIKTFTETGIVLESGQT
FT                   LPADIIVTATGLNIRFFGGIKLTVDGEPVDLHSKVAFKGMMLSGVPNFAFSIGYTNSSW
FT                   TLKVGLLAEHFCRVLAHMERGGLATCVPELPAADMPTRPLLDFGAGYVQRAIGSLPRQG
FT                   PGVPWVMSMDYHLDVEILRHGSVEDPCLRFRRAAAAGGTDRVEPRRAVGA"
FT   gene            387310..388266
FT                   /locus_tag="Bcep18194_C6846"
FT   CDS_pept        387310..388266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6846"
FT                   /product="Alpha/beta hydrolase"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6846"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05892"
FT                   /db_xref="GOA:Q39NS4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS4"
FT                   /protein_id="ABB05892.1"
FT                   /translation="MTIHTMEASQDAFCDLPGGVRLCYRIYGPVHGEPLLLIAGMTLQL
FT                   TFWPPALIDALIQCGYRVIVFDNRDVGRSSRIPRPGPSVLRQFLRWPVKDGYDLEDMAQ
FT                   DTIGLLDSLQLKRAHVVGMSMGGMIGQVLAARYPQRVLSLTSIISTTGARKVGQPAMSS
FT                   MLMLTAPPPRTREAAVEQYSRIMAHIGTQAYPADDAARRAYAAHAWDRGQQARDHESTT
FT                   RQIGAIIKSGDRTDEIRRIQAPTLVVHGDRDLLVAPSGGIATAAAIPGADMVTVRGMGH
FT                   DIPDGVVPLLTSLIDGHIRRRATRAAAEPVRTGRHIA"
FT   gene            388471..389892
FT                   /locus_tag="Bcep18194_C6847"
FT   CDS_pept        388471..389892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6847"
FT                   /product="Aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6847"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05893"
FT                   /db_xref="GOA:Q39NS3"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS3"
FT                   /protein_id="ABB05893.1"
FT                   /translation="MHQGYPTDLAARFERQRRAFALELNPALATRLARLDRLAAWLDAH
FT                   EHDIVRAIDADFQGRSTHETRLAEVFIVRAGLRHARRHLKHWMRARRVPTALHFRPGHN
FT                   RLMPQPLGVTGIISPWNYPLQLSLGPALAALAAGNRVLIKPSELTPALSDLLVSMARDT
FT                   FAPDELDVVVGDVELGKAFAGLPFDHLFFTGSTQVGRVVAQAAAANLTPVTLELGGKSP
FT                   AILDASCNVAVAAQRIAFGKLLNAGQTCVAPDYLLVPTGTADSVALQLTRAVARLYPTL
FT                   AANPDYTAIISERHRARLTEMVDEARRAGARILEVNPAGETFGSSSRKFAPTIVIGAPA
FT                   DTRLMNEEIFGPVLPIVEYANLDDALAYIQGRARPLALYWFGEDASRRDRVLRETVSGG
FT                   VTINDCLWHLVQENQPFGGVGQSGMGAYHGQWGFDTFSKLKPVFHQTRWNGAVLFHPPY
FT                   GRVFDLLLRTLSRLA"
FT   gene            389922..391592
FT                   /locus_tag="Bcep18194_C6848"
FT   CDS_pept        389922..391592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6848"
FT                   /product="Glucose-methanol-choline oxidoreductase"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6848"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05894"
FT                   /db_xref="GOA:Q39NS2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS2"
FT                   /protein_id="ABB05894.1"
FT                   /translation="MNHQFDYIVVGGGSGGSVVAGRLTEDPDVSVCLLEAGGSGDGAVI
FT                   NIPAGMVAMLPTRLNNWAFKTVPQRGLDGRIGYQPRGKALGGSSAINAMVYIRGHRSDY
FT                   DTWAALGNPGWSYDEVLPYFRLSEHNERIDDAWHGQGGPLWVSDLRSDNPFQARFLAAA
FT                   RQAGLPLTDDFNGVQQEGAGIYQVTQKQGERWSAARGYLFPHLGKRANLAVETHAQVRR
FT                   ILFEGKRAVGVEVLQNGTLKTFRARREVVLAAGALQTPQLLMLSGVGPSDELTRVGIET
FT                   LHHLPGVGRNLQDHPDFILSYRARSLDTMGVSVGGSLRMLREIMRFRRERRGMLTSNFA
FT                   EGGAFLKTQPGLDAPDIQLHFLVALVDDHARRMHLGHGLSCHVCLLRPRSRGSVALRSR
FT                   DPADTPLIDPAFLDDPRDLEDMVAGFKITRGLMEAPALAEWTTKDMFTRDVHSDDEIRA
FT                   VLRKRTDTVYHPVGTCRMGPDAMAVVDPQLRVHGIDGLRIVDASVMPTLIGGNTNAPTI
FT                   MIAEKAVDLMRGVSRVASAAHATAAETHRFTTSGVETGR"
FT   gene            391650..393410
FT                   /locus_tag="Bcep18194_C6849"
FT   CDS_pept        391650..393410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6849"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6849"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05895"
FT                   /db_xref="GOA:Q39NS1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS1"
FT                   /protein_id="ABB05895.1"
FT                   /translation="MQPRDDASRRSPLSPAVLTKSCRTMSAIRSPFWPAHLATRQAPPA
FT                   THLFRHAEAAAARHPDKPFILFYDTPVSFARFQHEAEQVAGFLQQRCGVKAGDRVLLYM
FT                   QNSPQWMIAYYGILRANAVVVPVNPMNMTDELAHYIEDSGASTVFVAQDLYPRIAPLVG
FT                   GAGGLAHVVVATYGDYVAQPSAVAFPDFVAAPRHVDGPGVAHWRDVLAEQLAPGALTAG
FT                   PDDMCVMPYTSGTTGKPKGCVHTHRSVTCTAAGFVDWFDDPEDAIHLAVLPLFHVTGMQ
FT                   GGLNGPLVRGSTVVVLPRWDRDAAGRAIGRNRVTVWQSISTMMVDFLSNPNLHEYDLSS
FT                   LRSMRGGGAAMPDAIARKLKDTVGLDYVEGYGMSETIAATHINPPAHPKPQCLGIPVFD
FT                   VDARIVDPVTFEPVPQGEVGEIVMHAPQLMQGYWRNPEATKQAFVEIDGKRFLRTGDLG
FT                   RIDADGYFFMADRLKRMINASGYKVWPAEVETMMYRHPAIKEVCVIGTRSAHRGETVKA
FT                   FVVLDPAYPGGVTPDDVVAWARDHMASYKVPRVVEFVESLPKSGSGKIMWRELQEREEA
FT                   AAAAQGNAAA"
FT   gene            393421..394269
FT                   /locus_tag="Bcep18194_C6850"
FT   CDS_pept        393421..394269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6850"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05896"
FT                   /db_xref="GOA:Q39NS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NS0"
FT                   /protein_id="ABB05896.1"
FT                   /translation="MRHAGLGYTGYTGCRRRATGPVTSYRMVLHAGTGHGVRRKRMRND
FT                   SCKVTRFTAWSAIVGGLLAYANVGLVSMVAGTDTGMLLHGATMLSLPAETRDLFRLSML
FT                   ADVFGFYLAVLVIGGYFVHTFKEELGALGTMIAFGIGAYALLGITGAALQLSVLDPLAH
FT                   MYAGGDDATRAAAAAAWATVANGTQSGLWWAEGPLVFFWAPIVANHLKKAGWHGSFLLK
FT                   IVAWFFAIIFVSGFFPEFEAVTGVGEIVVVLLLPLWMMGFGWQLLRRAGRHVKAGAMVA
FT                   G"
FT   gene            complement(394474..395214)
FT                   /locus_tag="Bcep18194_C6851"
FT   CDS_pept        complement(394474..395214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6851"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6851"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05897"
FT                   /db_xref="GOA:Q39NR9"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR9"
FT                   /protein_id="ABB05897.1"
FT                   /translation="MRYPTLTITGSHTLASCPSRLPDPGEILLWRLRGEWQLVTSERGH
FT                   LYLSKTELRRARTHPNRVHGRRFAIGRSALRAILGTLAGRAADELTLIDRDADHIAVAG
FT                   CDLLDGLDVVVGHAGIWIVIAIARGPIGLGMAQTSALADPVSRDQLRLDSISNACGSGH
FT                   GATLDSLAPLAGAFREVDTPHAGHWRLLDIPLSGLACAATVAARQMDRIHAVGWRGERK
FT                   DWLADRDRHLRAAKVRGEAALVTA"
FT   gene            complement(395267..395707)
FT                   /locus_tag="Bcep18194_C6852"
FT   CDS_pept        complement(395267..395707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6852"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05898"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR8"
FT                   /protein_id="ABB05898.1"
FT                   /translation="MPALNPNDFALHDIQLFPVCVFRAEHATPGYAPRWEGEIDTLMRH
FT                   GEPFVIVYVELDTDESHDDRKHRAVWLKQNKEALGAVCKALVSVEPDPDRRAEVAAQGE
FT                   VAVKAFGIPHHAVASFGQAVSLAARLTRQPSGNDARQAGQQA"
FT   gene            complement(395766..397241)
FT                   /locus_tag="Bcep18194_C6853"
FT   CDS_pept        complement(395766..397241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6853"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6853"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05899"
FT                   /db_xref="GOA:Q39NR7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR7"
FT                   /protein_id="ABB05899.1"
FT                   /translation="MRCPFPPSRLTCRARAFIAACTCALAACTTVGPDYVSPQSTHPPS
FT                   WSAPRDTVTTDPAQLQNWWRTFGDTQLDALVEQAIAHNQDLAIARQRLLQARAERDQIA
FT                   SRLGPTVTAGGNADALRSSRALDWPPGIGQSRTYRLGFDASWELDLFGGTRRAVESADA
FT                   QLDALDDDRHAILVSLLAELASDYAALRATQERLRIATDNVASLDATRRLTEQSNRRGL
FT                   GTSFAVAQARAELQLAQATLPPLHQDVARFAHAIGVLVGGFPETLRDTLSAPGATLPVA
FT                   PALPVTLPSDVIRERPDIRAAERRLAAATAQIGVARAEQFPHFAIPLSLGTTASLVQDL
FT                   FSGASVAWSVALDGTQTLYDGGRAKAGVDAARAAAEAARLAYEQRIRSAFRDVEDALVA
FT                   IGAARDQQAMLAAAVDSSQDAQSRATRLYRNGLGEYLSVLTAQRATYRARDALALSRLA
FT                   QVQGAIALYKSLGVGWRDAPPLAQAGAPRANAH"
FT   gene            complement(397253..398167)
FT                   /locus_tag="Bcep18194_C6854"
FT   CDS_pept        complement(397253..398167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6854"
FT                   /product="Secretion protein HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6854"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05900"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR6"
FT                   /protein_id="ABB05900.1"
FT                   /translation="MSLKPLTRSLLTLATVAVAIVLVAALWHAYVLAPWTRDARVSAHV
FT                   VRIAPEVSGTVVDVAVVDNQRVAKGDVLYRIDPQRFTLAVEQAEAQVAATAESMRQKRD
FT                   EAQRRTGLDDLVPREDIQRSSRAVSIAQAEHRKALAALDVAKLDLERTTLRSPVDGYVT
FT                   QLRLRHGDYAVEGKPGISVLDAHSFWITGYFEETKLRRIATGAPATIRLMGFDPLLSGH
FT                   VTSIGRGIADENGTLDELGLPAVNPTFSWVRLAQRIPVRIEIDQVPAGVLLAAGMTCSV
FT                   EVGERGHERTPRGRLASWLHAWM"
FT   gene            complement(398192..398386)
FT                   /locus_tag="Bcep18194_C6855"
FT   CDS_pept        complement(398192..398386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6855"
FT                   /product="protein of unknown function DUF1656"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6855"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05901"
FT                   /db_xref="GOA:Q39NR5"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR5"
FT                   /protein_id="ABB05901.1"
FT                   /translation="MLSEFPLAGIYLPPFFVYACATVPIYMAVRALLARLGVLRRVWHP
FT                   ALFEFAISLVLVATLILYF"
FT   gene            complement(398376..400478)
FT                   /locus_tag="Bcep18194_C6856"
FT   CDS_pept        complement(398376..400478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6856"
FT                   /product="Fusaric acid resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6856"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05902"
FT                   /db_xref="GOA:Q39NR4"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR4"
FT                   /protein_id="ABB05902.1"
FT                   /translation="MHDAADQTRAVAPPPRRLNRAAAALIARIDIFTPRGAYVARSVIA
FT                   AALALGVAYLLELETPYSAASTVLLVINPVQGAVIGKGVWRVVGTIAGMVVAFVLMGCF
FT                   AQQPLLFILGFAFWLGVCVAGMTLLRHFRASGTVVAGYTIGLATYGAMQHPELTFEHVI
FT                   GRGSTVAIGVLCMSLVSMLLGTRDVHAKLDALVTRVTADVARVIAAQRNGLAAAPADDK
FT                   RHALFAGIYGIDDLLALGKAESEDLAQRAAAVRHGMASLFGALAGGTPPLPADSPGAQA
FT                   VASLQPRLAAAWQAAADALGSGRGGAAHALALLADARESLRAALDGISLGDPRDDAALL
FT                   IAGERLIEQIDDYCAALDGLVELQRPRPGYRPARVRFYRDTGAALRNGVRSACAIAISG
FT                   AFWLATGWNQGDMMLLVVAPYCALLATAGNPAAGAQAFIKGTVLAVPAAFVCAFGILPR
FT                   IEGFPLLVIALALFWMPGIYATSVPKTALAGLAYLVAFNTLTGATNPFRPDVALFLNQS
FT                   VAWVLATFLTLLTFRLILPRNLATDATRLRRTIRDDTLALVAGKRVMAAGWQQRQQHRI
FT                   AQLGALLAGQPAAMTQASIEALAALHVGKELLRIRRGAARDGLPDAAQRRVRAGLAGLA
FT                   RHASAPARAARHARRAAHALAGLAAAQPGNTELKWLMAAFADVHVLLHTYAAYFTAVPE
FT                   RARDAQ"
FT   gene            complement(400579..401502)
FT                   /locus_tag="Bcep18194_C6857"
FT   CDS_pept        complement(400579..401502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6857"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6857"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05903"
FT                   /db_xref="GOA:Q39NR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR3"
FT                   /protein_id="ABB05903.1"
FT                   /translation="MAPDLNLLISLDALLEEGSVVGAARRMNLSPPAMSRTLARIRETV
FT                   GDPIFVQAGRKMVPTPRALELRGVVRETVERASQLLAPSAEIDLGTLDKQFNVRANDIF
FT                   VGLHSSRLLEEMARGMPRAMLRFMPEEDDIDDDALRSGRIDLFISASRRLGPEIRVQPL
FT                   FTTTFVGLARDDHPIFDDDITPERFARWPHIGVSRRGKSAGPIDDALAARGLARHVLLV
FT                   VPTPYAAIFALQASDLILPLPEHLARGAVRAGLGVRAFELPVPLETVLITQAWHPRFQS
FT                   DPAHQWLRRVVRGLCTGQPALHPAHA"
FT   gene            complement(401626..402153)
FT                   /locus_tag="Bcep18194_C6858"
FT   CDS_pept        complement(401626..402153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6858"
FT                   /product="Flavin reductase-like, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6858"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05904"
FT                   /db_xref="GOA:Q39NR2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR2"
FT                   /protein_id="ABB05904.1"
FT                   /translation="MMNTVDIAQQLKQAMRGVAATVTIVTTGGDGAAAAPCALTASSFT
FT                   SVALDPPTVLVCINRRASIHASITGHRRFCVNALRSCHVPLALACSTTGSDARFAHDAW
FT                   RTDAATGLPYLENAQTSFFCDTLEQVEVGSHSILVGRVTRVAMSDDVNPLMYVNGAFAA
FT                   VRSLPPDAGAGQ"
FT   gene            complement(402220..403482)
FT                   /locus_tag="Bcep18194_C6859"
FT   CDS_pept        complement(402220..403482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6859"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.14.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6859"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05905"
FT                   /db_xref="GOA:Q39NR1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR1"
FT                   /protein_id="ABB05905.1"
FT                   /translation="MPIPSGPTANPPMTPSLSLDTIVVGAGIGGLAAALALRRAGHRVT
FT                   VLEQSRAFREVGAGLQVVPNATRALRALGVLDRQRLAAVAPTATIRRRWQDGSLLGSFP
FT                   LGNEVEAAFNAPYWNAHRADLHAALLDAVRDPYTAGPPVAVLGGIAVRGLDACGPDGAT
FT                   LVDAAGTRWRADLVVAADGIHSTLRHALLGDDAPHYSGDDAYRALIDVDAIDPQSPVFE
FT                   IVKEPQVTIWLGPGRHAIHYWVRDRRLLNLVVIVPGDGSTRESWSSKGDRATLEAELDG
FT                   WDPRLVGLIRCASDLSRWSLHDRQPLTRWVWDSVCLLGDACHPMLPYQSQGAAQALEDA
FT                   VVLGRCVTGLASKEALGAALVEYQRLRIDRSARIQLASAGNGGVFHLPDGPEQQARDAE
FT                   LKSRRADFKSYHWTWADAYQL"
FT   gene            complement(403487..404545)
FT                   /locus_tag="Bcep18194_C6860"
FT   CDS_pept        complement(403487..404545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6860"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /EC_number="1.14.14.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6860"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05906"
FT                   /db_xref="GOA:Q39NR0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NR0"
FT                   /protein_id="ABB05906.1"
FT                   /translation="MKFGVSFLPDTGPADRPAADYYANALKLSTLGDKLGYAYVKMTEH
FT                   YLKPYGGYSPSPLMFLAAAAAQTKSIRLMTGGIQASFHHPIQLAAEAAQLDAISNGRLE
FT                   LGFARAFLPYEFDAFGIDLDSSKARFQQTIDATVRLLTEESVSEDTPFFRYRDAQSLPR
FT                   PTQQPCPPVWVAALLTPSSFEWIGERGFNLLMAAPPRKDALAKTQDMVALYRETFERHH
FT                   GHTGRRPQVAISIPLMIGTSDAHALALAEPRLRHHWRYFAEAAKSWEQVQSSAYQGYNE
FT                   AMKNKMGGMDTADLDATAVLGTPDTVRQRIRALEADLGLDAILWHIDYGAQPYELMSNN
FT                   LEVFARDVLPGL"
FT   gene            404819..405619
FT                   /locus_tag="Bcep18194_C6861"
FT   CDS_pept        404819..405619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6861"
FT                   /product="2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6861"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05907"
FT                   /db_xref="GOA:Q39NQ9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ9"
FT                   /protein_id="ABB05907.1"
FT                   /translation="MNALLSVSGKALRMRRVVRAASGKCLMVPLDHSLADGPIAHPQQL
FT                   RQLVGDIAVHGGDAIVVHRGRARFLSPDVLNDLALVVHLNGCTRYAEDVNAKTLFASVE
FT                   DALACGADAVSVHVNLGSKTESQQLLDLSRIATECARWSLPLLAMIYPRGPGLGDRPQT
FT                   ELIAHAANVAADLGADIVKLPYSGDAASMADIIAGSSLPVLVAGGAKLPEDEFVAFTSR
FT                   VMNAGALGIAAGRNVFAAPKAAPLIRRLSDAVHGVERRAAHLAA"
FT   gene            405672..406736
FT                   /locus_tag="Bcep18194_C6862"
FT   CDS_pept        405672..406736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6862"
FT                   /product="3-dehydroquinate synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6862"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05908"
FT                   /db_xref="GOA:Q39NQ8"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ8"
FT                   /protein_id="ABB05908.1"
FT                   /translation="MHRYPWIDLRALGAQAGAVAADAARAGVGRVVVAEADRDTFAAGA
FT                   AAQLAVSTAGVATLVDDAHAPLAGVRVRIDGAADFDAARTAIARHALVLIDYALATTVP
FT                   LERLLADAGDAACRIVVSLADPHGAAYLVRKHAQSPVDIAFAPRDAVALRSVLAACGEL
FT                   RAREPLKLKTFEVQRVEPLGVGLHAVIDGCSQLDGEECVLAGASATSMLLVVAAGAAHP
FT                   PGRPLTFGIDAGSAESFVFCGGDRARQLSLLRSGERILTVGAAGDTRAIVVGRVRIESA
FT                   PLVALHTRSASGANTRVVMRGDRAVRFRTDDGARVGLADVAPGIRLAGYEPGAGWVDCR
FT                   MRAAASRSVVSVSR"
FT   gene            406786..407886
FT                   /locus_tag="Bcep18194_C6863"
FT   CDS_pept        406786..407886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6863"
FT                   /product="3-dehydroquinate synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6863"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05909"
FT                   /db_xref="GOA:Q39NQ7"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ7"
FT                   /protein_id="ABB05909.1"
FT                   /translation="MKKLSWIDLRNIGELADEITEEALHVGVSAFVVKDAEQAGRLPPS
FT                   ACKVAVVDRQPADAALLEQVQIILVKDGLPVDFAVPDGVEIGVFIEVTGEATLTRACEL
FT                   STTTPWLLVEFLQDPSKIPLEILLAAADQASGELITVVADLEDAEVTLNVLQRGPEGVL
FT                   VSPTQVGQATQLVSICSDTVEDLQLEEIEIVGLTHLGPGERVCVDTCSRFEQDEGILVG
FT                   SYSTGMILISSETHPLPYMPTRPFRVNAAALHSYVVAPDNRTRYLAELESGAEILAVNV
FT                   QGKARRVVVGRAKVETRPLLLIEAKNAANRAINIIAQDDWHVRVLGPKGSVHNITELKR
FT                   GDRILGYTLDAQRHVGYPITEFLHEQ"
FT   gene            407964..408986
FT                   /locus_tag="Bcep18194_C6864"
FT   CDS_pept        407964..408986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6864"
FT                   /product="hydroxyneurosporene-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6864"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05910"
FT                   /db_xref="GOA:Q39NQ6"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ6"
FT                   /protein_id="ABB05910.1"
FT                   /translation="MENAAKQVLDTLFGRWRSRILYAGTRLGVFDAVTTDTPASSAALA
FT                   AKLDVDEPLLYRLLRALASLGLLDEDTRRGFRATASGALLHADAPSTLRDFVLLQEGPE
FT                   HYAIWAHLPDMVREGQQNGFVREFGAMAFDYAKDHERYRTDFKRAMSSFSTVQSEQVVD
FT                   ALRDVTFAPGTHACDIGGGQGHMLCSVLRRFQSLTGVVFDLPEVIDGDADDWAQRMGVS
FT                   ARCSKAGGNMFDAVPAADVYLLKLILHDWNDDECVAILKRARESARDGARVFVIERVVP
FT                   APGVAHFSKLYDIHMMCWGSGRERTRDEYDALLVAAGWRPAGVRPAPDGQIDVIEAVAA
FT                   "
FT   gene            complement(409011..409718)
FT                   /locus_tag="Bcep18194_C6865"
FT   CDS_pept        complement(409011..409718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6865"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6865"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05911"
FT                   /db_xref="GOA:Q39NQ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ5"
FT                   /protein_id="ABB05911.1"
FT                   /translation="MSSLPPATRHSLVDSAIEILKSNITSGIWRVGQRIPTELDLAKQL
FT                   EVGRNTVREAVRTLAYSGVLEVRQGDGTYVRRNVDPAETMRDVDRAARSDHLELQCMLE
FT                   TECARYAARRRTDEDLATLRKLLKARGEREASRDVKKFVERDRAFHIAVAAASHNHALE
FT                   ALYRYFSGSILANVEDILVELDEAEIPEPDMRSHQDVLDAIEQRDENKAVRATLAILKP
FT                   QMTWLETRETPAA"
FT   gene            410021..412267
FT                   /locus_tag="Bcep18194_C6866"
FT   CDS_pept        410021..412267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6866"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6866"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05912"
FT                   /db_xref="GOA:Q39NQ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ4"
FT                   /protein_id="ABB05912.1"
FT                   /translation="MNRSHTGRRARPGFPLPRAALRRVPSWAAALACATAMPVAVAAQD
FT                   APDAGEPAADASLLAPIVVDGRRETGVGPVQGIAADVSRAGTKTDTAIVEVPQGLSVVT
FT                   REQMDRQDVHSVGDSLRYTPGAYADSRPGGVLESVFLRGFGGFAAAAINPQMLDGLPLP
FT                   KGVNWAASVVDPWTLERIDVLRGPASVLYGQASPGGIVDMVSKRPTRDAQHLLAVQTGN
FT                   RDRGQLAFDFSGPVTKDGTWRYRIDGLARRADEQIDYSRQQRIVVAPSLTWQPNADTSF
FT                   TLLGSFQRDPHNNFAGWLPALGTLWPDSGRRIPTHFFPGLPGFDTYDRTQAMIGYAFEH
FT                   RFNSTWKVRQNVRYTHLDVDFAGAAVNFIAPYLSPGVLNRSLSWSREHVNHLALDNQAE
FT                   MRVMTGPVEHTVLAGLSYEHAVANLVGSGFGAAPPLDTRAPAYGQPFTVPPVAQQTRQT
FT                   PDRIGVYLQDQVRWDRWVFTLGGREEWSRTTTDDLLRSASVRQSTRAFTGRAGAVYLFD
FT                   SGFAPYMSYSTSFEPALGTRFDGQPFTPTKAKQFEVGLRYQSLDRLQNASIAAFDIRQR
FT                   NVLTADPEHPFFSVQTGEVRSRGIELEGRTRVWKQLDVIAAYTYLDTTVQADTDPTVVG
FT                   KRVAAVPRHLASLWLDYAVERPGLRGLRVGGGVRYVGRSAGDNVNTFDVPAVVLFDLGL
FT                   SYDLGVERPAWKGWRVAAHVNNLFDRTYVSSCFSAGGCFYGTRLMVTGDVSYRW"
FT   gene            412415..413329
FT                   /locus_tag="Bcep18194_C6867"
FT   CDS_pept        412415..413329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6867"
FT                   /product="Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6867"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05913"
FT                   /db_xref="GOA:Q39NQ3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ3"
FT                   /protein_id="ABB05913.1"
FT                   /translation="MSIVVRRKQIAILLCRVLISGALIASVVGCAATAVGDTSIAPDLH
FT                   ETVVKVPVDEGASTRDIVATTYMPDGPGPFPLIVLSHGSPPDPRDRPKVRRYRALPQIR
FT                   TFVQLGFAVIVPIRRGYGATGGVDEEDAGSCRHPDYLAAGQQAARDVLAAVRYAQTLPQ
FT                   VDRNRIVLVGQSAGGFASLAAASYAPQGVVAVVNFSGGRGGNPTTHPGMPCDPKQMADT
FT                   IGHFASTTRVPVLWHYVQNDKYFAPEVVATWFAAFQGAGGRGQMIVEPAFGSNGHGMFS
FT                   VKEAIPIWLPHFEAFVGPLVAMK"
FT   gene            complement(414380..415318)
FT                   /locus_tag="Bcep18194_C6868"
FT   CDS_pept        complement(414380..415318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6868"
FT                   /product="Alpha/beta hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6868"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05914"
FT                   /db_xref="GOA:Q39NQ2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ2"
FT                   /protein_id="ABB05914.1"
FT                   /translation="MKSLGLWLRRAGAALAFLLAFQAQSYAAAPVVTEHSLTVNGIGLH
FT                   YLEAGAGNGTPIVLLAGYGETSHMWLPLMPKLAVNHVVIAPDLPGAGASDIPAGGYDKK
FT                   TMAQDIHALVKALGYRDVEVVGHDIGLMVAYAYAAQYRDETRRLVLMESFLPGVGNWQS
FT                   YYYSPAKWHFAFYGETPLKLVQGRERIYLDHFWNDFAANPEHSVSEVDRALYTSIYAQP
FT                   GRMRAGFEWFHAFPQDIQDFQQFARTPLQMPVLVLTGQKAAGRFTIDQARVAAVNVQGE
FT                   VIEGVGHWLMSEAPDRTMGALVTFLNAGESR"
FT   gene            complement(415563..416642)
FT                   /locus_tag="Bcep18194_C6869"
FT   CDS_pept        complement(415563..416642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6869"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6869"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05915"
FT                   /db_xref="GOA:Q39NQ1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ1"
FT                   /protein_id="ABB05915.1"
FT                   /translation="MTFNAPTSLAYPARANLQGLFGFDSIRVPRYRLLDGATPIHPLPR
FT                   LSAYLGGATIHVKREDVASVGGGGNKLRKLELLIGEALQSGADTVITVGARQSNHARLT
FT                   AAAAAHAGMRCEVVLTRSVPRDDADYIESGNVLLDNLFNARVHDLPASADAMAYAIARA
FT                   DELRAAGHRVYVCPFGGSSPVGCLAYAACAAEIVQQSQALGTRFDRIIVPNGSGGTHAG
FT                   LVAGFAALGTGTVEVDAYTVYAPAADAYRATLDKAQQTANIIHPDTEISPDAVRVDASQ
FT                   LGPGYGIPTDAMRRAVRLLASQEGLLLDPVYSGKAFAGLIEGVASGRYASDQSILFVMT
FT                   GGLPGLFAYRREFQMALDG"
FT   gene            complement(416639..417667)
FT                   /locus_tag="Bcep18194_C6870"
FT   CDS_pept        complement(416639..417667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6870"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6870"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05916"
FT                   /db_xref="GOA:Q39NQ0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NQ0"
FT                   /protein_id="ABB05916.1"
FT                   /translation="MRDFTLKIAVLFGGASEERDVSISSAAQVIKALRSAGHSVVAIDT
FT                   ARGPLSPEEDALLLTSRIHDAPPPSRVSTRSPSAAFDLLRCRELTEADVAFLALHGGTG
FT                   EDGTIQAMLDLAGVPYTGSGHMGSAIAMNKDMTKRLFSSVGIRTPRWMMLPCDFDDIPR
FT                   RVGYPLIVKPNRQGSTVGLSLVHTPDELESAVRLARRFDTQVMVEQYIAGRELTVGVLG
FT                   AQALSVGEIVIEPGTIFDYRSKYQAGHVLEQFPATLPAATLEAAQRIALRAHALLELDG
FT                   YSRTDLRLDAQGILWCLEVNTLPGMTATSLLPQSAAASGIAFPQLCEQICLAGINRHQV
FT                   HA"
FT   gene            417952..418803
FT                   /locus_tag="Bcep18194_C6871"
FT   CDS_pept        417952..418803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6871"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6871"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05917"
FT                   /db_xref="GOA:Q39NP9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP9"
FT                   /protein_id="ABB05917.1"
FT                   /translation="MAAAAEALHLTPSAVSQQISQLEEEAGVKLTERVGRGVRLTPAGH
FT                   ALAGHAERVMVVLDEARSELAELRREMVGELRVAAFPSIASLVLPDVLKKLRPAYPRLE
FT                   IELEELEPIDAVAALRAWRTDIALIDDLSIKTDNDQENIEVVPLAEDVLYVAVASDHPL
FT                   SNMPSLGVADLRHETWAMESTWSTFGGFVIDLCRRAGFEPRINAKCRGSEMVEAMVASG
FT                   CSVSVAPGLRVLRAPPGVVWVKLKPEVRRKIYVAYRRGERNHPMIKVFLKEVVETVSSV
FT                   LG"
FT   gene            419197..420987
FT                   /locus_tag="Bcep18194_C6872"
FT   CDS_pept        419197..420987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6872"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6872"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05918"
FT                   /db_xref="GOA:Q39NP8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP8"
FT                   /protein_id="ABB05918.1"
FT                   /translation="MSYNAPVKDMLFVLKELAGIDAVAQLPGFEDAGYDTAQAVLDESA
FT                   KFCGEVLAPLNVEGDRNPSSWKDGVVTATPGFGEAFRQFVEGGWQGLQHPSEYDGQGLP
FT                   KLIATPCIEMLNASNLSFALCPLLTDGAIEALLTAGTDEQKQRYVPKLISGEWTGTMNL
FT                   TEPQAGSDLALVRSRAEPQGDGTYKVFGTKIFITWGEHDMADNIVHLVLARTPNAPEGV
FT                   KGISLFIVPKFMVNEDGSLGARNDVHCVSIEHKLGIKASPTAVLQYGDHGGAIGYLVGE
FT                   ENRGLEYMFIMMNAARFGVGMQGIGVADRAYQKAAEFAKERVQSRPVDGSARQSVTIIH
FT                   HPDVRRMLGTMRALTEGARALAYVAAAHSDIAHRHSDEATRARHQAIYEYLVPVVKGWS
FT                   TEMVNDVASLGVQVHGGMGFIEETGAAQYYRDARILAIYEGTTAIQANDLVGRKTMRDG
FT                   GAVAKALIAEIGETVAALGKLDSAAAASVKAQLEKGAKALSSVVDYVVANVKQDPNAVF
FT                   AGSVPYLKLAGVVLCGWQMGRALVAAQANRASDPAFFDAKIAIAQCYAEHVLVQAGAFE
FT                   ASIVGTKGNEGVLALTEDQF"
FT   gene            421024..422697
FT                   /locus_tag="Bcep18194_C6873"
FT   CDS_pept        421024..422697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6873"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6873"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05919"
FT                   /db_xref="GOA:Q39NP7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP7"
FT                   /protein_id="ABB05919.1"
FT                   /translation="MTTQDLLAQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGT
FT                   EIGVCVLEKGSEIGAHILSGAVMDPRAINELFPDWKERGAPLDVEVTEDRFLFLSEKGA
FT                   VTTPNWALPANFQNHGNYVISLGNVTRWLGAQAEALGVEIFPGFPAAEILYNDDGSVKG
FT                   VATGNMGVGKDGEPTENFQLGMELHAKYTLFAEGCRGHLGRQLISKFKLDANADPQAYG
FT                   IGIKELWEIDPAKHKPGLVIHTAGWPLKSDTYGGSFLYHMDNNQVVVGFVVGLGYTNPY
FT                   LSPFEEFQRYKTHPSIRAFLEGGKRVSYGARAITAGGLLSLPKTVFPGGALIGDDAGFL
FT                   NASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNVYPDAFKQSWLYTELYRARNFKQ
FT                   WMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCEPIEYPKPDGKLTFD
FT                   RLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPAAVYEFVKNDDGSD
FT                   RLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM"
FT   gene            422746..423939
FT                   /locus_tag="Bcep18194_C6874"
FT   CDS_pept        422746..423939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6874"
FT                   /product="acetyl-CoA acetyltransferase / 3-ketoacyl-CoA
FT                   thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6874"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05920"
FT                   /db_xref="GOA:Q39NP6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP6"
FT                   /protein_id="ABB05920.1"
FT                   /translation="MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVAEVLSRA
FT                   NVPGDAVGHVVFGHVVNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAA
FT                   QTIMLGDADIAIGGGSESMSRAPYTVPAARFGQRMGDGKLVDMMLGALHDPFQTIHMGV
FT                   TAENVAAKYGISRDAQDALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDSDEH
FT                   VRHDASADDFTKLRPVFKKEEGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLV
FT                   AYAHAGVDPAYMGIGPVPATQKALERAGLKISDLDVIEANEAFAAQACAVTQELGLDPA
FT                   KVNPNGSGISLGHPIGATGALITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI"
FT   gene            423978..424832
FT                   /locus_tag="Bcep18194_C6875"
FT   CDS_pept        423978..424832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6875"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6875"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05921"
FT                   /db_xref="GOA:Q39NP5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP5"
FT                   /protein_id="ABB05921.1"
FT                   /translation="MAIEIVGVVGAGTMGNGIAQTAAVAGLNVVMIDVSDAALEKGIAT
FT                   LKGSLDRLVSKDKLDAATRDAALARITTSTDYAKLAAADIVIEAATENVELKGRILKQI
FT                   EAVARAEAIIATNTSSISITALAAPLADPARFVGMHFFNPVPLMPLVEIIRGLQTSDAT
FT                   ASAVRELTERFDKSPIGVRNSPGFVVNRILVPMINEAFFVLAEGIASAEEIDAGMKLGA
FT                   NHPIGPLALADLVGLDVCLAVMDVFVKDFGDPKYRACPLLREMVTAGRLGRKTGRGVYD
FT                   YSK"
FT   gene            425117..427093
FT                   /locus_tag="Bcep18194_C6876"
FT   CDS_pept        425117..427093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6876"
FT                   /product="collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6876"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05922"
FT                   /db_xref="GOA:Q39NP4"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP4"
FT                   /protein_id="ABB05922.1"
FT                   /translation="MVVQKQPRENKVAINEGLQKTRRWSAIVAWSVFAGLAATASANTE
FT                   PAQPTQPRQARMPRVPQNLPVSPEQAQYNLPLSEQDRAALTRPSPLKQPATRSKRSTSG
FT                   ADCRDMSVMTQYRGAALADYIANLPDYECHYGLFSVDKVQATQIFNAENVHAAASRFVQ
FT                   EIHQYDASNLILVNLLIYLRAAYYQYDVSGIANPIPNLAVSLRPYIKQSLEGDALYRDN
FT                   ARAPSTANELMKLITNMRDEAFYLPTLKNRIASYTVSAANPQAAASLLQRSAAGGFTGL
FT                   LTVFFYAHQRSGAQPMLDGDATLPETLNRFVTANRASLSNTSAAYQLADAARETFRFLR
FT                   YPTQKPRVKKMIQDMLASTSMTGADSDLWLAAAEAVDYGDPGNCADYGTCDYKKRLTDA
FT                   VLSNRYACNAGVRILAQDMTMPQLQSVCTAVARQDDYFHRMMKTGRKPVAGDRNDTIEL
FT                   VIFDDYANYRKYASVIYGISTDNGGMYLEGDPSAPGNQARFIAHEASWLRPEFKVWNLE
FT                   HEFTHYLDGRYDMAGDFSVSTAKPTVWWIEGVAEYLSRKNDNQESIDAVRTGAYRFSDV
FT                   LGTRYASSDYVARAYRWGYMATRFMFERHRADVDTIVSRFRAGDYDGYANHVAFIGNRY
FT                   DTEFADWARNATTAGEPPVPAKR"
FT   gene            complement(427231..428142)
FT                   /locus_tag="Bcep18194_C6877"
FT   CDS_pept        complement(427231..428142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6877"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6877"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05923"
FT                   /db_xref="GOA:Q39NP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP3"
FT                   /protein_id="ABB05923.1"
FT                   /translation="MSTHITLRQIEYFVSVADTGQISQSANLCSVSQSSMTIALKNLED
FT                   MVGVTLLQRHSRGVRLTPAGERFLRHVQHATLSIDRAVVAAQEEPEQISGHVRIGVTET
FT                   ISAYLMPSLMSVISQRFGNLSVSIVESEREAIEDMLVDDRLDIALLLVSNTAEIRDLKY
FT                   ETMLRSPRRLWTHPDHPLQEAHRVTLEDVARENYLLLDMDEHLRTVGKYWGSYGITPNV
FT                   WMQSKSIEAVRSLVALGQGVTILSDLVYRPWSLEGNRISRRNLSVTVPTMDVGAVWRRG
FT                   GATSTPCRALLELFRSWKKSAR"
FT   gene            428326..431772
FT                   /locus_tag="Bcep18194_C6878"
FT   CDS_pept        428326..431772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6878"
FT                   /product="Molybdopterin oxidoreductase"
FT                   /EC_number="1.97.1.9"
FT                   /EC_number="1.5.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6878"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05924"
FT                   /db_xref="GOA:Q39NP2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR037949"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR041930"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP2"
FT                   /protein_id="ABB05924.1"
FT                   /translation="MDIQEKKGYCTLCRSRCGTINVVRGDMMIKVWPDETHPTGHAMCM
FT                   KGKAAPELVHSPNRVLYPMRRTRPKGAADPGWKRIGWEEALSEIAERLAYFKRENGAES
FT                   VAFGVTTPSGTPMSDSIDWVERFVWLFGSPNICYATEICNWHKDSAHVFTFGCGMPTAD
FT                   YQQADLIVLWGNNPANTWLAQADAIAKGRRRGAKLIVVDPRPTPLAREADLWLRVNPGT
FT                   DGALAMAIARQMIAIGNVDEPFVRRWTNGPLLVRADTGRFLRERDIDPHASGNRYALWN
FT                   QTLDRLELVEEEAGTALSDLSMTGTRHVGITDSAGRCTQVECTPAFDLYARALAAYTPE
FT                   LASTITGIDAADIMKAAQMLHPGQGIAYHAWSGVGMHTNATQTERAIATLYALTGAFDT
FT                   RGSNREWAKQPANAVSSYAMLNPGQRAKALGLAERPLGPPSQGWVTARDVYRAILDAEP
FT                   YRVRALFAFGTNMVLSQADGGIAHNALCALDFHVHCDLFETPSSRYADILLPVNTPWER
FT                   EGLRLGFEINERAVELVQLRQRMVPPRGESRADYDIVFDLAVRLGMKDRFFGGSIEAGW
FT                   NHVLEPLGMDVALLRTHPEGIARPLTQYERRYASATPDGVRGFNTETLRVELYSEKLHR
FT                   HGYPAVPQYVPPQHGLGEGVNDRRRFPYTLTSMKNGYYCHSQHRGLPSLRRRAPYPVAE
FT                   LNDALAAEHGIVDDDWFLVETTNGSARFKARIVPELAHDVIVAEYGWWQACDEIGMDAL
FT                   AVEGRNHSNFNRLVSAARLDPVSGSSPLRSVRCRIRPDPSTDPSRRAWKGRRDFVVSAI
FT                   HEEASGVRTVTFRASDRGALPDYLPGQHVTVHVPALGDGGTTRAYSLTGAASEDDRRTY
FT                   SISVRHQKGRTGEGVPFEGAMSSYIHGSLKVGDPVLLGAPAGTFIVPPASKQPVVMFAG
FT                   GIGITPFISYLESIRDRGAQAPESRLFYANQNSGTHAFRERIERLKQRLPKLEVVNCYN
FT                   QPHDEVLGRDYQIRGYLTADVVSDDLIQRRARFYLCGPEPMMQAITAGLIERGVPPFDI
FT                   FKEAFRSPSRPALDPSKRFVVQFTRSRRVSTWTPRDGSLLSFAESLGVVMPSGCRVGQC
FT                   ESCAVKVVSGEVAHLSGHGPDEPDVCLACQAIPATDVAIDA"
FT   gene            431796..432731
FT                   /locus_tag="Bcep18194_C6879"
FT   CDS_pept        431796..432731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6879"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6879"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05925"
FT                   /db_xref="GOA:Q39NP1"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP1"
FT                   /protein_id="ABB05925.1"
FT                   /translation="MKYFDAVATRDALDFESLVSRLRQAFVDGCHVPLRHAHAVNAGSE
FT                   DEGTVLIMPAWEDNGYLGIKTVNIFPGNARHGLPGLHSTYVLYDGRTGQPLAQLDGDEI
FT                   TSRRTAAASALAATYLARPDASRLVLLGAGRVGSLIPLAYRSQLPVSDVEVWDRNPRAV
FT                   AELVGRLTELGFNAEPVADLETSVRRADIVSCATLATEPIVSGKWLASGSHLDLIGSFT
FT                   PRMREADDDCFRNAEIYVDTDEAPQKSGDLLGPLSRGVIAIDGLNRTLSALCKGEAKGR
FT                   QDDGRRTVFKAVGTAMEDLAAAIQVYEKSN"
FT   gene            432757..434208
FT                   /locus_tag="Bcep18194_C6880"
FT   CDS_pept        432757..434208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6880"
FT                   /product="Short chain fatty acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6880"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05926"
FT                   /db_xref="GOA:Q39NP0"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NP0"
FT                   /protein_id="ABB05926.1"
FT                   /translation="MKDLMEVPHVGAAATDREGALERMAAGVARWSEKWFPDAYIFAAI
FT                   AVVVVAAGATAIGAPIRQVGVAFGDGFWSLIPFTMQMAIVAISGYVVAVSPPASKLIGA
FT                   LARFPSSGRAAVAFVAFVSIVASLFNWAISLIFSGLLVRALARRADLRMDYRAAGAAAY
FT                   LGMGATWALGLSSSASQLQANPDSLPKTLLAISGVIPFAETIFLPQSMLMAAVLTVVSL
FT                   LIAWLSAPGGTRAKTAAELGIPLDEAHATIPRPTRPGDWLEYSPLITLAIVAIGSVWVA
FT                   HEFTTKNPMIAISNLNTYNFLFLMLGMLLNWRPRRFLNAVARAVPSVAGVLIQFPLYGG
FT                   IAYILTKASAPAGLPLSDHLAHFFVALSSQSSFPAVMGAYSAVLGFFVPSGGGKWIIEA
FT                   PYVIEAAKLLHVHLGWAVTVYNAAEALPNLVNPFWMLPLLGVLGLRARDIVGFTFTQLA
FT                   VHLPLVIFMLWALASTLSYHPPVMP"
FT   gene            complement(434299..434973)
FT                   /locus_tag="Bcep18194_C6881"
FT   CDS_pept        complement(434299..434973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6881"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6881"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05927"
FT                   /db_xref="GOA:Q39NN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN9"
FT                   /protein_id="ABB05927.1"
FT                   /translation="MGRQKSGQNDGPGAAAADTADAPARARLVPTQQRSRERFERILAC
FT                   ASEVMIEKGCDAFRMSDIVERTGISFGSLYQYFPDKAAVIGTLAERYNEAGHVCVRRDL
FT                   ATMKTLDDLHATLARITDSYYRMFVDEPLMRDIWRATQADRALQALDRADGEFLAGLFA
FT                   DALGEVAPDTPHAQRSAFAELMMIQIAAAVRHAITLPPKAAQQILAMFKRALPRDLSVL
FT                   GA"
FT   gene            435068..435898
FT                   /locus_tag="Bcep18194_C6882"
FT   CDS_pept        435068..435898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6882"
FT                   /product="NmrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6882"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05928"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN8"
FT                   /protein_id="ABB05928.1"
FT                   /translation="MSALPTLIVGGSGKTGARVDARLRARGIATRPVSRTSAVRFDWTV
FT                   PETWPAALEGVSAAYVTYQPDLAVEGAVDAIAAFARLARESGVERVVLLSGRGEPRAQA
FT                   AEAALQASGVGWGVVRASWFNQNFSEGYLIDGVLAGEVALPAGAVREPFVDADDIADVA
FT                   VAALTDARFANRVIEVTGPRALTFAEAVGEIARAAGRPVVYREIPADAFVAGLREVGVP
FT                   EPVVALLDDLFSVVLDGRNSAVTHGIEATLGRPARDFADYARATAATGVWSARS"
FT   gene            435895..436380
FT                   /locus_tag="Bcep18194_C6883"
FT   CDS_pept        435895..436380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6883"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6883"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05929"
FT                   /db_xref="GOA:Q39NN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN7"
FT                   /protein_id="ABB05929.1"
FT                   /translation="MIAFVTAALLWGSAIGCGLMAGVYFAFSTFVMTSLGRIAPQAGVA
FT                   AMNAINVEIVRSPFMPLFLVTTLMALALVVLALFNREQPGAMVAVAGGALYLFGMFAVT
FT                   MAVNVPLNDALAAADPATAQGAALWTRYVHDWTMWNHVRTVASAAACVFFIAGIAAR"
FT   gene            complement(436452..437252)
FT                   /locus_tag="Bcep18194_C6884"
FT   CDS_pept        complement(436452..437252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6884"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6884"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05930"
FT                   /db_xref="GOA:Q39NN6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN6"
FT                   /protein_id="ABB05930.1"
FT                   /translation="MSRLVANRTLESTPPGAHLPFESTPMPVSAMAATYAHGTSIAPHR
FT                   HRRAQLLYAIEGVMHVQSEGASWVVPPTRGVWLEAGLDHTVQMSGDVQMRTVFVEPGAV
FT                   EHLPARSCVVEVHPLLRELILAAVDVPLDYAPGSRHDHLMHLLLAEVTVAPLLPLYLPW
FT                   PHDPRLRTICDALVAAPDDLRTIAEWADLLGLSVRTLHRAFRRETGLSFRRWREQARLL
FT                   LALKRLAHGEKVLTVAMDHGYSSQSAFSAMFKRHFGVSPSAFYA"
FT   gene            437289..438251
FT                   /locus_tag="Bcep18194_C6885"
FT   CDS_pept        437289..438251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6885"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6885"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05931"
FT                   /db_xref="GOA:Q39NN5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN5"
FT                   /protein_id="ABB05931.1"
FT                   /translation="MAFPTTPDPCQDINPSNAMNKSPFLFPFCAIALWAGNVVVSKLSA
FT                   STIDPSAITFYRLLLAVALMSVFTLRPAWRNRAALVAHLPKLAVLGFLAMALFQSLSYE
FT                   AAKTTSATNMAIITALVPLMTMALSSLLLGDPPSVGMIGGGVLSLAGVVYLIAEGHPTT
FT                   IAARGVHTGDLLMLAASAAYALYGVLLKRWRIGALPAWQSTYVQALAALVFMVPMLLRL
FT                   PAQAAWPTRASVPLILYAGVLASVVLPYLWMQGVRLLGPSRCAMFMNLLPVMTAGGAIV
FT                   LLGESLKLYHLIGGGVALVGVAIAQRFPFQASASQGVRQ"
FT   gene            438248..439225
FT                   /locus_tag="Bcep18194_C6886"
FT   CDS_pept        438248..439225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6886"
FT                   /product="protein of unknown function DUF815"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6886"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05932"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN4"
FT                   /protein_id="ABB05932.1"
FT                   /translation="MSGDRDMQNLMAALPDARASVDGPALAHQLERIATALEALAGTGQ
FT                   PAPVDFDAAVAFRWRGFDGGPRTAPLEPVATPALIAFDALRNVERQVAIVERNTRQFVR
FT                   GFAANHVLLTGARGTGKSSIVKACLHAFAPHGLRLIEVGKEQLSDLPAIVELVRARPER
FT                   YIVFCDDLSFEAGETGYKELKTVLDGSVASDLSNVLVYATSNRRHLMPEQASDNANVSR
FT                   AENGELHPGDAVEEKISLSERFGIWVTFYGFTQDAYLAVVESRLGEAGFDAEQIRAARE
FT                   PALQWALERGARSGRIAVQFVRDYIGRMADESDTVENARELRTG"
FT   gene            complement(439234..440100)
FT                   /locus_tag="Bcep18194_C6887"
FT   CDS_pept        complement(439234..440100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6887"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6887"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05933"
FT                   /db_xref="InterPro:IPR018644"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN3"
FT                   /protein_id="ABB05933.1"
FT                   /translation="MPLMLQDNAFVYPSAGPIGRLANRVVASRPLLRTRRALLSRLPFL
FT                   QLASEVENVVYCTWLVDVAAVAHLVPRGVTLASRDGRTPFTILTYAHRHFGPRIAGPLR
FT                   RVFPSPLQSNWRLYVDALPGGVPADRTVLFVKNVFDHPLYALGSRLFSDALPSHLAERF
FT                   THAVQDGRYRTLLSGGSGSAPDFHCAAALSDDYSLPEAFAPFFGSWRDAVAYLSLQHAA
FT                   VAHVADCDRLAHASIDLPIDIDAVRPLKPVEPVGGGEFLARIGATGEPLCFVVPDVAFR
FT                   VLSERVL"
FT   gene            complement(440177..440479)
FT                   /locus_tag="Bcep18194_C6888"
FT   CDS_pept        complement(440177..440479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6888"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6888"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05934"
FT                   /db_xref="GOA:Q39NN2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN2"
FT                   /protein_id="ABB05934.1"
FT                   /translation="MIDVDRAHKALAHPFRRNVLRWLKAPDTLLANAARLRSQHGVPLS
FT                   SIVARSGLSQSTVSAHLAVLCEAGLIVATQVGQWRFVARDDAGIAAFVAQVVSDL"
FT   gene            complement(440493..441695)
FT                   /locus_tag="Bcep18194_C6889"
FT   CDS_pept        complement(440493..441695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6889"
FT                   /product="Major facilitator superfamily, (MFS_1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6889"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05935"
FT                   /db_xref="GOA:Q39NN1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN1"
FT                   /protein_id="ABB05935.1"
FT                   /translation="MPPIASPAASPAAAPPAAASRGKIVAMAAIAGAVVTNIYCTQPIL
FT                   PLIAQDLQVAPATADLVAGAALLGFATGLALLLPLGDRYDRRKLVLGQIVLAFAFAVAS
FT                   ALAPGVWALIGAAFSLGVVSCVPQQLVPFAAVMSAPDERGRNVGTVVTGIMVGILLGRA
FT                   VSGLIAAHAGWRAVYAVEAAAMVPVGIAAAWLLPRGVPSTTLSYGRLLASLWTLARAHR
FT                   PIRESMIVQALLWAAFNAFWVNLAALLADGPWHLGSAWAGGFGLIGAAGALAATIGGRA
FT                   SDRIGTRRVIGLGIAIVTVSYLILAGAGSSLALLVVGVVVLDIGVQAGLVANQTRAFAA
FT                   DPKAQGRINSLYMTATFVGGAIGAIVSGALMARFGWHGVVAFGIAAGLAAALVHRCGAR
FT                   H"
FT   gene            441864..442775
FT                   /locus_tag="Bcep18194_C6890"
FT   CDS_pept        441864..442775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6890"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6890"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05936"
FT                   /db_xref="GOA:Q39NN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NN0"
FT                   /protein_id="ABB05936.1"
FT                   /translation="MNRLESMSLLVAVIDAGSMSAAARQLGIPLATVSRKIADLESYLN
FT                   TRLLHRTTRQLSLTEAGESYVAGCRRILDDIAETERAATGEYAAPRGELIVTAPIVFGR
FT                   LHIVPVLAAFLAHYPEIDVRLVLTDRVTHLMEEQIDVALRIGELPDSSFMATRVGSVRR
FT                   VICASPAYLAAHGTPTEPTDLARHQCITFEVLASRRAWVFGGEKGELTVPVHSRFAVNT
FT                   AEAAIDAAVLGVGLIRVLSYQVAQALRDRTLDVVLDAFESQPLPVSLVHKGQAPMPLKL
FT                   RAFLDFVAPRLRERIAGVGAGD"
FT   gene            443336..446254
FT                   /locus_tag="Bcep18194_C6891"
FT   CDS_pept        443336..446254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6891"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05937"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM9"
FT                   /protein_id="ABB05937.1"
FT                   /translation="MRMTEDSAEKARVEAEAVCVRLLQAAPTVAAAPVELLEHLAAAWL
FT                   RKIEALETLERNADAVAEVDAFTRYFDQGADTPESAWPWLVQAACRKVVALARQSQLLR
FT                   ALEIAESVQARFEHTRALAVREWVAYAGLEEIRIRTAMGETFARVDMVRHAQRLAERFG
FT                   ADEWPATRALVGRIRLRRARMLSELDYDDEALSELSAVRADFAEAEDPGAQEVAADALH
FT                   MRSRLLKVLHRDEEARSEQRALLAGYARSTCPEIRQTHVLARFDAIAWAEEAADEAGND
FT                   ADHLNAWIDACDALIFDHADSDDGFVVLRVNQALRHKARALRRLGGAGADEDDQHDQDD
FT                   YPERADKVADEQWTRYRDHSDAAVQAELIDAMLERLEARDRPGQVLDEAERLLQHLQRS
FT                   GPMQAASPQLVRILLLKSWALRALGRPRQALETFALLPADAPTGETDPVLSRLRVNVQI
FT                   ERGRLLRQMERPDEALDALSLAPDLLDDVVESGKAGFDKPLRRAVARAMDLRIDILAEA
FT                   TPPKDDDTPFGQSVPLEPAEQAYAQAVHALDQRFHADDDASVRSMVADALYSLAVHQRE
FT                   RAHPHEAIASYDLLLNRFAADPAPAIEPRVASAYLNKAYLLLNGLDRPEEALPVYDALM
FT                   ARFANATGGKLRDSVAKGAASRLTCLNRLQDRGVAVNYGEQYEDLTPAQRDAIAGTLDR
FT                   ADALRDEDKYRDAIALYDQILTQHVESLHPELRRLCRNAMTNKAFCYARLNQREASLAV
FT                   NDEVIARYGSDLSTTAEKDVALAMSNKAVDLDKLGRHDEELEVYAQIIERWRHADVAYL
FT                   RLRVASAMFGKACTLADRDPESALAGYRQVLDGYLSAGEANLRLQAAKSAVNLGILLRK
FT                   LGRHADALRPCERLLQACSGETDEQINAQLIRARISLARTYAPAGAPEKAVAMYRELLI
FT                   LPPRQLSETQRKELDKELLALPGGRLGLVGLFKAARGKLMGK"
FT   gene            446341..447432
FT                   /locus_tag="Bcep18194_C6892"
FT   CDS_pept        446341..447432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6892"
FT                   /product="Sel1-like repeat protein"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6892"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05938"
FT                   /db_xref="GOA:Q39NM8"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040239"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM8"
FT                   /protein_id="ABB05938.1"
FT                   /translation="MKSYLAVLAILCLTACQAGGQAAAPASVETSVGLQTKEEAVRDNP
FT                   ANPHEKDETGVTASDVSSSSTSSQKSLAQLVDACHATDPDSCEKAGLGYAAAATDNLLH
FT                   AADFYADGCDQSNASNCIRMGLMLQKGDGVQLDWFAAAINFRSACDLDDTECSNLGLAY
FT                   VFGQGVVRDGRRAVQLFDKACQAGRMTGCANLGAAYMKGIGVHRDRQRAIALFREACSD
FT                   GDSLGCFNLGVIYHTGQGVRRDLKRAATYYQTACDHDDGESCSNLGKLRLGRKIGARDP
FT                   KTAAQLFYRGCILNDAESCLYLGLAHQSGDGVRANAYDTRSYLWRAVALDPKSQAARRA
FT                   LARLARIGDERAATPAGRQPSGE"
FT   gene            447433..447915
FT                   /locus_tag="Bcep18194_C6893"
FT   CDS_pept        447433..447915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6893"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6893"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05939"
FT                   /db_xref="GOA:Q39NM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM7"
FT                   /protein_id="ABB05939.1"
FT                   /translation="MQSINTLVARVHDSWIARTLILGLSFLVPFIWILSTDLIWAALKN
FT                   VSRNTSDASINIPTAMPLIASVVGAWFVCAFALGRVVKSTRRVILVCNVVAVIVFVVEF
FT                   TMTIGTSDWALVSGELVSIYPIRFGLAVLIAFVSSLLASRIFGKTEASRNTTPPVR"
FT   gene            448067..448510
FT                   /locus_tag="Bcep18194_C6894"
FT   CDS_pept        448067..448510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6894"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6894"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05940"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM6"
FT                   /protein_id="ABB05940.1"
FT                   /translation="MESVAIGFFWTTSMPHLVVKRTVLVAMTIAYAACRADLPATRLTN
FT                   KEATAALRAEIEMVAEEQGRVALGTCKPALNPRYKDQVACTLLVISQAGTSETQADFHW
FT                   DGQKWVSTPSESQDILPFPDPLLADIHSWTKNIDQLEPHFLKN"
FT   gene            448626..449510
FT                   /locus_tag="Bcep18194_C6895"
FT   CDS_pept        448626..449510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6895"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05941"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM5"
FT                   /protein_id="ABB05941.1"
FT                   /translation="MNDVSIDEWLAGLERHLAQIPRGGGRYANGRPGFIAALTPQAWRL
FT                   LNLQGMGKDLAPIVTAAWNQEPVRFRALLSAYVRISTLTALANAPFGLKACFTDPLVAL
FT                   AAGDEATYRVQVPAADDWGDPDETPAIEGMVVLVTKLMAAIEHGLPRPAAWGGFTDRVL
FT                   AESGTFDQALVGTLLALHAGDSDPATPFGKVVATFRRSGWARVRYGELAGLPLLAVGIV
FT                   ALARRKHAVASDALAAMLPAAAVSYSRVLVADAPACPFRFRGELAFLDELLADPASWTA
FT                   LAAELAKQWNATA"
FT   gene            complement(449648..450319)
FT                   /locus_tag="Bcep18194_C6896"
FT   CDS_pept        complement(449648..450319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6896"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6896"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05942"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM4"
FT                   /protein_id="ABB05942.1"
FT                   /translation="MHAAVSTPIPDRPRADACRVLALPPPSSKAASHPESPKQRDASAQ
FT                   PFVADIGIRRTPASGTTTRQHRLPARHRGGVIGLVRDERPVNDLWSALPNEGRVEIDLP
FT                   RTFAGSPDIVTTFGAELASVRVAQIDAGLPAVGTSGLRRADDFGFRSIGHGQSHASSVL
FT                   RDGRDDRQRRIVGAARVTDQAVRPDVPRIAIGTPACQDGDRGDQGPRQEARPDRPCAVD
FT                   A"
FT   gene            450446..451318
FT                   /locus_tag="Bcep18194_C6897"
FT   CDS_pept        450446..451318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6897"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.184"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6897"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05943"
FT                   /db_xref="GOA:Q39NM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM3"
FT                   /protein_id="ABB05943.1"
FT                   /translation="MSRPPMPSWLCPRTCADEARLRRMLAGKTILITGASSGIGAAAAR
FT                   LLAQPGVRLLLVARNEARLADVCRQTTAKGASVHYYCVDFAEMSQVHALGDRIEAEVPA
FT                   IDVMISNAGKSIRRRVTDGEQLLRDALRCNQINHVAPVALLSRILPLMMARGAGQVVNV
FT                   STVSARLPATPYWAAYQSSKSAFDMWFQSVAGELCANGVDLGSVYLPLVHTPMSAPSAV
FT                   FERVPGMSAEQAAGVLAYALVSRRRRVAPWWLWPCEWLAILFRHPVDWMLAALHRRNTS
FT                   QHASGKRDA"
FT   gene            451311..452921
FT                   /locus_tag="Bcep18194_C6898"
FT   CDS_pept        451311..452921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6898"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6898"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05944"
FT                   /db_xref="GOA:Q39NM2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM2"
FT                   /protein_id="ABB05944.1"
FT                   /translation="MRDCLTAVRWVWRALRVSGLPAPVALGLRVILLGVRHGWSMYVLA
FT                   ALWKDLAPDEAALTDDRRQWSWRELVLDVDALATVLDGMGLRRRDRIGLMCRNHGGFVI
FT                   ALLASMRLGADVVLLSTRFDGRQLAAALDGHDVCTLVVDPEYEAHVKEAGFRGRVLWSE
FT                   ASADREVGDAGPNLPGLIASTPPVRLGRRRPGALIVLTSGTTGAAKGVRRALSVKQVAG
FT                   IVYSLVSRLSLRTGARTLIAVPLFHGYGIAALALGLALRCPVALTRHTDGSRLWAIARR
FT                   TQATNVVVVPTLLRRMLDASLHDPPAAIERIVSGSAPMPTRLIEETSGRWGEVLYNLYG
FT                   STEAGLITIADPRDLRDAPDSVGYAVHGTEVVIRGNAGDTLGPGKIGEVVVTGPLVFDG
FT                   YDHARVPPVSVHTFATGDKGWRDDAGRLHLLGRMDDMLIVGGENIYPQQVEDRLMTLRQ
FT                   VVDVAVAGLAAEDGGQRIVAWFVLRPGHEIGASDIASVLPAYMRPTRWTVVEALPRNAI
FT                   GKLARGRLAPGTIDTGSGP"
FT   gene            complement(453019..453849)
FT                   /locus_tag="Bcep18194_C6899"
FT   CDS_pept        complement(453019..453849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6899"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6899"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05945"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM1"
FT                   /protein_id="ABB05945.1"
FT                   /translation="MANRSYLYSLGNRPTSYEDRPETISGLSEWAYDVPFMYRLLMSCD
FT                   PQPCASLISDGLDGTKMPLHAISSPFAPGFERVRHFVAILRVLIESHAVPTPAAPPPEP
FT                   PGKSTLVDRMRRWVGVAPAPVESRPAHMPTPAVTHAAVDHVREWLDETLAFLEQHRAPY
FT                   LLLETIELDLMSESDPDALRALVDAEIGRCRHVGAAFEALPGNITEAAGILQRAAAERS
FT                   PAPLDAFFGLRFDDNCDSTRTGDTEHPLGLEWNDVLYFELFNREQFEAHRSQPD"
FT   gene            complement(453900..454559)
FT                   /locus_tag="Bcep18194_C6900"
FT   CDS_pept        complement(453900..454559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6900"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05946"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NM0"
FT                   /protein_id="ABB05946.1"
FT                   /translation="MNVSTSNLNALPDIAGLMRLTQSLAILDAVLSPEWEYRYYSFNQA
FT                   WADGEKMASMRNGSGDQWFAIFSAAGAALHGVLRDAPMYRPGNPWPAIFSGLPEAFHAN
FT                   LLHEPAFTTHDSTFCIWRLADETRWSCGPVESSTADDPDGSARLLGILAGRPEQYVEFA
FT                   ADYYECDIDPRDVAAVYRHEPLAAGLVRRLNPECDFESLQDDLAEIGYPWSVSDDR"
FT   gene            complement(454656..455180)
FT                   /locus_tag="Bcep18194_C6901"
FT   CDS_pept        complement(454656..455180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6901"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05947"
FT                   /db_xref="GOA:Q39NL9"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL9"
FT                   /protein_id="ABB05947.1"
FT                   /translation="MRTLSVWLRSGILLAIGIAVVLWGGFTLADGVILRRAQAWPHVPA
FT                   TVEQCAATLQYGRHSAYWEVSARFRYGDGREYVSAWQPADGLTDEHDPTPARTDAQTAA
FT                   YCGAAAQDGLRVSPEFPGIARLNSAAMSDEWEFKLMLGAALLLVGLVNGFTGFWLLRHG
FT                   DPPPRRLFSRE"
FT   gene            complement(455279..455959)
FT                   /locus_tag="Bcep18194_C6902"
FT   CDS_pept        complement(455279..455959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6902"
FT                   /product="Deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6902"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05948"
FT                   /db_xref="GOA:Q39NL8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39NL8"
FT                   /protein_id="ABB05948.1"
FT                   /translation="MPLSNAQLAQTIDHTLLAPDASDAQIRELCRQAAEHRFYSVCVNS
FT                   ANVPLAARELADTGVLVCAVVGFPLGAGLSAAKAFEATVAIAAGAGEIDMVINIGALKS
FT                   GRADDVKADIDAVHRACGAVPLKVILETGLLTDDEKVRVCEMCRDLGVAFVKTSTGFGH
FT                   GGATLADVALMRRTVGPVLGVKASGGVRDRAAALAMIEAGATRLGTSSGVAIVTDQDGS
FT                   ASAY"
FT   gene            456106..456876
FT                   /locus_tag="Bcep18194_C6903"
FT   CDS_pept        456106..456876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6903"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6903"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05949"
FT                   /db_xref="GOA:Q39NL7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL7"
FT                   /protein_id="ABB05949.1"
FT                   /translation="METKKGERIKTLMNVLQGQNAIHLREVAELFGVSEMTIRRDLADN
FT                   PHGLSLIGGYVTRHFAAQRSDIGEYVVSTENDRQTEEKRRIGKLAAQFVTTGDTIFVDC
FT                   GSTTPFVVDFIPDDLEFTAVCNSLNVFAKLQQKPHCSVILCGGAYHRKNMVFESVAETG
FT                   ILDTVRVSKAFISAAGVSDRCGVTCFNFHEVDAKKKVMERAQNRFLLVDHTKFDEVRAA
FT                   YFAELTDFNYVISDEQLSSRYETAIREHGIALVT"
FT   gene            complement(456899..457951)
FT                   /locus_tag="Bcep18194_C6904"
FT   CDS_pept        complement(456899..457951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6904"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6904"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05950"
FT                   /db_xref="GOA:Q39NL6"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL6"
FT                   /protein_id="ABB05950.1"
FT                   /translation="MRGEIELRRDDFRDTPRTLYRTDGLTVTAFAYPSGVEALKLENRR
FT                   GHLVVLPYLGQMIWAAAFDGHDLTMKHMFRQPKRAASIIDTYGCFMFHSGLLRNGCPGP
FT                   DDTHALHGEMPCAPMDRASLVVGADARGAFVEVTGEYEYVQGFGSHYVARPSVRLAEHD
FT                   AQMTIAMDVTNLGGTSMDLMYMAHLNYAYVPGGRFVQSLSRGGLRLRDSVPAHVKPTAA
FT                   WRDYTATLAHEPERLHTLDAPALYDPEIVFFMNDAETDADGVAHFLLEHPDGGAFHTAY
FT                   RPEQFPHATRWILHNADQQVAAFALPSTCEPEGYEAERRKGHVAALAPGATRRFEVVTG
FT                   YLSAAEARHA"
FT   gene            complement(457954..459327)
FT                   /locus_tag="Bcep18194_C6905"
FT   CDS_pept        complement(457954..459327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6905"
FT                   /product="L-fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6905"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05951"
FT                   /db_xref="GOA:Q39NL5"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL5"
FT                   /protein_id="ABB05951.1"
FT                   /translation="MSRARIEHTPDGYYLNRTPLFAFTLLCCLFALWGTAANLNDVLIA
FT                   QFKKSFFLSDFESAFVQSAFYLGYFFLAIPAATVVKKFSYKTTILVGLLLYTTGCLLFF
FT                   PAASMAKYGMFLVALFVIAAGLSFLETASNSYSTLMGPRETSTRRLNISQTFYPFGAMA
FT                   GVYMGSLLIFKEGDASHAQLAAMSAAEAHVHQLAMIQATLEPYKWLIVVLVAVFIVFAL
FT                   TPYPACKGNGPSVATHRIDARGTLARLFGNRRFVAGVVAQFLYVGAQVGVWSFTIRLAM
FT                   QIGGLTERGASHYLLATFFAFFVGKLVATLVMKRVGPAKVLIVYGILCIALLAYTISVH
FT                   NITAVYAAVGVSVFLGPCWPTIYGLTIDGLGKDTEYGGSILVMSIVGGAVVPLIQGLIS
FT                   DHTGGNMQLAFVVPLVCFVVIVYYGFYCLRHLPAATPDAAADGQAPARYAATRNTSGA"
FT   gene            complement(459369..460355)
FT                   /locus_tag="Bcep18194_C6906"
FT   CDS_pept        complement(459369..460355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6906"
FT                   /product="Ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6906"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05952"
FT                   /db_xref="GOA:Q39NL4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL4"
FT                   /protein_id="ABB05952.1"
FT                   /translation="MLHVAADHARGAPHTKEETQMETIAVIGSNMVDLVTYVARMPARG
FT                   ETLEAPNFELGCGGKGANQAVAAARLGARVVMVTKVGDDVFADNTIRNFEREGIDTTHV
FT                   RKVAGVPSGVAPIFVEPDSSNSILIVKGANRHLTPADIDAAAPQLAECALIVLQLEIEL
FT                   DTVYHAIAFGARHGIPVLLNPAPAVADLDFERIRTVEFFVPNETELAIVSGMPVDSRDS
FT                   AARAAEALVARGLKHVLVTLGSNGSLLVSRDGVRHVPGVPVDARDTTGAGDAYIGCFAR
FT                   CYAASRDALDAMRYASAYAAHSVTGLGTQKSYADTATFERFLRDAGV"
FT   gene            complement(460637..461749)
FT                   /locus_tag="Bcep18194_C6907"
FT   CDS_pept        complement(460637..461749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6907"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6907"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05953"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL3"
FT                   /protein_id="ABB05953.1"
FT                   /translation="MEDCLDRRHRLPVVHRDHTSLASRIRNARMTVSLRLSPFTAQGVV
FT                   QFMTLRQRLRRVNRQRETRGIAADFSPAPLGPPAFTTPHDMSRRALALPDAPCLAMTDT
FT                   DLCRAAAQVSAPHATNLLRSCSPRCRVCYAARIASPSRSPPMTDLAPDLARTLRASCDA
FT                   CFGTAAVWPLVEHAYREPQRHYHTLAHLAELFAHLAPYRTEPLWPAIELAVWAHDFVYA
FT                   TTLPEYSDNEARSAQWLVEVTNTHCSESWLHAHASHVSVAHDLVLATKSHRLPDTFASD
FT                   PNLQRAGRIFLDADLAILAAAPDRLREYDRAIAREWAQDPDAPSAAFRTGRRQALEHLR
FT                   AQVPLFQSAEFAPLTPRAQRNLDTLIATYA"
FT   gene            461904..462242
FT                   /locus_tag="Bcep18194_C6908"
FT   CDS_pept        461904..462242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6908"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6908"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05954"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL2"
FT                   /protein_id="ABB05954.1"
FT                   /translation="MHRTLVELERREYEKTHGHQSAGDFLQVMAFDDSMKWLEPLSRLI
FT                   VMLDEALDQEGELELTPTVVVARTRELLKLDRASTDAFATRYLYHFDNSADLAVDHTAL
FT                   LKLIGNVA"
FT   gene            462482..463099
FT                   /locus_tag="Bcep18194_C6909"
FT   CDS_pept        462482..463099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6909"
FT                   /product="Peptidase M17, leucyl aminopeptidase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6909"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05955"
FT                   /db_xref="GOA:Q39NL1"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL1"
FT                   /protein_id="ABB05955.1"
FT                   /translation="MVLRQIIGSWRDVSFEVAAWDGVGAQVDLSCGCMFAREAAGEGPT
FT                   GGLRHLDLALSGALTGLRREGHFLAAPMETLLISRPPAGIEVGRVLLIGLGDPASWTID
FT                   VTAAAAATAARTAMQQGLQSAAFAPSILDGGLTSAATDGMPHAMVTAVLATIDTQYRIA
FT                   ELGLSALPSLRHWVFDVGASRFDGAVEQFGNALASAQSRRSK"
FT   gene            complement(463357..464193)
FT                   /locus_tag="Bcep18194_C6910"
FT   CDS_pept        complement(463357..464193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6910"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05956"
FT                   /db_xref="GOA:Q39NL0"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NL0"
FT                   /protein_id="ABB05956.1"
FT                   /translation="MIDDPLPKNWQDLQTGVQRIFRNVGLRADVEVDLETPRGSVNVDV
FT                   LAVDVRSVDKIRYIVECKNWSSAVPQSVVHSFTTIMQETGANIGLVISKQGLQQGAKRY
FT                   TQNTNIVGMTYLEFQQRYFEAWWKRYFCPRIGDAADKPLQYIEEFNIDRDDAYKKLSRQ
FT                   GQDKFDRLRRENSGPVMFMSMFNYMALSPMLGTGTMLDVPTNLSEFKNNVLAKITPHIE
FT                   WHCDTFRGLLGIMLQYLADVEADFDAVFGGSIFEPREPISGVTADGPPLDDGIYHR"
FT   gene            complement(464550..465905)
FT                   /locus_tag="Bcep18194_C6911"
FT   CDS_pept        complement(464550..465905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6911"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05957"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK9"
FT                   /protein_id="ABB05957.1"
FT                   /translation="MNGQPMQRYLCTPDYEGYFDFFSNIIVLSIYDSKHKEEILGAIQP
FT                   QNGTTELSERQVEIRALLKHEITHFLDMTTTAWGCQYILRKLRTIKYLEEKGSEYEDAQ
FT                   KVFMLETSEIEMHTELLSTTDVPPMDCETLHHTLRYTTQFGAVLIVCYFRNDVCQHQVP
FT                   LSMLSLLEANATASEYLSRISDTESLEDNALRILRLEDIERSFSALLNDPARLEYSVLL
FT                   NLARVHFPELALRDLLIYVAALCRFSLDATDFGMAAMANIIEPSTLNQRLGNALAMELR
FT                   RAANRPLLFFKTVLFTYGWMQEMGEENRSGYLELVRTNPKQAIRSLWIDYLEVGEDTLD
FT                   LEREFTVPMKQAWIDELNVLGDAEIFKRSFASNAPKLNETSVGLLNFQEITAINIILGD
FT                   DTEIEMPNRIDLGVVEYFDNHMKTFARLDAMYREQPHERFHIPLDAPGYLIR"
FT   gene            complement(466793..467650)
FT                   /locus_tag="Bcep18194_C6912"
FT   CDS_pept        complement(466793..467650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6912"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6912"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05958"
FT                   /db_xref="GOA:Q39NK8"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK8"
FT                   /protein_id="ABB05958.1"
FT                   /translation="MTAYAFRLLNVFAESTFGGNPLCVFEDARGMDDATMRALAVQFNL
FT                   SETTFVLPSERAHARVRIFTPGYEMAFAGHPTLGTAHVVRDLLGTGNDLALEFKAGVVD
FT                   VSAHDDVWTFTAPHAGMPKTAPCELPDARIAALLGLTEDDLLAPPIWVDTGADQLLVAL
FT                   KDAAAVRRAQPDSACLDIWPTSSLGRKTAYVFAFDAERPGTVVSRYFFVKQGSVSEDPG
FT                   TGSACANLGGWLLAMKRGLPAAFQVEQGEAVGRPCLLRLLVSASGEIGVGGRVIELGRG
FT                   VVNV"
FT   gene            complement(467737..468555)
FT                   /locus_tag="Bcep18194_C6913"
FT   CDS_pept        complement(467737..468555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6913"
FT                   /product="Transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6913"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05959"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK7"
FT                   /protein_id="ABB05959.1"
FT                   /translation="MSENTELITSLIRLGFTQYEAQAYAALVGQAALTGAEVGRRAGMP
FT                   PSKIYETLGRLETRGAVLVNRSEPVRYAAVPHRSLLEDLRTRFNADLELAAGALDRLPV
FT                   QQEPGLVWSLSGREAIASAFARVIVNAKTQIFAGVWDEEIDDLGPLLEAAAARGVDTHV
FT                   AIYGTRTLNGPRHYDMAKCGASARLRLSGRRLAVAVADNTEAVVAEFGDHSPDHATLTT
FT                   NPVIALLAVEYIKADVSGRVLIDAMSPAEYRKILKHPDMQAMLAPLDKPS"
FT   gene            468655..469053
FT                   /locus_tag="Bcep18194_C6914"
FT   CDS_pept        468655..469053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6914"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6914"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05960"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK6"
FT                   /protein_id="ABB05960.1"
FT                   /translation="MYLNLTGGIFKMRKRISTGSPWEPKVGYSRAVVVDNTIYISGTAG
FT                   KGADVYAQTRDALATIDRVLADSGFALSDVVQSRLVVADFDNWEAAARAHGEIYGDIRP
FT                   AFSLVHALPFVDPEILVEVEAIAVRAAA"
FT   gene            469050..470255
FT                   /locus_tag="Bcep18194_C6915"
FT   CDS_pept        469050..470255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6915"
FT                   /product="Major facilitator superfamily, (MFS_1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6915"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05961"
FT                   /db_xref="GOA:Q39NK5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK5"
FT                   /protein_id="ABB05961.1"
FT                   /translation="MTVAGNRVPLSRTATGVLAVAAGVAIANGYALQPSLSAIASEFGV
FT                   AASRMAALASVTMLGYLVGLAWLVPLVDRFSPRVLVSTQMGVLALLLACASWSPGPLAL
FT                   DAGFFLVGAATTVAAQCSAVAGKHADPHRRGVAMGAVSAGISAGILLSRFVGGVLSQWC
FT                   GWRGALLALAGCVALAAIGAAVLLPGGRPERLPGRANAIGAIPRLLRDSAQLRRRTCAG
FT                   MLWFFAFNLVWVGLALRLAEPPYRLGAAAIGAYSLAGVLGLGVTRVAGKLADRFGDRAV
FT                   IRGGLFMSAVSALLLAVALGRPGWLGVGLAMFDAGCFAAQVANQTRVVAIEPARAGALS
FT                   AAYLTLYYAAGAGGAVAAGLLNARAGWGAMMLVTAAAIAAAAWIGTASPRIDARSEPTS
FT                   AA"
FT   gene            470543..471250
FT                   /locus_tag="Bcep18194_C6916"
FT   CDS_pept        470543..471250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6916"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6916"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05962"
FT                   /db_xref="GOA:Q39NK4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK4"
FT                   /protein_id="ABB05962.1"
FT                   /translation="MEPDRSIPNTGGGLAGVHAEAGSPQALLDAIVRGVEGRGIPAGTD
FT                   WPTAKQSLADNEGQWKFSAVLVAIVARREPTILLTKRSPDLSEYSSHVSFPGGRPAESD
FT                   RDIGATALREAFEEIRLAPDAVRVAGSLPIHQTRKRNHAIFPVIGIVPETAKWEAAPAE
FT                   VAEIFEFPFAALLNPDLPRQYTDGERTGAWYWAEQTQDIWGVTALILKSLAGLVRDAVR
FT                   GDAFMHRAFVRQG"
FT   gene            471254..472645
FT                   /locus_tag="Bcep18194_C6917"
FT   CDS_pept        471254..472645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6917"
FT                   /product="Drug resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6917"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05963"
FT                   /db_xref="GOA:Q39NK3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK3"
FT                   /protein_id="ABB05963.1"
FT                   /translation="MEMAETFGDEGFDIPRRYFAAVAILVGVFMSALDSAIVNIALPTI
FT                   SADLHVSAASVIWVANGYQVASAATMLTCASLGSRIGERRFYTIGLVLFTIASLGCGLA
FT                   STFGALVVMRILQGISYAILISVGYGLYRVIFPPASLGTIFGVNALIFAVGTAVGPALG
FT                   GLIVSWASWPWLFFINLPFGIAAIAFSFVALGKDTHRERGFDVPGAVTSAAAFGLFALA
FT                   VDQIGRWSNRTVLVLAVAAAALMLAFCIGQTRARHPLLPLDIFRSRRYTFAVLTSVTMF
FT                   VSQGMALVALPFVLQHTYAYSVLKSALVFTPWPIAVALCAPFAGRLANRFNATQLSSVG
FT                   VLTFCLGIGSLILLPAQPTVGDFLWRVALCGVGYGFFLPPNNKEMFANAAKNRTATASG
FT                   VLSTARTTGQSIGAALVAVVIALVGGAGGGGGERLFPVYVFALACAIAALSFFASIARI
FT                   YRQRG"
FT   gene            complement(472692..473663)
FT                   /locus_tag="Bcep18194_C6918"
FT   CDS_pept        complement(472692..473663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6918"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6918"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05964"
FT                   /db_xref="GOA:Q39NK2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK2"
FT                   /protein_id="ABB05964.1"
FT                   /translation="MSTAPTSARSPSLPPRDRKRLVTLLRALAPDEGYNLTALPSVRIL
FT                   RSNRALSRTPVLYDPGIVIVCQGCKRGYFGGERYLYDEHHYLAVSVPVPFSMETDATPE
FT                   RPLLALYLHLDFTMAAELAAQIDRAGIAESVQAPRSMMSTPMDETMHTSVLRFVEAMHR
FT                   PLDAAVLGPALLRELYFRVLTGAQGSAMRSALAMRGQFGRIGRSLRVIHADYAQPLDVP
FT                   QLADEAGMSVPSFHSHFKAITQVSPMQYLKSTRLHQARLLMVREDLTAEAAGYAVGYAS
FT                   PSQFSREFKRLFGLTPAKETQRMRESFAIPAAFEDAAFVSSH"
FT   gene            473758..474588
FT                   /locus_tag="Bcep18194_C6919"
FT   CDS_pept        473758..474588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6919"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6919"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05965"
FT                   /db_xref="GOA:Q39NK1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK1"
FT                   /protein_id="ABB05965.1"
FT                   /translation="MASSKLMLITGVSSGFGRALAQEALAAGHTVVGTVRSAQAARDFD
FT                   VLSAQAFARVLDVTDFDRIDGVVADIEANVGPVDVLVNNAGYGHEGIMEEAPLAEMRRQ
FT                   FDVNVFGAVAMMKAVVPFMRERRRGHILNITSMGGHITMPGITYYCGSKFALEGISESL
FT                   GKELEPFGIAVTAVAPGSFRTEWAGRSMLRTPRSIADYDAIFDPIRQAREEKSGKQLGD
FT                   PAKAARAMLAVIAADHPPAHLLLGSDALRLVRGKLAALDEEIRAWEAVTVSTDG"
FT   gene            474748..475584
FT                   /locus_tag="Bcep18194_C6920"
FT   CDS_pept        474748..475584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6920"
FT                   /product="Alpha/beta hydrolase"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6920"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05966"
FT                   /db_xref="GOA:Q39NK0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NK0"
FT                   /protein_id="ABB05966.1"
FT                   /translation="MPTVTTKDHVEIFYKDWGPKDAQPIMFHHGWPLSGDDWDAQMLFF
FT                   VQKGYRVVAHDRRGHGRSAQVSDGHDMDHYAADAFAVVEALDLRNAVHIGHSTGGGEVA
FT                   RYVAKHGEPAGRVAKAVLVSAVPPLMLKTASNPEGLPLEVFDGFRKALADNRAQFFLDV
FT                   PSGPFYGFNREGATVHQGVIRNWWRQGMEGSAKAHYEGIKAFSETDQTEDLKSISVPTL
FT                   VLHGEDDQIVPIADAALKSIKLLKNGTLKTYPGYSHGMLTVNADVLNADLLAFVQA"
FT   gene            complement(475696..476616)
FT                   /locus_tag="Bcep18194_C6921"
FT   CDS_pept        complement(475696..476616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6921"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6921"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05967"
FT                   /db_xref="GOA:Q39NJ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ9"
FT                   /protein_id="ABB05967.1"
FT                   /translation="MKAKPLPPVYALRAFESAARTGSFTLAAEELSLTQSAVSKHVRTL
FT                   EAYFGRKLFVRRGPKMTVTAEAHIFASGLRRGFRQIEEACVLFQSQRDVLRLKAPSTLT
FT                   MRWLLDALAAFRDTRPAFEVQIASVWMDVDTVDFFSESYDCAILLGAGKFGEATQCVKL
FT                   FDEWLIPVCSRATATVARTNPAACELIHPSPDRRDWRRWLKGSGHDLEVDITRGQVFDM
FT                   LEQGIAAAIAGHGLSIGDLALCATAIDEKQLVLPFKTAVNTGDAYYLIWPDDSAKAAQV
FT                   RELLAFLESRMPRLTFPGIRFNGPG"
FT   gene            476782..477432
FT                   /locus_tag="Bcep18194_C6922"
FT   CDS_pept        476782..477432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6922"
FT                   /product="Lysine exporter family(LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6922"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05968"
FT                   /db_xref="GOA:Q39NJ8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ8"
FT                   /protein_id="ABB05968.1"
FT                   /translation="MALHYPLLFAYLAAIVLLIATPGPVVMLVVGTVARRGFRQGMLTA
FT                   VGANAASLVMIAGAMLMVFGVVLVSERLLTGLHVAGCIFIAVLAIRTLLGEWRAGRSRN
FT                   GNDAAQGEPASQARRLPGVVRGFLVGIANPKDLLFFVAFFPQFVGITPDSRVSLAILAV
FT                   LWIAVDFTILTSYMAAINHPLIHRKQRWITASSAGALLVIALAGLGGAIAGAA"
FT   gene            477491..477865
FT                   /locus_tag="Bcep18194_C6923"
FT   CDS_pept        477491..477865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6923"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6923"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05969"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ7"
FT                   /protein_id="ABB05969.1"
FT                   /translation="MSSPPPTFSEHLFSYGTLQLEPVQLATFGRKLDGREDAMPGYAMT
FT                   MLKIDDPEVVATSGKTHHPVVAYTGQSGDRVTGTVFAITPEELQHADDYEVDSYRRDRV
FT                   VLESGVAAWVYVDATSPRPA"
FT   gene            complement(477909..478625)
FT                   /locus_tag="Bcep18194_C6924"
FT   CDS_pept        complement(477909..478625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6924"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6924"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05970"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ6"
FT                   /protein_id="ABB05970.1"
FT                   /translation="MKRIACVACIALLLAGRVALAGTVDAARYDAFWLWAGVKPQAVVH
FT                   GARTVYVLQGQIEASPRDESQVRVIAQGVALPPAPQARVWLVYRAHTLRWTPRVTQIML
FT                   AQLTRWRASGRTITGIQIDFDARTRHLQDYLEFLRSLRETLPADCRLSITGLLDWSSRI
FT                   DTDQVNQLRGIVDEVVVQTYQGRSTIPDYADYLPRVARLQLPFRIGIIQGGEWDAPPYL
FT                   ATNPWFRGYVVFLRND"
FT   gene            complement(478633..480804)
FT                   /locus_tag="Bcep18194_C6925"
FT   CDS_pept        complement(478633..480804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6925"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05971"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ5"
FT                   /protein_id="ABB05971.1"
FT                   /translation="MPNSPLLHRNLFAALAASLLWIPAAHASGDDGCYAPTTLRQTNYS
FT                   CANVPMLSPANDTRINAMLMMVDSAKVAQAFPDPKTIPAKDRINQIIVPFPMDFSGWIS
FT                   IGQKEPDKTDGAADTGTPSNQYADGEGSICRSMTSGADAFSDALGGAGGLPADEATRLR
FT                   AARADIAQKTCAAGGASAAWTKPPVKSPLGQQFAAYLDGTNAFYRADFLTATKAFANAS
FT                   HSANPWLKETGLYMAGRAQLNAAQANVFDNDSPTPTRGRVTKVSLDAANTVFRTYLKVY
FT                   PQGRYATSATGLLRRVAWLGGNVTQQADLYGHALARWSPATSNVPLIQLANELDSKLLF
FT                   GSDYDASQIQSPTVLATVDLLRMRTSENSDSSRAKPLTLDELQAQKPRFANAPALYDYL
FT                   LATWYVQIGHKPDAALALLPQTPAEPLDYFGLSQQALRGFALEDSGQSDKARQLWRDLI
FT                   PLAKFRFQREALELALAINLEQAGLVNDAFADDSPVQNAAIRAVLLQRSANADLLRAQA
FT                   QNQATGGAMRDTALYTLLYKELTRSHYAEYIADAVLVSGKPADPLKPFIAAGAKNEDGY
FT                   ACPSANDIAAALQQNPADAKGLNCLADFVRLHPPAPGLENDPVPMWIRNASTTAATRIP
FT                   PTLGAGPSQFAGKPYERMSSYVTVMADAQANPNDRAYAYYRAIKCYAPGGSNECGGKDV
FT                   PKNVRKRWFDTLKASYAGSPWAQKLRYYW"
FT   gene            481260..482768
FT                   /locus_tag="Bcep18194_C6926"
FT   CDS_pept        481260..482768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6926"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6926"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05972"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ4"
FT                   /protein_id="ABB05972.1"
FT                   /translation="MKPITWMVMAVALALSACGGDDVAKNDGASLSSPNNPGSPSGPTS
FT                   PGGGSNGGPTGGSGPTQPQAGWSKAAAVDGKGPEGQPSVTLDASGNALATWMTNGPAGM
FT                   SGNEMWGARYAAGSGWGSATRLDTSDGSHAMNTLIGVQPKLVGNASGQAVAFWTEWTPG
FT                   PNTYALWARPYSPGSGWGTPVTLAADMAGSSYSAGMDSQGNALVTWTQSISLLDTRIAW
FT                   TRYTQAGQWSPTALVQMPVQSGPGAVTGDTDNVRPMLSVLSSGRAVLAWRQTNHTKSAL
FT                   WTATYDATNGWTNVNQVVSNASLFTTIISPVAGMDAKGNITLVWGQLDVTGGKLYTATM
FT                   SQRYVSGTGWQPAQPVAPAIVVPTGFIATPMLTVNENGVAAAMWGESGAVLQASVSDAN
FT                   GNWGALQKLTEHLNGAALQYPPLVIDLAGNVTVAWEDTGTPNASVLLVGGYRNGAWSTA
FT                   TLDPQDGTWPALAVNAAGAMALVWQGFAANIGSQIQSSFYTPGS"
FT   gene            482801..483133
FT                   /locus_tag="Bcep18194_C6927"
FT   CDS_pept        482801..483133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6927"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6927"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05973"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ3"
FT                   /protein_id="ABB05973.1"
FT                   /translation="MKKILQRTVTLRTVLGAAVAGLVLSACGSTQMNMIDVQTSTAKTL
FT                   GLASSDEITVANVQYGKKDGLGGQKVSYDATTGKGRRFGCTVFMIPGLTPIDRPTYNNW
FT                   ECHPQR"
FT   gene            483282..484334
FT                   /locus_tag="Bcep18194_C6928"
FT   CDS_pept        483282..484334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6928"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6928"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05974"
FT                   /db_xref="GOA:Q39NJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ2"
FT                   /protein_id="ABB05974.1"
FT                   /translation="MDQAAFVPVFKFRTIDYPEQDRFHVWVKDMLCDYRLDDDGGHGAF
FT                   DAEASGAALGPLILSGRHWRSRAPAYRVNRTTRRIRLDGQDSIRFTLLLGGRLASHTGG
FT                   PELVKGAGDVFVYDVAQVNDCRVEAGDVISLVVPRYLLPSHAAQAHGQTLTSGVGRLLG
FT                   DHMLSLFRNLPNLRTHEIPSIVQSMLLLLGAAVSPTAQALQDARGPIDEALAERVRRYI
FT                   DVHLLEPDLDPDRICRDIGVSRARLYQLFKEDGGVMRQITRRRLRHAYHVLGDPQRRHQ
FT                   RIAEIAWAHGFPDEKYFHRLFKAEFGHTPKETLECATAPVLLPCDAAEDRWADGGRLTG
FT                   WTLPFGVLTN"
FT   gene            complement(484380..485792)
FT                   /locus_tag="Bcep18194_C6929"
FT   CDS_pept        complement(484380..485792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6929"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6929"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05975"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ1"
FT                   /protein_id="ABB05975.1"
FT                   /translation="MSLTPLPALLDETLRTVARRYRLPPLDSALSPADAANPAATLAIV
FT                   IEEARRMRSDGQTPDAILRQRFIDALAQMIRDAMDTHAGDPAFQAAVLRHDAPSVREYA
FT                   SLSAHAEQDRRALHSAVNAIAHPAKLERSARPWQRDGLARLHAAATAASWADLHDTLRH
FT                   LLALPDMATDAAFEQDIVKLKDSPALERMLRVDALASDAHVRRYRALWVRQGPLEGSTV
FT                   AVAQGVASQQRGAAVEALAAQALDALARRLDAVDARRTYRVVTSMRVPSSIPGRHDRAK
FT                   TEWDSILLERTRGDDPAPVWNVRFLVEAKASADAATTDLPRLLRGLNLLAQADPATTYA
FT                   FETHQGTVRVHGASLHALTTDEAALPREVLYCCDASADTTPRLLGAASRMQLLSAQASL
FT                   EYASALAQRPDADPGSLGVVWHALLTLPQWQAVLHQYPSLRQVRELMVAIDDLRAAIDD
FT                   VDEDGIASSVYA"
FT   gene            complement(485932..486486)
FT                   /locus_tag="Bcep18194_C6930"
FT   CDS_pept        complement(485932..486486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6930"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6930"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05976"
FT                   /db_xref="GOA:Q39NJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NJ0"
FT                   /protein_id="ABB05976.1"
FT                   /translation="MDETTGATRRTASYRIANEQDVDALVELVNAAYRPTTAAAGWTHE
FT                   AALIDGPRITSSQLAATLQAPDTVLLVAEIDAAIAGCIEVRKDGGAAYIGTLAVAPSMQ
FT                   DRGLGKALLNEAEQFAVRRWNLETAVMVVLSARHELIDFYLRRGYTRTGERSGYPFDAG
FT                   VGRPRDETLTIETLTRNIARD"
FT   gene            486714..487634
FT                   /locus_tag="Bcep18194_C6931"
FT   CDS_pept        486714..487634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6931"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6931"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05977"
FT                   /db_xref="GOA:Q39NI9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI9"
FT                   /protein_id="ABB05977.1"
FT                   /translation="MQQPVMPRSPPAVADLLLLLALSTLWGASYTFIRIGVETIPPLTL
FT                   IAARTLIAGSVLLLWMRIRRIPMPSDLAVWRRFFVQALLNSVVPFTLIAWAERSVEAGL
FT                   ATILNSASPVLAFVGTWLITRHEPLTPRKLFGVVAGLVGISLVVGVSAFDGLGRQLVSQ
FT                   LAIVAATVCYAGAAIYGRAFSGLSPAVPAAGSLIVGAVVLVPASIVVDRPWTLHPSPPS
FT                   LIALAALAVFSTALALVIYFRLVQSLGSVGTTAQAYLRVPIGVGISMALLGESLSASAW
FT                   VGLGCVVAGVAAMTLPSRRRGQPRS"
FT   gene            complement(487804..488565)
FT                   /locus_tag="Bcep18194_C6932"
FT   CDS_pept        complement(487804..488565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6932"
FT                   /product="2-keto-4-pentenoate hydratase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6932"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05978"
FT                   /db_xref="GOA:Q39NI8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI8"
FT                   /protein_id="ABB05978.1"
FT                   /translation="MTTTSERVDGAAQHLVAARHAGSPGPLLPDALRPENVETALAIQQ
FT                   RVADLLGEPVGGWKCALPPPDRVILAPIFASTIREADAPYRVVGGPIVRIEPEIAFVLD
FT                   RDLPARDQPYDEQDVRDAIREVRIVLEVLGCRYAEPTRASKFELLADGQFNQGLCVGPV
FT                   VPDGLNVPLETLALSFEGALNRAIDGRHPDGDPLKPLVWLVNFLASRGEPLRAGQIVTT
FT                   GSYAGAIDVPLGDALTVRFGELGSLSVTLTA"
FT   gene            488957..490195
FT                   /locus_tag="Bcep18194_C6933"
FT   CDS_pept        488957..490195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6933"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6933"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05979"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI7"
FT                   /protein_id="ABB05979.1"
FT                   /translation="MFNRLRAATFAVLSVLAAQVCAAPVTLDVTGWKGGGAEPANMAEL
FT                   IAKFEKENPDIKVKFEYMSRNDTTTVVSSRLQGGNGPDVLMVDRELMRQWQGAHQLLDL
FT                   SGEKWVPTIWRGVRSHTQIGGKTYMLPMELVGIGLFANLDLFKRAGIATVPTDVDQLKA
FT                   ACGKLAAAGITPMLLPAKEGWAPAALVIASGLAAGGGGDADARAESFVGAGSARFAADP
FT                   AFKQSMAALKVLADAKCFVPRLNNGVSAWSTGLTEFQAGRVAMMPQGAWNIAKFSATKG
FT                   LSFQFAPLPALVPGNGPVALDMLGTAWAINAASHQADAAKKWLAFWARSDNDRQFLDAE
FT                   AGFSPFEGGTDAMPPQAQPYAAAQKNGHVVLYPKGVWTGSLFTAIWNSMSAYFLDIGQD
FT                   PAKLLARWDAAAR"
FT   gene            490266..491135
FT                   /locus_tag="Bcep18194_C6934"
FT   CDS_pept        490266..491135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6934"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6934"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05980"
FT                   /db_xref="GOA:Q39NI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI6"
FT                   /protein_id="ABB05980.1"
FT                   /translation="MKRNRTLLWCAVPALALYALLSLYPLFKAARMSLTDFSGVGDAHW
FT                   IGLANYAAAFRDPASLHTLVVTFAYAAIVVIVQNGLGLLFAALLFSLPRLRGALRVGLL
FT                   VPSMFSAVIAGFVWEYLYSPLGGGINELLHLVHLDALQQVWLGDPSVTLPAVTAVHVWM
FT                   YVGYSTAIFLAGYLNIPSELHDAAKLDGANAWVRFTRIDLPLLAPAFTVNITLSTIGTL
FT                   KTFELPLVLTNGGPDGATTTLGLQIFHSLFNDYKFGFASALSMIMLAIVVVVATTQNTI
FT                   LRRREDNL"
FT   gene            491132..492034
FT                   /locus_tag="Bcep18194_C6935"
FT   CDS_pept        491132..492034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6935"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6935"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05981"
FT                   /db_xref="GOA:Q39NI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI5"
FT                   /protein_id="ABB05981.1"
FT                   /translation="MNVIRQRFHADQPSTGTSGGGLRTSALLRRVPGFARLVAAIAIVA
FT                   IVLLPTIYMVLMSLRTGDDIIARPLGLPDHVFFGNYAAVFTQMNYWRSVANTIGITLAV
FT                   TFLVALLSSLAAYPLARVKGRLSNAVYIVLTLGLTIPMFVSLTPLYVLFRDLHLLNTYL
FT                   GVVLAYTVQSLPLGVFFYTSFLKRIPLELEEAAVMDGCSPLQVYWYIVLPLLRPITGTL
FT                   AMFVTLSVWNDLVYPLLFLTDSSKFTITVAVFRFIGTNDIDPTKLFPAAVMGTLPLLVL
FT                   FFILQRKIVAGITAGAVKG"
FT   gene            492039..492824
FT                   /locus_tag="Bcep18194_C6936"
FT   CDS_pept        492039..492824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6936"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6936"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05982"
FT                   /db_xref="GOA:Q39NI4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI4"
FT                   /protein_id="ABB05982.1"
FT                   /translation="MNPFESLDGRVIVVTGGGDGIGLGIVDVLAQCGAQVVVAEKNAAR
FT                   ADAVRERLGGRDALFVETDVAEPASVAALFERVDAHHGRLDGLVNNAGITLHGPFDAFS
FT                   LDDCDRLYRTNLRSMFQCAQLAAPRIARAGGGAIVNIASNHAGASVPGFEMYAATKGGI
FT                   VAMSRAMATSLAPQRIRVNTLSPGFTLNAPIGAALERDPALLDAYRALHPAQRINEPAD
FT                   IGRIAAFLLSDAAAGIAGADLVADNGMSALLFNRTRSST"
FT   gene            492821..493966
FT                   /locus_tag="Bcep18194_C6937"
FT   CDS_pept        492821..493966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6937"
FT                   /product="galactonate dehydratase"
FT                   /EC_number="4.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6937"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05983"
FT                   /db_xref="GOA:Q39NI3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI3"
FT                   /protein_id="ABB05983.1"
FT                   /translation="MKITEIETFAVAPRWQFVKVSTDEGLAGWGEPIVEGRAATTAAAV
FT                   HELADYLIGRDPRHIEDLFQVMYRGGFYRGGPILTSAISGIEQALWDIKARALGVPVYD
FT                   LLGGPVRDKARVYAHVKGDTPEDMAANARQLVEAGYTALKMGVVNATDWIESPAAIDRA
FT                   VARFGTVRDAIGKEVGLGIDFHGRVRRPVAKALAKALAPFDPMFYEELLLPEHNDALRE
FT                   VARDCAVPLATGERLFTRWQFKELLQEGVVDIVQPDVSHTGGIWELRKIAAMAEAYDVA
FT                   VAPHCPLGPLTLAASLQIDFCTPNAFIQEQSTNVAYHDDNAMYAYTRGIPFAFDAGYVA
FT                   RPDAPGLGVEIDEEKVREAAAIGHRWRNPVWRREDGSVAEW"
FT   gene            493998..495077
FT                   /locus_tag="Bcep18194_C6938"
FT   CDS_pept        493998..495077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6938"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /EC_number="3.6.3.25"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6938"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05984"
FT                   /db_xref="GOA:Q39NI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI2"
FT                   /protein_id="ABB05984.1"
FT                   /translation="MASVSLKQIRKRYDDGADVIKDVSLDIEDGEFMVFVGPSGCGKST
FT                   MLRMLAGLEEITSGDLLIDGRRVNDVPAAKRGLAMVFQNYALYPHMTVFENMAFGLKLA
FT                   GVDAAETRTRVGQAAEALRLSALLDRKPKALSGGQRQRVAIGRAIVRKPGVFLFDEPLS
FT                   NLDAALRGGMRLELARLHRELGSTMIYVTHDQVEAMTLGDRIAVFNGGRIEQVGSPLAL
FT                   YEQPANHFVASFLGSPSMNFLPCRAHGGADALRFDVPGGSLATTPDATRSWPSGSLQLG
FT                   IRPENLTVGAPGTGLDGRVTHAEHLGDATIVYVELAGHDRPLSVRQNRDAYTVAAGQPV
FT                   GVRFDMWHAHFFDDAGRAL"
FT   gene            495130..496056
FT                   /locus_tag="Bcep18194_C6939"
FT   CDS_pept        495130..496056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6939"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6939"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05985"
FT                   /db_xref="GOA:Q39NI1"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI1"
FT                   /protein_id="ABB05985.1"
FT                   /translation="MHKNRISMTTVKLVQGANAILGEGPLWCERSASLYWIDIKRTALY
FT                   RYTPGHGQTGFWLLPELAGCVASVDDGRLLVALKSGLHLFDPAHGTLERLADAAHARPS
FT                   LRYNDGAVDARGRFWVGTMADDGDGPGDLHCFEHAHASRVAVAGFACANGMGWSPDGST
FT                   MYVTDSGRRTIFAYDFDVDAGRLSNARPFATFGDARGVPDGLAVDAEGGVWSAIWDGWR
FT                   LHRYAPDGALDQVVEMPVQRPTSVAFGGADRATLFVTSASVNVSADGLLRGPLAGSLFE
FT                   TRPGVAGLEQHCVARAWLGDAVAATPR"
FT   gene            complement(496079..497158)
FT                   /locus_tag="Bcep18194_C6940"
FT   CDS_pept        complement(496079..497158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6940"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6940"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05986"
FT                   /db_xref="GOA:Q39NI0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NI0"
FT                   /protein_id="ABB05986.1"
FT                   /translation="MAAMPPHGRRHRRACYARRQNALTLTFIVAKINEVAAAAGVSIGT
FT                   VSKFINKTKRFSPDVERRIAEAIEQLGYESNPLARSMATGQTGAVGVVIQDILNPYFTA
FT                   MVKGVNRIAQRNDFVVLIVDADENRKGERPALTKLSRRVDGLILNTSMPDDDLRWTASL
FT                   GKPVVAVGSAPRDGLLTLYSDPVRAGEMLAQHLLMEKYQRFAYISLPNARGDDERRAGA
FT                   EQVLARAGLPLRTFSVPRATVADGERVCASVMLSAEPPDAVICYNDMIAAGFIKEAERL
FT                   GIAIPHDVAVCGFDNLELGKLTSPTLTSIDTETERAGEVAMTTLLDALAGKSPAPHTML
FT                   ESRLVVRESTVRPRDARRR"
FT   gene            497394..498515
FT                   /locus_tag="Bcep18194_C6941"
FT   CDS_pept        497394..498515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6941"
FT                   /product="outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6941"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05987"
FT                   /db_xref="GOA:Q39NH9"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH9"
FT                   /protein_id="ABB05987.1"
FT                   /translation="MRQYGWIAALALAVPAVAQAQSSVTVWGRVGGDVQYLSGVQNGPH
FT                   STGSRFSEGNDWGTSILGITGKEDLGGGNQAVFWLESSINAANGNYGGGVLFQRGAWVG
FT                   FKNERYGFLRLGQGSFINSYIWSYDPLLEENYSVESLTSYRNGPKLSNGIRYESPKFGG
FT                   FSFALQANLGNSSNGWLRGSTNNVGATGLSDGATVAYTHGDFEVRAIWNEIRNQYGRED
FT                   NLFTASQEAFIGVRDRFGPALVQIGYTRYSAPDTPAGLSRTANYYWGGVTYDATPFLHL
FT                   QSAVYSMKIDAGQWTADHSGEGRSTIIGLGAMYDLSKRTFLYATAAHVFNSAGANLGVN
FT                   PQSPGLGNGNGLGASPMPGHGQTGVYAGIETLF"
FT   gene            498565..499707
FT                   /locus_tag="Bcep18194_C6942"
FT   CDS_pept        498565..499707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6942"
FT                   /product="2-keto-3-deoxygalactonate kinase"
FT                   /EC_number="2.7.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6942"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05988"
FT                   /db_xref="GOA:Q39NH8"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH8"
FT                   /protein_id="ABB05988.1"
FT                   /translation="MQDATPRPGGQAPVPRLIALDWGTTSLRAYLMADARTVLDERAAP
FT                   KGVMQLGGTGIAIADACDAAFEDVCGGWLDAWPALPVVAAGMVGSTQGWREAPYAGVPI
FT                   DATRLGASLQTVRARRGVTVHIVPGLIQRGELANVMRGEETQIVGALQAGGATHGATNG
FT                   TAPVRWIGLPGTHSKWVAVRGSRIERFCTFMTGELYALLCTHSLLGRTMQPSAGFLRDA
FT                   FERGVRAAQAGHATGLLATIFGSRARLLAGDLAPAEQADYLSGVLIGHELAGLAAEPCG
FT                   PGGAARDAALRPMLIGDAVLCERYKHAASLFGWPPVDTIDGAAAAGLWVLAERAGLLPA
FT                   ASEEGAPVRVDEPAAGMSGRHEDRPAVDSIPDHECHISGD"
FT   gene            499686..501494
FT                   /locus_tag="Bcep18194_C6943"
FT   CDS_pept        499686..501494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6943"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6943"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05989"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH7"
FT                   /protein_id="ABB05989.1"
FT                   /translation="MPYFGRLTLKHWKIVAAPLIGALAACGGGESADGVAAGQQLAAVP
FT                   AAAAEKATIEVPGTLHVDCSLGSNGTGSPATLGSTANPIHDLATLNRIVLTPGMHVRFK
FT                   RGTTCDGSFAPAPGSTGAAGAPIVVDAYGDPKAPRPVIAAGCTDATADPDQSITEQHKT
FT                   PSGFSGYYSLCKSDNPTVNRAAISLYNTQYWEIRSLELTNDATTPGGRLGLYVRLEDYG
FT                   TGSHYHVDDVYVHHVRGYLKDVASNTVGSYKTTGGMLFEVTRDNEAVGTKETRTGFDDI
FT                   AVENSEIYNVDAVALSTRSAWMCREGGAPCGDYPPYKGNSAYLTNPATQAATDYFPMTH
FT                   VVFRNNLIHNVGGDGIIVRTATAPQVEANHLYDIWMRAPGNSAGAWAINTDDALFRYNE
FT                   VNGVRLQNNIEAGDGMAFDADLGTRNTRVAANFSHDNDGGLMLFCGCGSDGLGHVAQET
FT                   GAIVENNLSLNDKRRIVSAAGSADSVVRDNVVITRTPGLVTPIVENLSYANAFQVTGNR
FT                   FYNASDSGAIFRTKNAQGSYANIVWSGNTYFGYAADPEFTGPNYRHGAQPDTVLPFAGQ
FT                   DVDAVASAWSRDSGFDKHKYRAPHAR"
FT   gene            501655..502128
FT                   /locus_tag="Bcep18194_C6944"
FT   CDS_pept        501655..502128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6944"
FT                   /product="Universal stress protein, UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6944"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05990"
FT                   /db_xref="GOA:Q39NH6"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH6"
FT                   /protein_id="ABB05990.1"
FT                   /translation="MYKKIMVAVDGSASSKQALAEAVKVALAGDAHVSVVYVVDKSVLF
FT                   TYAGRFDPHALVEEIRDDGRKVLREAEQIIALAGAKGEAELVETESIGEDIAERLQRYV
FT                   KECGIDLAVVGTHGRRGIRRVLLGSVAERFVRGSKCPVLLIRGDDDDVAAAAA"
FT   gene            502144..502335
FT                   /locus_tag="Bcep18194_C6945"
FT   CDS_pept        502144..502335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6945"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05991"
FT                   /db_xref="GOA:Q39NH5"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH5"
FT                   /protein_id="ABB05991.1"
FT                   /translation="MIRRQYRIVVAAIAVFVSLAGMMAVVSGLLFDNATALRGGAIALV
FT                   VGVAGFVVMLNPGAKGEG"
FT   gene            502423..502983
FT                   /locus_tag="Bcep18194_C6946"
FT   CDS_pept        502423..502983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6946"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05992"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH4"
FT                   /protein_id="ABB05992.1"
FT                   /translation="MKTRDLAAIGVVIGAAVLPVLSWAGTAAPPAGFGSHASSGTSATG
FT                   TSGVSGQHPAADRYGDHSTDFTDTIGGIDSQGDGIRDDVRAYIDDQYPDPLQRAAMRRY
FT                   AAVQRDFMMHGDTRAGAIEGFTRVFRSLECVSRLMGQPGVNQSKIIAAMMSNTRQRFAA
FT                   NGHAMANASGHIYMQSQGDPCAQ"
FT   gene            complement(503026..504264)
FT                   /locus_tag="Bcep18194_C6947"
FT   CDS_pept        complement(503026..504264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6947"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6947"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05993"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH3"
FT                   /protein_id="ABB05993.1"
FT                   /translation="MHFRPSVNNTFTNKNRKFMTSRLLAALVAAALSCTALPAAYARTY
FT                   VAPTASFGKGAYVHQFVLRDPATHQPLPNARYRLFLPGQVIAGLPVKPDEHDSVIFGTT
FT                   DAAGRTVRVRLPKLHPEKQWVFNPIVGDGDLGESFRLVEPGGSAPIGHFPYVLDVENEY
FT                   LACGYSDANGYTYYAQSRTPRNVNLYAGTLAGSADTDWCAGPGLTIANSANAPGAPDLY
FT                   TQYLGSLVANRDRISSDLRQQIVAKLLSLAIAEHDEGRVAAALDLDRIPDDRRNDIGYR
FT                   LADAGVAVERGLAMIDAHLAESPDDAYALDSKGWALYRLGRNDEALTWFDRSIAIFAKD
FT                   GDKDKDASEAHAIGLTHKGEVLWKLGRQDEARDAFAQARKVQPKNEELAETLKRLNVQA
FT                   IPDSAASPGTTGT"
FT   gene            504512..506248
FT                   /locus_tag="Bcep18194_C6948"
FT   CDS_pept        504512..506248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6948"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6948"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05994"
FT                   /db_xref="GOA:Q39NH2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH2"
FT                   /protein_id="ABB05994.1"
FT                   /translation="MNPRLASLPSSDSTPAPAGFPDADELAALRAWYAGMTVRQAVERY
FT                   LPDRLGEGRSARGVIGGIRRRLVRVARQAGRPDLAEQLGHPDGERTREARAAAEAIGLL
FT                   RHARAPVPQISDDVGQWLPARAVVALRAHGIATLADLTVRIPRRRQWWRAIAGLGVASA
FT                   RNIEAFFAAHPALTERARALIATTPRGSIVPWEQLKLPHEVDGSAGTFRAPRATSTLDA
FT                   DNDYAAVHAWLSLHESAATRRAYRKEAERLILWAIVERGRALSSLTTEDAVAYRAFVRR
FT                   PTPHERWVGPVRPRGAPDWRPFSGALSARSAAYTLSVLGALFRWLIEQRYLLANPFAGV
FT                   KVRDTRGANALDTSHAFTEGEWLLVRTIADGLEFRKSTGTGTPQSGWTPAAAQRLRFIL
FT                   DFGYATGLRASELVGATLGDIETDAHGDAWLKVIGKGSKAARVALPPLARTGLDRFLVA
FT                   RRLPVTPSRWRPDTPLIPSLAEDGAAAITSVRLWKVMQRFFAQTADQVDADNPALAQKL
FT                   RQASPHWMRHTHATHALARGAELTTVRDNLRHASISTTSIYLHGDDVKRARQMSSAFAA
FT                   DK"
FT   gene            complement(506288..507004)
FT                   /locus_tag="Bcep18194_C6949"
FT   CDS_pept        complement(506288..507004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6949"
FT                   /product="ThiJ/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6949"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05995"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH1"
FT                   /protein_id="ABB05995.1"
FT                   /translation="MATTPFIVVFALFDHVTQLDFTGPDEVFWRLPGARIHRASVRGGS
FT                   IRADSGLILAEVERLADIAHADLVCVPGGLGVIDAIADDAFVSEVRRLALGARYVTSVC
FT                   SGSLVLGAAGLLQGRRAACHWAWRDLLPPFGAIVDTGRVVRDGPVVTGGGVTAGIDMAL
FT                   SVMADITGPEYAQAVQLGIEYAPEPPFDCGRPERAAPDVLASVSALFERVRPDRHAVVA
FT                   RAAQNLAQPDAGRQPT"
FT   gene            507089..508021
FT                   /locus_tag="Bcep18194_C6950"
FT   CDS_pept        507089..508021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6950"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6950"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05996"
FT                   /db_xref="GOA:Q39NH0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NH0"
FT                   /protein_id="ABB05996.1"
FT                   /translation="MTHRVAMLVYPGFQLLDAAGPVAAFEMADYARTPHYAVRVVAAQP
FT                   GLVRSSSGVSWHAEPLPEAADLDTLLVAGGDGVDAAMVDDATCAFVRRCAARGIRVASV
FT                   CSGSLLLAAAGVLDGRLATTHWGCGERFAQAFPQVRLALDRIYVNDGPFWTSAGITAGI
FT                   DLTLALIGEDRGERLARAVAKRLVVYYRRPGGQSQFSALIELDSAQGRFKPLLDFIRRN
FT                   LGARLRVSDLAEQACMSPRQFARAFQTETGLTPAKAVEKLRVEAARAALESGAASLQRV
FT                   ANECGFGDTENMRRSFQRWLGVAPSALRS"
FT   gene            508236..508559
FT                   /locus_tag="Bcep18194_C6951"
FT   CDS_pept        508236..508559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6951"
FT                   /product="TfoX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6951"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05997"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG9"
FT                   /protein_id="ABB05997.1"
FT                   /translation="MASSQGTVDFIVEQMAAAGTVSARKMFGEYGIYCDGKMAALVCDD
FT                   RLFVKPTPEGRAFLGTCEEGSPYPGAKPHLVISGERWDDREWLSALIRITAAQLPVPVK
FT                   RSR"
FT   gene            508648..509559
FT                   /locus_tag="Bcep18194_C6952"
FT   CDS_pept        508648..509559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6952"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6952"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05998"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG8"
FT                   /protein_id="ABB05998.1"
FT                   /translation="MNTSGHPRGTWLARRARHALVAALCVGWSALSFGADDAATLLERY
FT                   RSLGAQLKDNAFHRPLVLESAEASSSLKGDIYAVVDYPYTVVSSQLDDPAQGPANWCAV
FT                   LILHLNTKYCHASSGSNGPVLDVNLGRKIQQKLSDTYRVQFRYRVAAATPDYFQVDLTA
FT                   DSGPMGTKDYRIALEAVPVGASRTFLHLTYSYGFGTVGRMAMKTYLATVGSDKVGFTTV
FT                   SGGSAAQPQYIGGVRGLLERNTMRYYLAIDTYLATLDKPLDQRLTRWFDATEQYPQQLH
FT                   EVERGAYMQMKAQEVQRQQAAR"
FT   gene            complement(509585..511762)
FT                   /locus_tag="Bcep18194_C6953"
FT   CDS_pept        complement(509585..511762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6953"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6953"
FT                   /db_xref="EnsemblGenomes-Tr:ABB05999"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG7"
FT                   /protein_id="ABB05999.1"
FT                   /translation="MPDRDLAALLVARLTGRADHPRFTGTPIDLSTLDAHSLGAVWPAL
FT                   RRVEHEIMVRDQAFDDPRAEFARWLHGQIDALGLVPLVDADAALELFRDIPAGEWKRAL
FT                   EELPCLDTLPSPTLQAELARIAGEPDEGDVRSGSSTYGVYTLDRFAGRRDFSARRDAYA
FT                   QALADSPFRVRELDVLPALGPAGLLALAATNDGYFAPRRLWLDFSDPAITLAEDAAYVA
FT                   FARDALTEAAQQVAALHAGTVPYEADRAFTTDDAQVVARAARVAAYRDEAWLRPLIGPL
FT                   LTGVCVAPTAAKTAPSQSLAIALGHAVETIPTPESVRALRDALATVRHAGVQKKLARNL
FT                   KPAERALGERPHTALRMTLDAKPDKKQLAMLATCMEAGFWQSMTLGHAEWRERLVDAPA
FT                   GAAFAARMIWHARSADGSTRSFMPDIAKGKVVLRDVAGHAIDLAGDSDIRLWHPLLADA
FT                   DERLAWQRAIVGRTLRQPVRQAFREYYVPADGDTPASDSAMFEGHVLSSRPLVGVARRE
FT                   GWSIRAYDDGLVREFGDVRATFFVDARLYPGSESHGTSRRLHFERRHDRRWVPLPIGEI
FT                   DRVVFSEVARAVDLLVSVAAFALDDDATRAAAAALTVDPVRQRELEAERWQRLNRLSDV
FT                   PLGTMARHRRHVLSLVFAGPVAQGKMTIDERHVRVGAWSVHCATGRVMRDGEPVEPAIV
FT                   PPPSPLRAVPWLPYDEALLQRIVDVVAGLLD"
FT   gene            512360..513784
FT                   /locus_tag="Bcep18194_C6954"
FT   CDS_pept        512360..513784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6954"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6954"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06000"
FT                   /db_xref="GOA:Q39NG6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG6"
FT                   /protein_id="ABB06000.1"
FT                   /translation="MKLYEKLADDIERLIRQGVYRHGDRIPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDSHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVEFATKTGMPL
FT                   IENGVYNELYFGDAHPSSLKSYDRSGIVLHCSSFSKSLTAAYRIGWALPGRYRDQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRLRKAYAQQANLMRAMVSRFFPEGTRISS
FT                   PAGGYVLWVELPAQVDAMRLYQLALEQGITIGPGYMFSITDSYRNFIRLNYSSPWSPEI
FT                   EQAVITVGKLASACMR"
FT   gene            complement(513881..514774)
FT                   /locus_tag="Bcep18194_C6955"
FT   CDS_pept        complement(513881..514774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6955"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6955"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06001"
FT                   /db_xref="GOA:Q39NG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG5"
FT                   /protein_id="ABB06001.1"
FT                   /translation="MDPIADLEFFARLVTHGSLSALARDLGVTPPAVSARLNQIERRLG
FT                   VKLLNRTTRRLALTNEGEVYLATGSKLLEQVHELERTVSSSRNQPQGLLKVNATFGFGR
FT                   RHIVPALSAFRDRHPEVEIQLELTDRPMNLAELAYDVGIRFGELPDQRVVGRKLAANRR
FT                   FVCASPAYLKANGVPKVPGDLRGHRCIVLRENDTAYGTWHFTKGKRHELVKVHGVMSSN
FT                   DGEATLRWAIDGHGVLVRSEWDAQPFIDSGALTRVLADWSLPPSDIYAVYPERLNLSAK
FT                   VRVFIEFLCEYLERRA"
FT   gene            514891..516303
FT                   /locus_tag="Bcep18194_C6956"
FT   CDS_pept        514891..516303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6956"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6956"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06002"
FT                   /db_xref="GOA:Q39NG4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG4"
FT                   /protein_id="ABB06002.1"
FT                   /translation="MGQTLYRKIVASHTVSRVDAQHVVLYADLHIMNEYTSPQAFAGLA
FT                   ARNLPVRCPEKQMGIVDHVIPTHPVPVGQRMIVIDAAASQAANFTRNCRRHGIHLFDVQ
FT                   DTEQGIEHVVAPEIGLIRPGMVVLCGDSHTTTYGALGALGFGIGTSEVEHVLATQTLVY
FT                   RVARDMRIRVDGTLPAGTTSKDLVLYIISKIGAQGARGFVVEYCGPAIDALSAEARMTL
FT                   CNMTVEAGARGALIAPDATTVEYVRDRIRDLPAARLDEAAAQWTQLQSDADAPFDVTHR
FT                   FNAADVAPFVTWGTSPDQAIAITARIPALSAEPLERDNARKALDYMGLDAGQPIDGLHI
FT                   DHVFIGSCTNARIEDLRAVADVVRGRTVAPSVRAMVVPGSVAVREQAEREGVARTLIDA
FT                   GFEWRQPGCSMCLAMNDDILAPGQRCASTTNRNFEGRQGRGARTHLMSPAMAAAAALAG
FT                   RIVDVRKEFDHA"
FT   gene            516296..516934
FT                   /locus_tag="Bcep18194_C6957"
FT   CDS_pept        516296..516934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6957"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6957"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06003"
FT                   /db_xref="GOA:Q39NG3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG3"
FT                   /protein_id="ABB06003.1"
FT                   /translation="MREHASVTGIAAPLPLNNLDTDQIMPKQFLLGIDKSGLARGVLYD
FT                   LRHDGSGARRPDFVLNRPEYQEARILVAGANFGCGSSREHAVWGLQQAGFDAVIAPSFG
FT                   EIFYFNALNNRLLLVMLDPAVVSTLVEQARNPATCTLTIDVLRQVVRTAEGSEYPFDLP
FT                   ERQKRMFVEGRDMIGMTLADRDAIDAFEARHHAASPWMKIDLPKQQRAV"
FT   gene            517037..518359
FT                   /locus_tag="Bcep18194_C6958"
FT   CDS_pept        517037..518359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6958"
FT                   /product="Citrate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6958"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06004"
FT                   /db_xref="GOA:Q39NG2"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG2"
FT                   /protein_id="ABB06004.1"
FT                   /translation="MEASPVQTSLPPSTPLAWLLNLKIGGMPLPMFVAIAAVTILAAAT
FT                   KRLPNDMIGGFAVLMLSGLLLGEIGRRIPVFRHIGGPAILCLFVPSALLGYRLMDDATL
FT                   KAITVTMKTANLQYLYIACLVAGSILGMNRKILIQGFLKMFVPLLVGTVAAIAAGIAVG
FT                   FAFGYDPQHTFFYIVMPILGGGIGEGILPLSIGYAEITGAAQGHLIAMMVPAALIGNVV
FT                   AILASGMLKRFGEKHRRYSGDGLLVKTGEDRELLAAQQAEARLDLRLMGFGLLLACTLF
FT                   ILGGLLAPLTGIPGPVLMIVAAAVLKVCRAIPESMEIGAYQMYKFMSTNLTFAILVGLG
FT                   TLFVSWDKLVGAFSPGYFVICASIVIAMVVSGFFVGAALKMYPVESAIITACHSGLGGT
FT                   GDVAILSSSNRMGLMPFAQISTRIGGAAMVVFATIVMKWLH"
FT   gene            complement(518462..519901)
FT                   /locus_tag="Bcep18194_C6959"
FT   CDS_pept        complement(518462..519901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6959"
FT                   /product="Major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6959"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06005"
FT                   /db_xref="GOA:Q39NG1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG1"
FT                   /protein_id="ABB06005.1"
FT                   /translation="MHQTVTAGGAPLDTPQVRAGIRAGADISARMDRLPITRHQWMLVL
FT                   LISLGGFFEVYDLIFTGYIAPGMAKSGLLQTTTQAFFGFTGIAAFIAATFAGLFVGTFG
FT                   FGWMPDRYGRRAVFTYSLLWYSIGSAIMAFQTTPEGVLLWRFITGIGVGLEIVTIDTYV
FT                   TELVPQHMRGRAIAFNQVVMFAAAPVAAILSWWLVPTTVFGLDGWRVVVLAGSAGAVIV
FT                   WFIRRAVPESPRWLAAHGDAERSERIVSRMEAIAERESGMPLPPPAPASEAPEVHRAAF
FT                   AALWRAPYRARLLMLVAFNFCQAIGYYGFANWVPTLLIGQGITVTKSLLYAFVIAFAMP
FT                   AGPLLAMRYADRIQRKHLIVGGALAVIACGLAFAQVKTVAPLIVLGVLISLAGQTISVA
FT                   YHAYQCELFPTEVRSRASGIAYSASRAGAMMSGFIIAALLKDFGVSGVFTGITVFMLVV
FT                   VIVIGTFGPRTNGVRLEELNR"
FT   gene            complement(520066..521217)
FT                   /locus_tag="Bcep18194_C6960"
FT   CDS_pept        complement(520066..521217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6960"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6960"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06006"
FT                   /db_xref="GOA:Q39NG0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NG0"
FT                   /protein_id="ABB06006.1"
FT                   /translation="MSHDTRLPLDGIRVIEFTHMVMGPTCGMILADLGAEVIKIEPPGG
FT                   DKTRNLPGLGIGFFRSFNRNKKSVVLDLHTPEGREAAVELIGTCDVMLENFRPGLMASL
FT                   GLDYDTLSARYPALVYVTHKGFLPGPYDRRLALDEVVQMMGGLSYMTGPVGRPLRAGTS
FT                   VNDIMGGMFGAIGVLAALRERERTGRGQEVQSALFENCVFLCAQHMQQYAMTHEPPPPM
FT                   PARVSAWSVYDVFTLADGEQLFIGAVSDRQFVTLCDVLACPALAAEPDFATNALRVAVR
FT                   PRLLERLGAILKDHRAAELSPKLEAAGIPYAPIVRPEQLLDDPHLKASGGLVPMQTDDG
FT                   RTTDVVLLPITMGGRRPGVRQALARVGEHTQEVLARLTRRAIA"
FT   gene            complement(521225..522166)
FT                   /locus_tag="Bcep18194_C6961"
FT   CDS_pept        complement(521225..522166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6961"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6961"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06007"
FT                   /db_xref="GOA:Q39NF9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF9"
FT                   /protein_id="ABB06007.1"
FT                   /translation="MRSFPQQAVIREVGLRDGLQSIPRILPTKHKIEWIGDAYAAGQRE
FT                   IEVGSFVPARLLPQLADTAELVAYAKTLPGLCVSVLVPNLKGAEHAIDAGADLMLVPLS
FT                   ASRAHSIANLRKTPDEVVAEVARIRAARDAAGSKTLIEGGIGTAFGCTIQGRVEQSAVL
FT                   RYLHALLDAGADRVSIADTVGYAGPAAVGELFGKARAAAGERFWCGHFHDTRGLALANV
FT                   YAALETGVARFDATLAGIGGCPHAPGASGNASSEDLAFMLADMGIDTGIDLAALLTLRA
FT                   KVARWLDGETLHGALWRAGLPATHAIAATTTA"
FT   gene            522314..523231
FT                   /locus_tag="Bcep18194_C6962"
FT   CDS_pept        522314..523231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6962"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6962"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06008"
FT                   /db_xref="GOA:Q39NF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF8"
FT                   /protein_id="ABB06008.1"
FT                   /translation="MRDIDLKTLRLLVAVCDHRNMARAAEAVHIEPSAISKRIAQLESD
FT                   LGVPLLTRSRRGVEPTAAGNALLEHARSVLFTMERIASDVAAFGGGLKGRVSICASASA
FT                   IAEALLDDISSFMREPANENIRVDVEERLSSELVRQLREGAASVGVCWDNVDLQGLQHR
FT                   PYRQDRLALAVHRDHPLANAPSLSFEQTLGYEHVGLLPTTAVHTLLQRAAADAGTTVSY
FT                   RVIVSGFDAAFRVVAAGLGISVVPMEVADTYRPVFGIKVIPLVDAWAKRRFVVCFRSFD
FT                   ALQPAAQRMVDYLSSRAAMPAASD"
FT   gene            complement(523306..523563)
FT                   /locus_tag="Bcep18194_C6963"
FT   CDS_pept        complement(523306..523563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6963"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6963"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06009"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF7"
FT                   /protein_id="ABB06009.1"
FT                   /translation="MKLTIKYFASIREQLDLDEEIVEIDARELTVDALRDTLAARDARS
FT                   AEALRTDRPVRAAVNLEMVTGGFVVREDSEVAFFPPVTGG"
FT   gene            complement(523620..524189)
FT                   /locus_tag="Bcep18194_C6964"
FT   CDS_pept        complement(523620..524189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6964"
FT                   /product="Molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6964"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06010"
FT                   /db_xref="GOA:Q39NF6"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF6"
FT                   /protein_id="ABB06010.1"
FT                   /translation="MTSFTESRAGLPDDPLHAGSPAPDSTTDPHPEPPPSITAGFEVRV
FT                   QYAPIDAGAELAPIVRNPNVGAVVNFLGVVRNEGDVDDVIALEVEHYPTMTEQALWSIV
FT                   EEASARWRLEAIKIVHRVGRIPLGQAVVLVVVAAAHRGAAFDACEFLMDFLKTHAPFWK
FT                   KEIRHDGVSGWVEAKAHDDQAMRRWG"
FT   gene            complement(524236..525360)
FT                   /locus_tag="Bcep18194_C6965"
FT   CDS_pept        complement(524236..525360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6965"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6965"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06011"
FT                   /db_xref="GOA:Q39NF5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF5"
FT                   /protein_id="ABB06011.1"
FT                   /translation="MQADEPIVNAIVSAAPAVAALSGGASPGAFPRTTDTLGRPLRDLR
FT                   LSVIDQCNFRCGYCMPRESFGADYAFMPSSERLSFAQLEKIARAFTSLGVEKIRITGGE
FT                   PLLRRNLEALIERLAALTTVDGKPVEIALTTNGSLLAAKARTLRDAGLSRVTVSLDAID
FT                   DAVFRRMSDADVPVSRVLAGIEAAQAAGLAPVKVNAVIERGVNDDQILPLVRHFRQSGV
FT                   AVRFIEYMDVGGASFWSGDKVVPAARMRELIDEHYPLVLVGEPGHDATAIRCAHIDGAG
FT                   EVGFIASVSHPFCGTCSRARVSADGQLYTCLFATQGTDLRPWLDDTASTADLAAAVRDR
FT                   WSHRDDRYSERRAARPARAPGKTYPTVRMSLVGG"
FT   gene            complement(525569..526783)
FT                   /locus_tag="Bcep18194_C6966"
FT   CDS_pept        complement(525569..526783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6966"
FT                   /product="Molybdopterin binding protein, MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6966"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06012"
FT                   /db_xref="GOA:Q39NF4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF4"
FT                   /protein_id="ABB06012.1"
FT                   /translation="MKPLTDFDTAQQHFASAFAPLGATTSIPVAEAAGHVLAAPLTAVL
FT                   DQPPADQSAMDGYAVRHADLAHGEPLHVAQRCYAGDTPAPLAPRTAARIFTGSVIPPGA
FT                   DTVVMQEHAREQDGWVAFDVPQRSGSHIRRRGEEVRAGDLLVPAGVRMGAMHVGVAAAQ
FT                   GFARVDVRPALRVGILTTGDELVACGQPRAPQQIYNSNAPMLAALVSGTGAEVAMSLHA
FT                   ADTATAVDRALRDLHAGCDLVICVGGASVGDKDLLRPALDALGASFIVTGVRMKPGKPV
FT                   ALARLDTQPVVLLPGNPGAAMTAFALFVAPLIRRLQGRTTRVPVVPSLPIDSDFEPDAQ
FT                   RERFVRVHCTVGLDGMPALDTLRQQGAGTLQSLVQASGLARLPAGQRIACGDAVPYYEF
FT                   AHWLA"
FT   gene            complement(526783..527652)
FT                   /locus_tag="Bcep18194_C6967"
FT   CDS_pept        complement(526783..527652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6967"
FT                   /product="Formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6967"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06013"
FT                   /db_xref="GOA:Q39NF3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF3"
FT                   /protein_id="ABB06013.1"
FT                   /translation="MESCIRRDDPTGSTACHVTRHRAGDARDTVDRVVDETPVALVING
FT                   IAHTVMMATPIDLDVFGLGFALSEGIVERASDVFDIESECRAGSAEVRMTVSQQAFMAM
FT                   KAHRRALAGRTGCGVCGIESIAQLDLHPPRIAAAGTAAGIGAAAIERAARALPAHQTLM
FT                   RETGGIHAAAWCNRDGDVLDVFEDVGRHNALDKLIGRLAQRRANLHDGFVFLSSRASYE
FT                   LVRKAARVGIPMIATISAPTSLAIDVAREAGVRLLGFCRNDGFVEYVSPDAMHPDQPAL
FT                   AQAHPALS"
FT   gene            528078..529478
FT                   /locus_tag="Bcep18194_C6968"
FT   CDS_pept        528078..529478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6968"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6968"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06014"
FT                   /db_xref="GOA:Q39NF2"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF2"
FT                   /protein_id="ABB06014.1"
FT                   /translation="MEIFDAFHLARLQFAFTVSFHIVFPAISIGMASFLAVLEWRYLVT
FT                   GDAAYKSMFQFWSKIFAIGFGMGVVSGVVMAYEFGTNWAGFSRVAGNITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWQRVSPRAHFFATLMVAVGTLISTFWILASNSFMQTPQGYKIEN
FT                   GLVVPVDWFKIIFNPSFPYRLVHMTIAAFIVAGFIVAACGAWHLLKGRRDEPVKRSFSM
FT                   ALWMLLVLAPIQIVVGDAHGLNTREYQPAKIAAIEGLWETEKGGTALNLFGLPDMQAET
FT                   TRYAIQVPHLGSLILTHSWDGEIRGLKEFPPQDRPYSPIVFWTFRIMAGLGMLMLLTAL
FT                   LGLLLRKGGRLYETRWFQWFVVAMGPSGILALLAGWITTEVGRQPWTVYGVLRTVDSVA
FT                   PLSAQQVGVSLLIFVVVYFLVFGTGIYYMMKLMKRGPAAQAGYIELHRHPGLRKSALST
FT                   PLNVTEAE"
FT   gene            529482..530489
FT                   /locus_tag="Bcep18194_C6969"
FT   CDS_pept        529482..530489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6969"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6969"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06015"
FT                   /db_xref="GOA:Q39NF1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF1"
FT                   /protein_id="ABB06015.1"
FT                   /translation="MQIDLPVIWAAIIGLGVFIYVMLDGFDLGIGLLFPFFDAKAERQV
FT                   MLDTVAPVWDGNETFLVLGGAGLYGAFPVVYSTLLPANYLPLVLMLVGLIFRGAAFELR
FT                   AKATRTQHMWDLAFIGGSALAAFCQGIVLGSLLQGIKIENNQFAGGPFDWLSPFSLLCG
FT                   IGVLVTYATLGCGWLILKVDGELQRKMRLLMKPLAGVLLAVMGVVSLWTVIGLPAVAHR
FT                   WFGSGNLGWFLPVPILVIACVWGIFHTVKRAHEATPFLLTLALVFLGYTGLVISIWPNI
FT                   VPPSLSIWDASSSPSSQKFALVGTVIVLPIILVYNAMQYRVFRGKVREGDIGYH"
FT   gene            530668..531588
FT                   /locus_tag="Bcep18194_C6970"
FT   CDS_pept        530668..531588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6970"
FT                   /product="protein of unknown function UPF0187"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6970"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06016"
FT                   /db_xref="GOA:Q39NF0"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NF0"
FT                   /protein_id="ABB06016.1"
FT                   /translation="MIVRPQQNWLRMLFVWNGSVLQSIIPQLVFMAIVSTLAVFTNGRI
FT                   FGEKIPLNTAPFTLFGLALAIFLGFRNSASFERFKEARHLWGNLLIAARTLTSQFNRYL
FT                   PDSVNDAERNRLADLLIALTYALKHQLRHTDPTADLQRILGAERTTELGGKCFKPVAIL
FT                   DELRGGIVRALGRAPGSDATCWMFETQLDEVGKSVGGCERILSTPIPFSYSVLLHRTVY
FT                   AYCVLLPFGLVDSTEFFTPLICVFISYTLIALEAIASEVAEPFGLAPNALALDAMTRTI
FT                   ERSVLELGDRPLPEEFMPASTYQIT"
FT   gene            531668..532261
FT                   /locus_tag="Bcep18194_C6971"
FT   CDS_pept        531668..532261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6971"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06017"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE9"
FT                   /protein_id="ABB06017.1"
FT                   /translation="MTLVDTYLAGLRAALPDTDTAALAATTGATPAQLDALRDAYPQCP
FT                   ASLLELLGKLDGTYWRDYGGTTVNVLVLGSDVYEYPYYLLSAGQMLEEGAKYRDSIAEI
FT                   YGDDANDDGELVDSRIDIALPMNRRLCFSHCMNNGGTSQLYIDFEPAPGGKVGQVVRFL
FT                   HDPDSYAVIADDFDGYLRKLIDDGYAFVIDFDEE"
FT   gene            532319..532705
FT                   /locus_tag="Bcep18194_C6972"
FT   CDS_pept        532319..532705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6972"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6972"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06018"
FT                   /db_xref="GOA:Q39NE8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE8"
FT                   /protein_id="ABB06018.1"
FT                   /translation="MRIYVTSIFVDDQDKALTFYTDKLGFKLKNNVPVGEYRWLTVVSK
FT                   DQPDGTELLLEPSNHRAVGPYKQALYEDGIPAASFQVDDLDAEFERLRNLDVRFTLEPM
FT                   DAGPVRVAIVDDTCGNLIQLMQMK"
FT   gene            complement(532730..533170)
FT                   /locus_tag="Bcep18194_C6973"
FT   CDS_pept        complement(532730..533170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6973"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6973"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06019"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE7"
FT                   /protein_id="ABB06019.1"
FT                   /translation="MTPQETIDRMEIQDLLTRYCHAVDRHDWHEFERLFAANATLDYTA
FT                   FGGPAGSRAEIAAYLEHVTSAMRGTQHTISTSLLIVDGDAATARTAGQAMMISAGEAGD
FT                   DRVCFVGLWYRDLLVRTECGWRIQRRTQERSWMHNAPPVTAS"
FT   gene            533381..533791
FT                   /locus_tag="Bcep18194_C6974"
FT   CDS_pept        533381..533791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6974"
FT                   /product="putative glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6974"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06020"
FT                   /db_xref="GOA:Q39NE6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE6"
FT                   /protein_id="ABB06020.1"
FT                   /translation="MQLLDHVSISVPDIDLARPFYDAIMAALGAAKVYDRPTALGYGER
FT                   CNANDTASTFLAVYLDPAEVGASKRHWCFKAASREQVDAFFEAGLATGGQSDGEPGLRP
FT                   HYHGDYYGAFLVDPAGNRVEAVCHASVPASAS"
FT   gene            complement(533909..534922)
FT                   /locus_tag="Bcep18194_C6975"
FT   CDS_pept        complement(533909..534922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6975"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6975"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06021"
FT                   /db_xref="GOA:Q39NE5"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE5"
FT                   /protein_id="ABB06021.1"
FT                   /translation="MTHPARPTILTGDRTTGPLHLGHYIGSLRARVQMQHEAKQFLLLA
FT                   DTQALTDNMGRRQRVTENVIEVALDYLAVGIDPAISTIVVQSQVPELAELSQYLLNLVT
FT                   VARLERNPTIKEEIRLRGFERDIPAGFLTYPVSQAADITAFKATHVPVGDDQLPMIEQT
FT                   NELVRRFNATVEQPVLVECEAVLSPVTRLPGIDGKAKMSKSLGNAITLGSTPDEITQAV
FT                   KDMYTDPNHLRVSDPGQVEGNVVFTFLDAFEPDVQKVDELKAHYRRGGLGDSVVKRVLD
FT                   ERLQALIEPIRARRREFEADKAEVMAILKRGTMHARDVAGATLAEVKGAMGLNYFD"
FT   gene            complement(535131..535670)
FT                   /locus_tag="Bcep18194_C6976"
FT   CDS_pept        complement(535131..535670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6976"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6976"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06022"
FT                   /db_xref="GOA:Q39NE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE4"
FT                   /protein_id="ABB06022.1"
FT                   /translation="MDIAWCSPGNGRATASPESSAGPLQGRIGRRVCEIERCTRMTLSG
FT                   SPPPPTILDCARADDLVGCTSPPYGRQPDTQPSPFLPRDRLTPPSRAGALNRTPATVKP
FT                   ATPRRRPTRPVAATVGVAPRAPASMKNSKPSTRPPREKDRTPLVRASALLLMAGLLYLL
FT                   WPSAETAYLAMESVIR"
FT   gene            535766..536428
FT                   /locus_tag="Bcep18194_C6977"
FT   CDS_pept        535766..536428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6977"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06023"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE3"
FT                   /protein_id="ABB06023.1"
FT                   /translation="MSHEALDPLLRQFAEKRLGRSLAPAEEQMLLEQLPSRNGNPPAPA
FT                   AGMAAPVPAANRPLPQLKTRQEAREQVKHFLQLNQQKAYEKMRGILQTIDAQNETTLGM
FT                   LASEQRKVSGVLDAHEPQGDAQASGAAEIQDSTREALAMIGEQLTGLIRQEIDACFRQY
FT                   VDALAERLDARLDAMEARLRSADATPAPAPAEPSAPSEPTAVVAAAVHDPSGQASME"
FT   gene            536509..536841
FT                   /locus_tag="Bcep18194_C6978"
FT   CDS_pept        536509..536841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6978"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6978"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06024"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE2"
FT                   /protein_id="ABB06024.1"
FT                   /translation="MADTCQVCQVNPAITDAVTQVNVKVVAEAPAMAMGSLYQAQSHSL
FT                   SILFENAVQQQSQAAIQSQTSTNVGTMQLYTIGPESAGAAATEIGANGIISILADVIAI
FT                   GKAVKP"
FT   gene            537026..537412
FT                   /locus_tag="Bcep18194_C6979"
FT   CDS_pept        537026..537412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6979"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6979"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06025"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE1"
FT                   /protein_id="ABB06025.1"
FT                   /translation="MMANDTTDPAAPTDPKDPKDPCNCKTCAVNAAITDAVTQTNVKVV
FT                   GEAPAMATGSLYQAQSHSLSVLFENAVQQQSQSAVQLPTSTNVGTMQLYTLGPASAGAA
FT                   ATEIGSNGVLSVLADVLAIGKALA"
FT   gene            537591..537914
FT                   /locus_tag="Bcep18194_C6980"
FT   CDS_pept        537591..537914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6980"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06026"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NE0"
FT                   /protein_id="ABB06026.1"
FT                   /translation="MPEQVSAAVTDAVTQANVKVVGEAPAVALGTLMQSNSHASAILLH
FT                   NAVQMQANQAMSNLAATTVGVMQLYAGSPAAAASAARSANDSFASQLAAVAQLMNAIGH
FT                   WRG"
FT   gene            complement(537995..538669)
FT                   /locus_tag="Bcep18194_C6981"
FT   CDS_pept        complement(537995..538669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6981"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6981"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06027"
FT                   /db_xref="GOA:Q39ND9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND9"
FT                   /protein_id="ABB06027.2"
FT                   /translation="MPALANAQTLRNIPILTDLPESLIAHVERHVTPWPEHGNRLLFFK
FT                   GDPGDFVAFVHRGHVYKTLHEPGGREIILGHSMPGELIGENTLIRAHRRNFTAQLSADC
FT                   RISLLHRPYFAPLLANPEFMGRIHEQLCRHIHQLSDFVESACLYRLDARLARHLLNRMQ
FT                   GNDLEVPLPENQSVLAAMLNVSRPRLNSSLQKMQRDGLIRLHEHGVTIEKPEQLRTIVD
FT                   AN"
FT   gene            539078..539635
FT                   /locus_tag="Bcep18194_C6982"
FT   CDS_pept        539078..539635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6982"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6982"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06028"
FT                   /db_xref="GOA:Q39ND8"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND8"
FT                   /protein_id="ABB06028.1"
FT                   /translation="MTTSNQHAAPTPECPAQQLDRTWREMQGKLRRRARLLCKGDIHRA
FT                   DELLSDTALKVHIYLQRSPERVQNLAGFLFLVLNHAFLDGARRRLRESGMLEFDPGWDD
FT                   DHTVELAGHAPSVEQQMLLRQQLVRLQQALSTLPPQQQMLFTLKFEEDRPYLHIAATLG
FT                   INEPLARKRVELLRKKLREELA"
FT   gene            539675..540055
FT                   /locus_tag="Bcep18194_C6983"
FT   CDS_pept        539675..540055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6983"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6983"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06029"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND7"
FT                   /protein_id="ABB06029.1"
FT                   /translation="MCGVAGLPARPFLQSHAGAGFRGGLVADKVNEQITDAVTQTNVNV
FT                   VAGSPAQALGTLYQMFSQAVGISAQNMTQQQAALNQISNAVVSKAVAMILSVEASPKSA
FT                   SGGGAGGAPQVPSAGPQTGPTH"
FT   gene            540085..540696
FT                   /locus_tag="Bcep18194_C6984"
FT   CDS_pept        540085..540696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6984"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6984"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06030"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND6"
FT                   /protein_id="ABB06030.1"
FT                   /translation="MNMKGLLGGRGDGTTQAPDDVADAAAEATTPADVTPHAATPKAGA
FT                   RAWPVNRLRRFTDALKAPNAVAGPAGSGGSALQTVQAINAEAASYATTQIAVGPNMMIT
FT                   QAGGMVAQAAANYFEATTSLAIAGKSVLMKDLAQKTVDENVPGMAMDAVGLLLTDLFVA
FT                   TAAIVAGAAEAIEGEAASVALDRIDESLQKYQALLDKKGA"
FT   gene            540999..541445
FT                   /locus_tag="Bcep18194_C6985"
FT   CDS_pept        540999..541445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6985"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06031"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND5"
FT                   /protein_id="ABB06031.1"
FT                   /translation="MSYIIQNVHGPAPLAVGERTWGDATEIDFGAMTSCIALVEQAPAQ
FT                   PTQVRGIHLSIVSIDGTNVYDPAADVAGQVETIMQQSGDLRACLGRIDLWQASDTQELQ
FT                   DFFVGLMQSLDMLNWVQVEDGNLRVRIHGGVMQYQHGTGAWTNV"
FT   gene            542320..543948
FT                   /locus_tag="Bcep18194_C6986"
FT   CDS_pept        542320..543948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6986"
FT                   /product="putative tyrosinase"
FT                   /EC_number="1.14.18.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6986"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06032"
FT                   /db_xref="GOA:Q39ND4"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND4"
FT                   /protein_id="ABB06032.1"
FT                   /translation="MNNAPGVRVRPSIESLQAEYLAGNKKPLEDVMRAWKGIKALPPDD
FT                   PNSFFMIGGFHGEPFRGAGWGSASYWGGYCNHGNVLFPTWHRAYLLRLEQALQSIPGCE
FT                   QVMLPFWDETSEESLTKGIPWALTAPDFELDGETIPNPLASFAFNRAIADNINGDNPNY
FT                   SKPLPYTTVRYPLSGLVGTDKDKAATEKHNAKFPNAKENVVILNRNIVDWLTSYIVVKG
FT                   DVVPTNVKSKFEQCLNAPNYTVFSNTSSAAQWNENLPADAIPVVPLESPHNDIHLAVGG
FT                   FDVPHGPNKGDFSPIPGANGDMGENDTAGLDPIFYFHHCFIDRVFWLWQKRHGYTQHLD
FT                   VIAEYPGTNSVDAQGPTPGTVPNSWLTLESPLDPFKKSENGKERAYTSLDCINIEEQLG
FT                   YTYGPGSLENLPKYSLAAATVPAGNSSKVVRVSGLNRAPIAGSFLVSAYVNVDGERQLL
FT                   GTEAVLSRWSVVSCANCQTHLEVKAFFPLNHFAESAVQDAQYEVEIHTREGVRLQTQPA
FT                   SPPALQAVAGAPPQPAPKLFRLEVR"
FT   gene            544036..544467
FT                   /locus_tag="Bcep18194_C6987"
FT   CDS_pept        544036..544467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6987"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6987"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06033"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND3"
FT                   /protein_id="ABB06033.1"
FT                   /translation="MSYTPETGSLVGLWTYRSFLNDPDPATAFNDLEFGLGTIEIEQAP
FT                   AGIFKGRIFGPGWELQLNGWVTYGNPGTVRFQGRGVVGGEEWVYDYVGYVSAPWPNGID
FT                   QRPALTGSIVRTVPHASGSGGVAPAGVVCSWYAVMRDPA"
FT   gene            544474..545238
FT                   /locus_tag="Bcep18194_C6988"
FT   CDS_pept        544474..545238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6988"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6988"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06034"
FT                   /db_xref="GOA:Q39ND2"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND2"
FT                   /protein_id="ABB06034.1"
FT                   /translation="MTTPTAPPADTARRPARVTDAIRASARIGPARTAMLPISGRVRGG
FT                   LAFALLGFLACDLPTRLHGAPSSWIWNGIGAIACGIAGYSTRSGSPGRCARRSMLWCMA
FT                   AICAGLTLDAMRSPLDAILNICGGTLDAGAMWNTLVLHLQWFPMSMLAMLALLIRREAD
FT                   RQGAHRRSTVRVLVRAPVRVALEFEAMLLVMALGMTAIKASAFSLGLRWDTSGVAVAML
FT                   VSMLVFYALSDRVALGAVSLKDRLRNKSEQIT"
FT   gene            545792..546994
FT                   /locus_tag="Bcep18194_C6989"
FT   CDS_pept        545792..546994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6989"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6989"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06035"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND1"
FT                   /protein_id="ABB06035.1"
FT                   /translation="MRRLQAFKFELMPNGEQQRDMRRFAGSCRFVYNKALALQKGNYEA
FT                   GGKFIGYVAMAKHLTEWRNGGETPWLKDAPVHPLQHALKDMERAYKNFFAKRAAFPKFK
FT                   KRGQRDSFRYPDPTQFKLDQPNGRIFLPKLGWMRLRLSRPVLGELRNATVSFNAGKWCV
FT                   SIQTEREVEQPVPHATSVIGIDVGIARFATMSDGTFIAPLNSFRKHEARLRRCQRAMSR
FT                   KVKFSNSWKKAKARVQRIHARIGNARRDYLHKATTTISKNHAMACIEDLQVRNMSRSAA
FT                   GSIDAPGKNVRAKSGLNKAILDQGWCEFRRQLEYKLAWNGGWLVAVPPANTSRTCPACG
FT                   YVSADNRTTQEKFACVECSYEENADVVGALNILARGHRVAACGEPVKSSRSMKQEPAAA
FT                   T"
FT   gene            complement(547250..547531)
FT                   /locus_tag="Bcep18194_C6990"
FT   CDS_pept        complement(547250..547531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6990"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06036"
FT                   /db_xref="UniProtKB/TrEMBL:Q39ND0"
FT                   /protein_id="ABB06036.1"
FT                   /translation="MKPLTIATRRIMATLVAGGALAATGTAFAQGYGAPQPRYEERAPA
FT                   PGVGVSVEIGMHGDRYWDGHRYWERDEWRHRHPHDRDPWREHEHEHRE"
FT   gene            547837..549177
FT                   /locus_tag="Bcep18194_C6991"
FT   CDS_pept        547837..549177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6991"
FT                   /product="Flavin-containing monooxygenase FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6991"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06037"
FT                   /db_xref="GOA:Q39NC9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC9"
FT                   /protein_id="ABB06037.1"
FT                   /translation="MAVETTSIDTLVVGAGQAGVAMSEHLGKLGVPHLVLERSRIAERW
FT                   RTGRWDSLVANGPAWHDRFPGLEFDGLDPDAFASKDQVADYFEAYARKFNAPIRTGVEV
FT                   KQVVRNAGKPGFVVETSDGTIEANRVVVATGPFQRPVIPPIAPDDARLVQLHSADYRNP
FT                   GQLPDGAVLVVGAGSSGVQIADELQRAGRQVYLSVGPHDRPPRAYRGRDFCWWLGVLGE
FT                   WDKEVATPGREHVTIAVSGARGGHTVDFRKLANQGVTLVGLTKSFDGGVAVFERDLAIN
FT                   LARGDENYLSLLDAADAYAARNGLDLPEEPEARRILPNPDCVAHPILALDLAGAGVTSI
FT                   IWATGYAVDYGWLKVDAFADNGKPQHQRGVSKEPGIYFLGLPWLSRRGSSFIWGVWHDA
FT                   RHIADHIAIQRTYLDYHDASQRRSTSHAAQDGAAAHADAQPLADAVN"
FT   gene            549253..549690
FT                   /locus_tag="Bcep18194_C6992"
FT   CDS_pept        549253..549690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6992"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6992"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06038"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC8"
FT                   /protein_id="ABB06038.1"
FT                   /translation="MSQPTHTRIRMFNTKDTYPNQTLDNDLCQAVRAGNTVYVRGQVGT
FT                   DFDGKLIGLGDPRAQAEQAMKNVKQLLEEAGSDLTHIVKTTTYLIDPRYREPVYQEVGK
FT                   WLKGVYPISTGLVVSALGQPQWLMEIDVIAVIPDNWQPNRA"
FT   gene            549699..550376
FT                   /locus_tag="Bcep18194_C6993"
FT   CDS_pept        549699..550376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6993"
FT                   /product="protein of unknown function DUF1028"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6993"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06039"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC7"
FT                   /protein_id="ABB06039.1"
FT                   /translation="MTFSIVGRCPETGQLGIAISSSSIAVGARCPWVRAGVGAVATQNI
FT                   TLPALGPQILDLIEHEQLAPAAALDRALSANGWSQYRQVTVIDGQGQTACFTGKEALGT
FT                   HHAVQGEQCVAAGNLLAAPAVIDAMVRAFEQAPGLLADRLLAAMHAAMAAGGEAGPVHS
FT                   AALKVAGDLTWPIVDLRVDWADADPIGQLEALWQAYRPQMQDYQTRALNPTAAPSYGVP
FT                   GDE"
FT   gene            550369..551532
FT                   /locus_tag="Bcep18194_C6994"
FT   CDS_pept        550369..551532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6994"
FT                   /product="acetylornithine deacetylase ArgE, Metallo
FT                   peptidase, MEROPS family M20A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6994"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06040"
FT                   /db_xref="GOA:Q39NC6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC6"
FT                   /protein_id="ABB06040.1"
FT                   /translation="MNDTSSRALLERLIGFATVSRDSNLEMIGFIRDYLAGFGIESELF
FT                   YNAERTKASLYATIGPRDRGGIALSGHTDVVPVDGQAWTVEPFRLTERDGRLYGRGTAD
FT                   MKGFIASVLAAVPAFVARPLSVPVHLAFSYDEEVGCLGVRPMLDALAAREHRPRLCLIG
FT                   EPTELKPVLGHKGKLAMRCHVKGAACHSAYAPSGVNAIDYAAKLIGRLGEIGAALARPE
FT                   RHDARFDPPFSTVQTGLIKGGRALNIVPAECEFDFEVRALPDFDAHDVPRKLQDYAESE
FT                   LLPRMRAVQPDTDIQLQPLGAYPGLATAPDSEAARLLAMLSGSDAFGTVAFGTEGGLFG
FT                   QAGIPTVVCGPGSMDQGHKPDEFVTLDQLHGCDAMLRRLAAHLAAAA"
FT   gene            complement(551604..552533)
FT                   /locus_tag="Bcep18194_C6995"
FT   CDS_pept        complement(551604..552533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6995"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6995"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06041"
FT                   /db_xref="GOA:Q39NC5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC5"
FT                   /protein_id="ABB06041.1"
FT                   /translation="MLVAHYTLRQLKYFVTTVESGSVAEASRQLFIAQPSISSAIKGLE
FT                   ESFGVKLFIRHHAQGVSLTPSGTRFYRKAQELLRISHEFEQNALADNDVITGQIDIGCF
FT                   ETVAPLYLPQLIAGFRERYPGVNIRLRDGDQQELVQGLTSGTFDLALMYDHDLDGTIET
FT                   EPLMPPQQPYVLLPENHRFAGQTHVSLRDLCVEPMILLDVQPSRTYFVSLFHELGLTPN
FT                   IVFGSPSIEMVRGMVGQGFGFSLLVTRPHSEYTYDGQRVVTIALSETVSPSGLVSARLK
FT                   RGQLTKQAQSFVDFCRERLAQIVVETAR"
FT   gene            552923..554344
FT                   /locus_tag="Bcep18194_C6996"
FT   CDS_pept        552923..554344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6996"
FT                   /product="cytosine/purines, uracil, thiamine, allantoin
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6996"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06042"
FT                   /db_xref="GOA:Q39NC4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC4"
FT                   /protein_id="ABB06042.1"
FT                   /translation="MTNVDRNASPMIEKHTIGYVPPAERHGKVRDLFTLWFGGNIAPLP
FT                   IVTGALGVQLFHLNLMWGIVAIVVGQAVGGVLMALHSAQGPQMGIPQMIQSRAQFGSWG
FT                   ALLVTVIAAVMYVGFFASNIVLAGKSVHGIASSVPVPVGIVIGAVGSGLIGIVGYRFIH
FT                   ILNRIGTWVLGIGILVGFWMILSHVTTDDFLTRGGFNFAGWLATVSLSALWQIAFAPYV
FT                   SDYSRYLPENVGVASTFWATYLGCTIGSTLAFIFGAVAVLAVPAGADAMDAVKQATGPL
FT                   GPLMLVLFLLSVISHNALNLYGAVLAVITSVQTFAYKWIPTAKARAVVSVVIFVACCYA
FT                   AIGASTNFVGNLVDLVLALLVVLVPWTAINLIDFYVIHKGKYDIKSIFMADGGIYGRFN
FT                   PQALLAYAIGILVQIPFMNTPMYAGPIPAHLGGADLSWLVGLALTSPLYYWLASRDSAY
FT                   RRRQTGATMPPTAAR"
FT   gene            complement(554559..556838)
FT                   /locus_tag="Bcep18194_C6997"
FT   CDS_pept        complement(554559..556838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6997"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6997"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06043"
FT                   /db_xref="GOA:Q39NC3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC3"
FT                   /protein_id="ABB06043.1"
FT                   /translation="MTNRREVPGIRKYDGPAGGWGALRATADAVRTQMETIEAPIVLMR
FT                   TNQPDGFDCPGCAWPDKEHKSTFQFCENGAKAVTWEATTKRVTPEFFAANTVSSLLRMS
FT                   DYELENMGRLTHPLVYDRATDTFRAIEWDDAFARIGEVLRALSPEQVEFYTSGRASNEA
FT                   AYLYQLFAREFGTNNFPDCSNMCHEPTSVGLPQSIGIGKGTVSLEDFDHCELIISIGHN
FT                   PGTNHPRMMGTLHECSRRNVPIIVFNPLRERALERFADPQDMIEMASFGSTRIASTYYQ
FT                   VDAGGDAAALKGIMKALLQLEAERGDVLDRDFIAQHTNGFDAFSADLEATSWDDIERAS
FT                   GLSQAQLEQVALAYAKSNATIITYGMGVTQHNKGTATVRLIADLLLMRGNIGKPGAGVC
FT                   PLRGHSNVQGNRTVGITEKPSAEFLKKIEDVCGFTPPAHHGHDAVQAMQAMIDGTAKAL
FT                   LCLGGNFAVALPDPEQSFPAMAKLDLSVHLGTKLNRSHLLVAKETFVLPVLGRTELDMQ
FT                   ATGRQSITVEDSMSMVHASAGKLKPASDQLRSEPAIVAGIAHATLPASKVAWLDLIADY
FT                   DRIRDLIDRTVSGFEAFNDRIRTPGGFRLPLPPTERVWPTPTGKAMFSVYKGVKEDADV
FT                   LGAEQVLRLITLRSHDQYNTTIYGLDDRYRGVFGRRDVLFMNPADLAKYGLEHGDLVDI
FT                   ETVTASGRALRLEKITAIEYDIAPGSVGAYYPEANVLVPLDYIDKESGTPSYKSVPVRV
FT                   ARSAVV"
FT   gene            complement(556964..559813)
FT                   /locus_tag="Bcep18194_C6998"
FT   CDS_pept        complement(556964..559813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6998"
FT                   /product="putative ClpA/B protease, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6998"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06044"
FT                   /db_xref="GOA:Q39NC2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC2"
FT                   /protein_id="ABB06044.1"
FT                   /translation="MPALCDICHARPAVARATVMQDGERKTISICDYHFRQLMRHQSML
FT                   NPFDSLLGGGGSSSLFGGLDDDAPLAAEIPRESVDPTDAFSEQTLELLQRAAEKAHELR
FT                   RSELDSEHLLYALADTDVCAALLKELKLSPQDIRSYIDEHAHTGTADADAPLDKLSISP
FT                   RVKKAVQYAFQASRDLGHSYIGPEHLLIGLASVPDSVAGTLLKKYGVTPEALRQKVVKV
FT                   VGKGAEDGRVDAPTGTPNLDKFGRDLTAIARQGKLDPVLGRAQEIESTIEVLARRKKNN
FT                   PVLIGEPGVGKTAIVEGLAQRIVNGDVPEVLRDKRLVEVNINSMVAGAKYRGEFEERAK
FT                   QLIDEVTAKQDELILFIDELHTIVGAGQGGGEGGLDIANVLKPALARGELSLIGATTLN
FT                   EYQKYIEKDAALERRFQPVFVPEPSVEQTIVILRGLRDSLEAHHQVTFADDAFVAAAEF
FT                   ADRYITSRFLPDKAIDLIDQAAARVRIGATSRPVDIQEGEAQIAQLKREQDYATSRKRF
FT                   DEAKQFEEQINAKQKSVDEMMEAWQRKTGSETLEVTVESVAEVVSRLTGIPVSELTQEE
FT                   RQKLLKMEEQLRERVVGQSDAVVAVSDAVRLSRAGLGQTHRPIATFLFLGPTGVGKTEL
FT                   AKALAETVFGDEQAIIRIDMSEYMERHAVARLIGAPPGYVGYDEGGQLTERVRRRPYSV
FT                   ILLDEIEKAHPDVYNVLLQVFDDGRLTDGKGRVVDFSNTIIIATSNLGAAIIMDNLTQP
FT                   EAARKTDKAIREELMQVLKGHFRPEFLNRIDEVIVFHALSKENIRSIVQIQLDRVVRTA
FT                   AAQDITLVMGDSLVEHLTEAGYQPEFGARELKRQIRQTIETRLAKEILADRLKSGDRCE
FT                   VDYDKASDEVKFNTFAAPEAKETKDAKKDADGKAKPNGKAAKAGNDAKTGDTPADAPPP
FT                   APAAKASGKKSSGTKKDAH"
FT   gene            complement(560435..560704)
FT                   /locus_tag="Bcep18194_C6999"
FT   CDS_pept        complement(560435..560704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C6999"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C6999"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06045"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC1"
FT                   /protein_id="ABB06045.1"
FT                   /translation="MSESNEALQALQASVDHLKQAVDANASSQAGDTAVLFTVLSLVLA
FT                   ELPPDTRNLIEDSFSVWANGLPNAALSTDVKQIARQRLAMTLPD"
FT   gene            complement(560809..561624)
FT                   /locus_tag="Bcep18194_C7000"
FT   CDS_pept        complement(560809..561624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7000"
FT                   /product="Linocin_M18 bacteriocin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7000"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06046"
FT                   /db_xref="GOA:Q39NC0"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NC0"
FT                   /protein_id="ABB06046.1"
FT                   /translation="MNNLHRELAPISSSAWEQIEEEVARTFKRSVAGRRVVDVDGPEGP
FT                   ELSAVGTGHLVEVAAPREQVNARLREVRTIVELTVPFELSRDAIDSVERGARDADWQPA
FT                   KDAAQRLAFAEDGAIFDGYAAASIVGIREGTSNNKLTLPADVSAYPDAISDALEALRLA
FT                   GVDGPYSVVLGSDAYTALSEARDQGYPVLGHIKRIVSGEIIWAPAISGGCVLSTRGGDY
FT                   ELHLGEDVSIGYTSHTDKVVRLYLRETFTFLMLTSEASVAVAPQANTTA"
FT   gene            complement(562138..563199)
FT                   /locus_tag="Bcep18194_C7001"
FT   CDS_pept        complement(562138..563199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7001"
FT                   /product="Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7001"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06047"
FT                   /db_xref="GOA:Q39NB9"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB9"
FT                   /protein_id="ABB06047.1"
FT                   /translation="MTDRQPTMQTPPPLSQNVHSTITRSAIFLVATINPGADHADTIRS
FT                   WCGDIAALVRSVGKRVPGGNLTCVCGFGADAWDALFGNPRPAALHPFREFGAGQRVAVA
FT                   TPGDILLHIRADAMDLCFELATQLLGALGDAVTVVDEVHGFRNFDQRAMIGFVDGTENP
FT                   EGREAVDFTVIGDEDAEFTGGSYVIVQKYLHDMAGWNALAVETQERIIGRTKLSDIELA
FT                   PDVKPSCSHSSLTTLDEDGQEVKILRDNMPFGRPGAGEFGTYFIGYARSPAPIEQMLEN
FT                   MFVGRPPGNYDRLLDYSRAVTGSLFFVPSADLLEALADRAAPAAEAAEPAPASSAPHRD
FT                   GSLKIGSLKGVPS"
FT   gene            563567..563953
FT                   /locus_tag="Bcep18194_C7002"
FT   CDS_pept        563567..563953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7002"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7002"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06048"
FT                   /db_xref="GOA:Q39NB8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB8"
FT                   /protein_id="ABB06048.1"
FT                   /translation="MNLLEAMRVYVAVVEHGGLSAAASELRLDETQVSERIDGLERYLG
FT                   CRLLLCRDRDDVACTDAGDAFHVCCRRTLSAVERATGAAGPHGPDLPDLPDLPAAHATV
FT                   HAAARDATFPPPGAVQASSPRLSP"
FT   gene            563950..564399
FT                   /locus_tag="Bcep18194_C7003"
FT   CDS_pept        563950..564399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7003"
FT                   /product="Phosphate-starvation-inducible protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7003"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06049"
FT                   /db_xref="GOA:Q39NB7"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB7"
FT                   /protein_id="ABB06049.1"
FT                   /translation="MNTTTLSCSPAERIRRRFGHFLHAAELAGLIVIGLATAFAMAQEA
FT                   WKVVLAGEVSLTDLLLMFLYLEVLAMDVRYLRLGRLPVRFPLFIAMTSLARDLILRGAT
FT                   DSPERMLMTTFGIVLLAVGVLILSFGQHRFPADVADVEDDAHARR"
FT   gene            564720..565175
FT                   /locus_tag="Bcep18194_C7004"
FT   CDS_pept        564720..565175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7004"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7004"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06050"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB6"
FT                   /protein_id="ABB06050.1"
FT                   /translation="MTKQLIVAVFDSVDTARQAANDFEALSEKDEGFHVENGVVVEKDA
FT                   TGKLAVLHAESRPFKGGVIGAIAGGLLGLLAGPLGVVTGMAAGAGAGILAEAAGNALLD
FT                   GTFVETIAARLVPGSVAVILEAKEDTPFSVDNVVTGFGGKVFRQTLD"
FT   gene            565210..565464
FT                   /locus_tag="Bcep18194_C7005"
FT   CDS_pept        565210..565464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7005"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06051"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB5"
FT                   /protein_id="ABB06051.1"
FT                   /translation="MRIDQSYRRFDIAATLSPLPGNGNRAIAVVDVTTDDPARIVDLGT
FT                   GQFLQIRKWVESNDIALLTVVFDECKVAIDHYADNVDDA"
FT   gene            565856..567280
FT                   /locus_tag="Bcep18194_C7006"
FT   CDS_pept        565856..567280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7006"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7006"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06052"
FT                   /db_xref="GOA:Q39NB4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB4"
FT                   /protein_id="ABB06052.1"
FT                   /translation="MKLYEKFANDIERLIRQGVYRHGDRVPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDSHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLYPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVEFAAKADLPI
FT                   IENGVYNELYFGNMHPSTLKSFDRHDIVLHCSSFSKSLTAAYRIGWALPGRYREQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRIRKAYAQQANLMRTMVSRFFPEGTRISS
FT                   PAGGYVLWIELPAQVDAMRLYQLALEQGITIGPGYMFSITDSYRNFIRLNYSSPWSPEI
FT                   EQAVITVGKLAAYCVD"
FT   gene            complement(567315..568475)
FT                   /locus_tag="Bcep18194_C7007"
FT   CDS_pept        complement(567315..568475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7007"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7007"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06053"
FT                   /db_xref="GOA:Q39NB3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR033689"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB3"
FT                   /protein_id="ABB06053.1"
FT                   /translation="MATVLCVLYPDPVDGYPPRYVRDAIPVITHYADGQTAPTPAGPPG
FT                   FQPGELVGCVSGALGLRGYMEAHGHTLIVTSDKDSPDSEFERRLPEADVVISQPFWPAY
FT                   LTAERIARAPKLKLALTAGIGSDHVDLDAAARARITVAEVTGSNSISVAEHVVMTTLAL
FT                   VRNYLPSHAIAQQGGWNIADCVSRSYDVEGMHFGTVGAGRIGLAVLRRLKPFGLQLHYT
FT                   QRHRLDASIEQELGLTYHADAASLASAVDIVNLQIPLYPSTEHLFDAAMIARMKRGAYL
FT                   INTARAKLVDRDAVVNALTSGHLAGYGGDVWFPQPAPADHPWRTMPFNGMTPHISGTSL
FT                   SAQARYAAGTLEILQCWFDGKPIRNEYLIVDGGTLAGTGAQSYRLT"
FT   gene            568664..570247
FT                   /locus_tag="Bcep18194_C7008"
FT   CDS_pept        568664..570247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7008"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /EC_number="1.18.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7008"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06054"
FT                   /db_xref="GOA:Q39NB2"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB2"
FT                   /protein_id="ABB06054.1"
FT                   /translation="MRDADNGIVTSLCGSDVMSGSDSSSSRPDLAQGIALDDLADGAMI
FT                   EGHVGDAAVLLVRRADELFAVGAQCPHYGAPLADGLLEGDTIRCPWHHAAFCLRTGELL
FT                   RAPALDGLPCWRVERRDGRAVVLDARPAAVPPALNAAGLPVSVVIVGGGAAAIAAAVTL
FT                   RQEGYPHPVTLLTADADPPYDRPNLSKDYLAGTADADWLPLRAPSFYADHHIDVRCGTR
FT                   VARIDPARQAVELADGSRVGYGALLLATGAEPNRLTVPGADLPHVCVLRSRADCDALIA
FT                   KLKTARRCVVVGASFIGLEAAAALRTRGLDVQVVAPDAHPMARVLGDALGSTIQALHES
FT                   HGVVFHLGATPAQITPDSVTLSTGDVLPADLVVVGIGVHPNVALAQDAGLAVERGVTVD
FT                   RFLQTSAPGIYAAGDIARWPDPLTGERIRVEHWVVAERQGIVAARNMLGQQRPFDAVPF
FT                   FWSQHYDLTVNYVGHAEQFDRVEIDGDLGAHDCTIAYWRGNTRLAVATIGRDLDSLKAE
FT                   AAFEQQIAAA"
FT   gene            570285..570662
FT                   /locus_tag="Bcep18194_C7009"
FT   CDS_pept        570285..570662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7009"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06055"
FT                   /db_xref="InterPro:IPR040953"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB1"
FT                   /protein_id="ABB06055.1"
FT                   /translation="MNPDVRARFETEFAPRIAARVLGLYQPGEVRVDVVPHDGQGSPTC
FT                   VDVIGLTSTVGLPNRLNARLAWRDDAIDGLLAEPDRSRFDRYLAALPVTIERWQMELPV
FT                   DFSTRTQRDREILIGDLDFDA"
FT   gene            complement(570701..570919)
FT                   /locus_tag="Bcep18194_C7010"
FT   CDS_pept        complement(570701..570919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7010"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06056"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NB0"
FT                   /protein_id="ABB06056.1"
FT                   /translation="MQATDTFMDHEIRVDATRNANGAWVAQVRIFRDGAPVDLPAPELV
FT                   TPEWLTCDEALRGGIDQGRVIIKTRDR"
FT   gene            571066..571704
FT                   /locus_tag="Bcep18194_C7011"
FT   CDS_pept        571066..571704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7011"
FT                   /product="Multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7011"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06057"
FT                   /db_xref="GOA:Q39NA9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA9"
FT                   /protein_id="ABB06057.1"
FT                   /translation="MAFDLTFSIKVFAALFAIMNPIANIPVFLSLTEGAADGARRKVAL
FT                   TAAIGVTVGCIVSAVAGGAILHVFGLTIDDFRLAGGLLVLLIALSMLHGAPSRQHSPGD
FT                   DEGADPAAAESVAIYPLTIPLLVGPGTIATMIVLGHSALSTGQELAFALGLAAFLVLLA
FT                   VSLLSAPLIGHYLSPRVTAVTQRLMGMILAAIAMQMIVASLKAAFGVPH"
FT   gene            571750..572214
FT                   /locus_tag="Bcep18194_C7012"
FT   CDS_pept        571750..572214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7012"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06058"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA8"
FT                   /protein_id="ABB06058.1"
FT                   /translation="MNTLIVLSYPDLAAAHRALAELDTLRDRHVVALSGVAIVECAPDG
FT                   QLRAHAVDPGRTPPGSLLDSVVEHIESSLDAWREKPVDDALIDRVARKARPGTVSLGLA
FT                   ATQLDIYALSTALAPFGGAVIDTTLSIDDELKLVEAISKARDGGSQAASD"
FT   gene            572673..574040
FT                   /locus_tag="Bcep18194_C7013"
FT   CDS_pept        572673..574040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7013"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7013"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06059"
FT                   /db_xref="GOA:Q39NA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA7"
FT                   /protein_id="ABB06059.1"
FT                   /translation="MPYVLIVEDDADTRTMLAALARTQQLSCDTAATLEEARTLVATHT
FT                   PDLVLCDLVLPDGNGMELFDVLPKRSHCEMVLTTGHASLETAIDALRRGATDYLVKPLN
FT                   MQRLNSIFARVPRTTALHEEIAELRGELQRLGRFGRMLGSSPAMQAVYDAIGRVARTEA
FT                   SVLLTGESGTGKELAAQTVHDLSLRRRGPFLAVNCGAIAANLVESEMFGHDRGSFTGAE
FT                   RQHKGFFERADGGTLLLDEITEMPLESQVKLLRVLETGRVTRLGSTREIDVDVRIVAAT
FT                   NRDPEAAMADGKLRPDLFHRINVFPIPLPSLRERGDDIPMLADAFLQQFNADSGRNLRF
FT                   APAAREALKTYAWPGNVRELRNFVQRASIFSDADVIDSLPPPIMDELSNLADSHEDRVT
FT                   VPFGTPLDEVDRRLILGTIAQCGGVKAQAAEVLDVSLKTIYNRLAQLEDEADKPES"
FT   gene            574040..576385
FT                   /locus_tag="Bcep18194_C7014"
FT   CDS_pept        574040..576385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7014"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7014"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06060"
FT                   /db_xref="GOA:Q39NA6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA6"
FT                   /protein_id="ABB06060.1"
FT                   /translation="MPHRPDQPRGARPMFDTSRIRAGNVITAVMLVAIATVLQALAIRF
FT                   GGVNLPLVLYYPLLAGAAWATSFLFGIVSTVISGMLVWTLFLSDPAAYSEPLPERLVRL
FT                   GTFVLVGALVCAVAAMLRHARLTNDAALRREAAARRRLEAVLQALPHGVIATDTNGRLT
FT                   YLNAAAAALVGCPPGDATGRAVRDVLRVVDRDGRRVQSTPLDLALGGAGVVSDRHWLQV
FT                   EGGEPVPIVEVAAPLGDADGNVDGAVLLLRDAGADRSRADASRLQRAVVDASPDAIVGI
FT                   DTDGRIVSWNPAAQRMFGYDDAHARGRTFESLVAMRWLKRKPLTESFDDMHEAVGPIDL
FT                   LCVRRDGRRFRATVSAGPVRSDARACVALSLTLRESGAQRRRDLRAQRSLRGARVARDQ
FT                   AATSNRLKDELLATVSHELRTPLNVIYGWVEVLRNSGDSALQQQAIDAIDRSARSLTRM
FT                   VGDILDASSLATGKLQLDAMPVDVVRLFSDSVGAFQTAASSAGIVLEFDCAASTCVVSG
FT                   DAERLRQMLSNLVSNALKFTPAGGSVTVGLARDDVRVVLTVSDTGQGIVPAFLPYVFDM
FT                   FRRADDSPASSRRGLGLGLSIVRHIAELHGGSVTVKSAGRNRGATFTVTLPVGWQPIGA
FT                   MAWGNAHANGHRDPPMLDTQRILIVDDDATTRESLTAALTTFGAAVAIASTGREALAVA
FT                   ADLRPTVVLSDLAMPDGDGFWLLDALRHAGMNGGGAPPAMRVLAVTAHAGLADERRALE
FT                   AGFDGYLCKPVDVRELADKIVRVTKHDG"
FT   gene            complement(576501..576932)
FT                   /locus_tag="Bcep18194_C7015"
FT   CDS_pept        complement(576501..576932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7015"
FT                   /product="CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7015"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06061"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA5"
FT                   /protein_id="ABB06061.1"
FT                   /translation="MHRVNEIMSQDVVRIAPTDSIRHAAQLMERYDVGALPVCDNNRLV
FT                   GMVTDRDLAVRAISAGKPPETRIQEVASGPIEWCFEDDSLDEIQHYMADAQLRRLPVVD
FT                   HDKRLVGMLSLADIATRSAGPARDDVANTLEGVSQPRRT"
FT   gene            complement(577012..577329)
FT                   /locus_tag="Bcep18194_C7016"
FT   CDS_pept        complement(577012..577329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7016"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06062"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA4"
FT                   /protein_id="ABB06062.1"
FT                   /translation="MANPVPRTNPGMAVAEMFASLSFAGSVAMKDSTRPDPSPPRKHED
FT                   RTRTRHSERHIDQQLEDTFPASDPPATGGVTRIEPDAPPDTPPDSHEEKPRQDPRERGG
FT                   T"
FT   gene            577405..577710
FT                   /locus_tag="Bcep18194_C7017"
FT   CDS_pept        577405..577710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7017"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06063"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA3"
FT                   /protein_id="ABB06063.1"
FT                   /translation="MTIPKRRQGVRYELNVCGGGFDSVKSHFEEWKHEPLIYRPERRMF
FT                   EGKADVRPLGDETFGSTEPARFALQRACDPADTYALAARVRDDGRDLWLVMAAYDA"
FT   gene            577879..578187
FT                   /locus_tag="Bcep18194_C7018"
FT   CDS_pept        577879..578187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7018"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06064"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA2"
FT                   /protein_id="ABB06064.1"
FT                   /translation="MKRIRTISAGLCAMAAACALAACTQPAPYGARGAPPAPPDGHASP
FT                   PGTTMPDANTRYETRPSPGNMMPQGAAGGEPADVPPPGPNGVQGDPPPPRMPPPAQY"
FT   gene            578414..579874
FT                   /locus_tag="Bcep18194_C7019"
FT   CDS_pept        578414..579874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7019"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7019"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06065"
FT                   /db_xref="GOA:Q39NA1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA1"
FT                   /protein_id="ABB06065.1"
FT                   /translation="MSVSLSLQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDQNP
FT                   FLDDGQGDEEPAADAPGPQAEAAAPDAVPPADEVRQPDGDVPEVPEVSEVSLTAAPATR
FT                   GTSRQGDESGGLSPGEWLAAEPSLHQQLHDALRLYQLNRRDREAARIVIDALDDDGYLR
FT                   QELVELLVAADPALLLSEQDLAVALRLVQMLDRPGMAARSLSECLVLQLDAIPAGTTAL
FT                   AEAKAIAREHLERLARRETAEIQRRIGCNPQTLQAACALVRGLDPRPGNHYGSTRGDYV
FT                   VPDVIVRQVRDDWIVTINPAVLPRARLHERYATLFAQSSGERDSPLGQQLQEARWLIRN
FT                   VQKRFDTIQRVGECIVARQRDFFRYGEIAMKPLVLRDIAEELDLHESTVSRATGNKYMA
FT                   TPHGTFEFKHFFPRKLEAAGKGVCSAAAAKVLIRDMIAAERHTDPLSDVALAHNLAGRG
FT                   ILLARRTVTKYRQAMKIPPADLRRRDTA"
FT   gene            579952..580140
FT                   /locus_tag="Bcep18194_C7020"
FT   CDS_pept        579952..580140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7020"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06066"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:Q39NA0"
FT                   /protein_id="ABB06066.1"
FT                   /translation="MPAKSQAQQRAAGAALSAKRGKTNMKDLKPPAQSMARSMSEKALE
FT                   KMASTPRRGKPEHKHDA"
FT   gene            580187..580348
FT                   /locus_tag="Bcep18194_C7021"
FT   CDS_pept        580187..580348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7021"
FT                   /product="protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7021"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06067"
FT                   /db_xref="GOA:Q39N99"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39N99"
FT                   /protein_id="ABB06067.1"
FT                   /translation="MLRYAVIFFIIAIVAAVFGFGGIAAGAAEIAKILFYIFVVIFLVT
FT                   LLLGVVRR"
FT   gene            580345..580731
FT                   /locus_tag="Bcep18194_C7022"
FT   CDS_pept        580345..580731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7022"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06068"
FT                   /db_xref="InterPro:IPR021389"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N98"
FT                   /protein_id="ABB06068.1"
FT                   /translation="MSGAPGRSQRIAELEHALANGFPSQSTVVVHADDASGRLTIQVSW
FT                   VRVPSDEDAREWRCAVDLRFDPDVITRYASLGADDRLRVRTHLCDSARRAVDERKPRVE
FT                   EAAIECNVALDVTRAELDEALRAP"
FT   gene            complement(580886..581143)
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C7023"
FT   gene            581173..581523
FT                   /locus_tag="Bcep18194_C7024"
FT   CDS_pept        581173..581523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7024"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N97"
FT                   /protein_id="ABB06069.1"
FT                   /translation="MQSHSRIWLENDELDNDADDLDTTVHVDVATGRIMFQAAWAEAAD
FT                   PPPETVGHSVVLVLDCDTMERYADLDEGTRMRVHAILHDTVEDLLDRLPDEHVTLTIEL
FT                   TDAMLDAARRLQ"
FT   gene            581789..582103
FT                   /locus_tag="Bcep18194_C7025"
FT   CDS_pept        581789..582103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7025"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06070"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N96"
FT                   /protein_id="ABB06070.1"
FT                   /translation="MPADSARRVSLVDEPPVFDGAELQLHFVVDVDGELQTCAITVEAL
FT                   EDHFGAQSALEADLRDAFEHGRARIEAACAEALAEGNGSVVLHSGDFRAPAGLSRSRRS
FT                   "
FT   gene            582195..582545
FT                   /locus_tag="Bcep18194_C7026"
FT   CDS_pept        582195..582545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7026"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06071"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N95"
FT                   /protein_id="ABB06071.1"
FT                   /translation="MPHRAARRQRRRRTHRANRHDPCMSFYAPVRTSRSRQRETSMLSA
FT                   HEFATLLLVHRAPEQLQIDREDVVALVERHLIVMQYDDASGERRPVLTADGLSLVRCVQ
FT                   RNDASEPDVTDA"
FT   gene            complement(582610..584223)
FT                   /locus_tag="Bcep18194_C7027"
FT   CDS_pept        complement(582610..584223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7027"
FT                   /product="putative filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7027"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06072"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N94"
FT                   /protein_id="ABB06072.1"
FT                   /translation="MAELPDDPIGTAWLIANCDVAPMARPPVLSRIGGRRATETIDGYR
FT                   LETYPELMRPTGDIAAHLQFHLRHEVPQLEFLARLFAQSGPGFVQDWIDSEPTGQYARR
FT                   AAFLYEWLTDGELSVPERLGGNYVDVLDDAKVVTSSRDRIVKNPRWRVNDNLPGTRYFC
FT                   PTLVKTASFMEAAELNVPRLFADLAAEFGEDLLMRAAAWMTLRESKASFAIEGEADRTS
FT                   RIQRFADVMARRTAQGEQPLSDDAAAELQREILGERTTLTHFGFRQSPVFVGETVRFNE
FT                   VVHYVAPGQEDVPAMLDGLRTFLARTSGQSSVMRSTVAAFGFVYVHPLADGNGRVHRFL
FT                   INDVLRRDGVIPEPVILPISAVIMDDAGERRGYDRVLDQVSAPLMEHVRDHIVFDAAQT
FT                   TYPDGVVSNFAFDGAGLAMPLWRYPDLSPHVQYLANIVKRTLTEHMREESRYLRSHALA
FT                   RQVLKEIVEMPDHQADRVLRSIEQNQGQLSNVLAKEMPILQQPGIWPAIVEAVSSAFRN
FT                   GDSTDAAIVDRYRPERPAGQ"
FT   gene            complement(584501..587272)
FT                   /locus_tag="Bcep18194_C7028"
FT   CDS_pept        complement(584501..587272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7028"
FT                   /product="maltooligosyl trehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7028"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06073"
FT                   /db_xref="GOA:Q39N93"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N93"
FT                   /protein_id="ABB06073.1"
FT                   /translation="MTPRATLRLQLHAGFTFDDAAAHAGYFARLGVSHLYLSPVATAEP
FT                   GSRHGYDTVDYGALNAELGGEAGFVRLVDALRAHGLGVIVDIVPNHMGVGGASNGWWND
FT                   VLEWGPASPYAGHFDIDWHPPDAALDGKVLLPCLGTPYGEALAAGDITLDADPATGRFF
FT                   VSCPGRRLPVATATYADILRIANRTDLNALAERFDAAPPRDSARLAAAHAALRDHAVTH
FT                   GPHALDAVLRGADPRHARSRACLHRLLERQHYRLAWWRTAADELNWRRFFDIATLAAVR
FT                   VDDDAVFDAVHALPLRLHAAGYIDGLRVDHVDGLADPRAYCRRLHERLAAQRDAQPFVV
FT                   VEKILAPGEALRADWAVDGTTGYDFMNDVGALLHDPAGAAPLAAHWAHVSGSSRTFTQE
FT                   ALDGKRRVLMRQLAVEHARAARALHGIARAAPATRDVSLVAIQRVLGELAVQLPVYRMY
FT                   PAHDEEPADADRRVLAPAYARACAAVDPADRFALDHVATWLGLPVTRVPRADAAALHAA
FT                   RVAFAQLTAPLAAKGVEDTAHYRYGRLLSRNEVGADAGDFSLSRGAFHARNRHRARTVP
FT                   HGLVATATHDHKRGEDARARLAVLSEMPDAWRTVSLDWSALNRPHRGGAHRDLAWAPGP
FT                   AAEAMLYQTLVGCWPPELAPDDAAGLAALAERVVQWQTKAWREAKRHTDWLAPDMRYER
FT                   DCEAFVRAILMPRGTGDFAHRLHAFVARIVPAGVVNSLTQAVLRMASPGVPDLYQGTEA
FT                   WDHSLVDPDNRRDVPFAALAAERVDEPVASYLQAWPDARVKRALVERMLALRARWPETF
FT                   AAGTYVPLRVRGPLGRHAIAFARCNDESTVVVVATRLAGRLLGEAPELPRVAPAQWGDT
FT                   AVVLPREIDGPWTDWLNAGDTIDVTGRLIKLGNCLAALPVAVLVAVHPTSAS"
FT   gene            complement(587269..589476)
FT                   /locus_tag="Bcep18194_C7029"
FT   CDS_pept        complement(587269..589476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7029"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7029"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06074"
FT                   /db_xref="GOA:Q39N92"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N92"
FT                   /protein_id="ABB06074.1"
FT                   /translation="MTTDVSIAELARAAGLETDWTDAGGVARRVDDGALGALVDALGWP
FT                   CGTATQRVASAAALADANAAPPRIVTGDAGPPLTLPAAIAPPGARFRITLEAGGHVDGR
FT                   VGDAGEHGTLPPLAMPGYHALDVGDRRIGLTIAPPRPQPFDPRTADAGGRWGIAAQLYS
FT                   LRRAGDDGAGDYTALARLAAQAARHGAQAVAISPTHAGFPALPAHDSPYSPSSRRWHNV
FT                   AYLDCDAVPGAAAVHRVPDAAADAPLIDWPQVLPLKLRHLRACFDAWRASDDPSRGAFQ
FT                   RFRAAGGAALDAHARFDALQAFCIEHGAGADWRHWPAPWRQPGSAEVDAFAHAHADTVA
FT                   FHTFLQWCASRALGDAQHAARGAGMATGLIADLAVGSDRAGSDAWAHGATLLRGVSLGA
FT                   PPDLFNAAGQAWGVTTWTPAALRAEGFVPFVELLRAAFAHAGGIRIDHVLGFARMWIVP
FT                   DGGSPRDGAYLRYPVDDLVRLVALEAARHRALVIGEDLGTVPAGFRERLGAQGIAGMRV
FT                   LWFERDAGGTFRPPAEWDRNAIAMSSTHDLPTVAGWWRGVDLAWRRIAAEAAEQSGDTD
FT                   ARNVAPPAPPDEMNEYEQDNTVSRAASASPLKAGPVTPPPAVDPDLVAAHAARATERAA
FT                   LWHALQHAGCAPAGTATPPANAPPVAAMLAYVACSPSPLAILPLEDLLALDAQPNLPGP
FT                   PCGHPNWRQRLPRTIDTLFDADVRDRIAAVVRARRSREPAP"
FT   gene            complement(589473..591344)
FT                   /locus_tag="Bcep18194_C7030"
FT   CDS_pept        complement(589473..591344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7030"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7030"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06075"
FT                   /db_xref="GOA:Q39N91"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N91"
FT                   /protein_id="ABB06075.1"
FT                   /translation="MRSRPARPSGSHAFESSFGTTCVDVDRTRFWLWAPASRTAAVEIE
FT                   GEDAPAVAMTAVGDGWFEATVPCGPGTLYRYRLDGGLAVPDPASRFQPGGVEGPSQVVD
FT                   PAAYRWRHDAWRGRPWHETVLYELHIGACGGHASVERRLPEIAALGVTAVELMPVNAFP
FT                   GMRNWGYDGVLPFAPDASYGRPEELKALIDAAHGLEMQVFLDVVYNHFGPEGNLLPRYA
FT                   PAFFRADRQTAWGPAIDFSREQTSTFFIENALYWLDEFRIDGLRIDAAHAIDDDAWLRE
FT                   LARRVRAYVGDTRHVHLVLENERNAASLLGPGGFDAQWNDDFHNSAHVLLTGERDGYYR
FT                   AYADAPLRHLARTLGEGFAYQGEPSPLHDGAARGEPSAHLPPTAFVAFLQNHDQVGNRA
FT                   FGERLRTLANEDAVRAATALLLLAPSIPLLFMGEEDGSTQPFQFFTDYRGALADAVREG
FT                   RRREFAAFPAFADAAHRDAIPDPNDIATFVRSTLHGSSDETTPDTDAWRRFYRSALAVR
FT                   AALVTPNLPGARALGVDLLTGDGDPQALVARWRLGDGSTLTIALNLGSHDAVLPALPVG
FT                   KIVFETPPRARDRLRDLRLPPRACIAWRDGKVNHDARQHRINGQGRS"
FT   gene            complement(591341..593467)
FT                   /locus_tag="Bcep18194_C7031"
FT   CDS_pept        complement(591341..593467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7031"
FT                   /product="Glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7031"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06076"
FT                   /db_xref="GOA:Q39N90"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N90"
FT                   /protein_id="ABB06076.1"
FT                   /translation="MPTALPARLESGRSYPLGATWDGLGTNFAVFSAHAQRIQLCVFDP
FT                   TGRKELARLDLPECTDEVWHGYLPNAHPGTVYGFRADGPYQPQHGHRFNPTKLLLDPYA
FT                   RKLVGQFRWSDALFGYRVHSSRADLSMDRRDSAPAMPKCVVVDEAFDWRNDRRPRVSWR
FT                   NTVIYETHVRGASMRRAGLRPPERGTFAAFAHPAFIDHLLSIGVTTVELLPVHAFLQQR
FT                   ALVNRGLRNYWGYDTAAFFAPEPAYLATRRLDEIRIAIRQLHAAGIEVVLDVVYNHTCE
FT                   GNELGPTLSWRGLDNASYYRLMPDDHRFHVDETGCGNTLNLSHPRVVQMVMDSLRYWAT
FT                   AFNVDGFRFDLGVTLGREEHGFDPGAGFFDALRQDPVLAQRKLITEPWDLGPGGYQLGR
FT                   HPPGFAEWNDRFRDTVRRFWRGDAGQRPELAARLAGSADLFNHQRRHTWASVNFVTAHD
FT                   GFTLADLVSYSAKHNDANGEDNRDGRDDNCSANWGVEGPSDDAAIRAVRARVARSMLAT
FT                   LFTALGTPMLVAGDEFGRTQHGNNNAYCQDNELSWLDWDLARSDEAVTLMRFVSRLAAL
FT                   RRMYPVMSTPRYPSGDRDAAPGMAEIDWFDERGDAMTVPAWQDRERRALTMRRVGTGRT
FT                   GRTEALLVMLNASSETVVFAPPAPVLDYRVLVDTATPDAGPRAWPADGLDVAAHAAAIA
FT                   VAAVPPDLHSGDSP"
FT   gene            complement(593499..595706)
FT                   /locus_tag="Bcep18194_C7032"
FT   CDS_pept        complement(593499..595706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7032"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7032"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06077"
FT                   /db_xref="GOA:Q39N89"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39N89"
FT                   /protein_id="ABB06077.1"
FT                   /translation="MTDTLFERSDIDALLAGRHPDPFACLGPHGQTGQVVVRAVLPGAK
FT                   SVHALSPEGAELGTLACVDRAGCFAGTIPRNGGAPHYLLAIDWPDARQVIDDAYAFGTL
FT                   LDDAVLARFSAGDPAAVLDCLGATPARIDDTDGVRFAVWAPNAQRVSVVGDFNGWDGRR
FT                   HPMRLRRPSGVWELFVPGIGAGECYKYELRAADGRVLPHKSDPCARATEAPPRTASVVA
FT                   DVAALDAFAWHDEGWMHARPRADRYRVPWSIYEVHAESWQRVPEEMNRSATWDELAERL
FT                   IPYVQGMGFTHVEFMPIAEYPFGGSWGYQPVAQFAPSARFGPVDGFARFVDRAHAAGIG
FT                   VLVDWVPAHFPDDPHGLAQFDGTALYEHADPREGLHPDWHTCVFNVGRTEVGAFLAASA
FT                   LAWARRYHVDGIRVDAVASMLYRDYSRAEGEWVPNVHGGRENLESVAFLRMLNDTLHGA
FT                   AAPAGVVTVAEESTAWPGVTAPTGDGGLGFDFKWNMGWMHDTLAYVREDPVHRRYHHDR
FT                   MTFGLVYAFSERFVLPLSHDEVVHGKGSLVAKMPGDAWQRLATLRAYFGFMWAHPGKKL
FT                   LFMGSEFAQWAEFAHDATPHWDLLDAPAHRGVQRLVRDLNRTYAAEPALHALDCHAAGF
FT                   SWLIGDDRDNSVFAFARRDEAGHLVVAICNFTPVPRASYRVGLPAPGQWRELMNTDAAP
FT                   YGGTNAGNDGAVWAEAVPAHGEAWSALLRLPPLATLWLRPA"
FT   gene            complement(595703..599119)
FT                   /locus_tag="Bcep18194_C7033"
FT   CDS_pept        complement(595703..599119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7033"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7033"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06078"
FT                   /db_xref="GOA:Q39N88"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N88"
FT                   /protein_id="ABB06078.1"
FT                   /translation="MMKREDSLDDVRRAQFPSLAPGGTPRRRRARRRAPALCADDPLWY
FT                   KDAIIYQVHVKSFYDSNNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDI
FT                   ADYRDVHPDYGTLADVRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSTHR
FT                   DYYVWSDTDTKYAGTRIIFLDTETSNWAHDPVAGQYYWHRFYSHQPDLNFDNPAVVREV
FT                   MQVMRFWLDLGIDGLRLDAVPYLVAREGTNNENLPETHAILKRIRATIDAEYPNRMLLA
FT                   EANQWPEDVQEYFGDEDECHMAFHFPLMPRIYMSIASEDRFPIVDIMRQTPELAPSNQW
FT                   AVFLRNHDELTLEMVTDSERDLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINS
FT                   LLLSMPGTPVIYYGDELGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVM
FT                   GSLYGYDAVNVEAQTRDPHSLLNWTRRILSTRRASQAFGRGTIRFLRPENRKVLAYLRE
FT                   LDGDDPVLCVANLSRASQAVELDLSEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFL
FT                   WFVLAEHGREPSWRQPHAEPLPEYVTLVMRRGDARPDIEQLHVLAHDALPSWLARRRWF
FT                   ASKDRAIGAARLNVVTPVPGEPFQYAEAWVESDEPGDVERYVVPLAAAWGGETSQPLFA
FT                   QLALARVRRGHSVGYLTDAFALPAFAHGMLRKLRDGATVPTSDDGRLAFLPEDALAALD
FT                   PGDNADVRWLAAEQSNSSLVIGDAIVLKLVRKVAHGVHPEAEMSRYLTRIGYPNTATLA
FT                   GEVVHVDPDGTPHTVAILQRYADNQGDAWTRSFDFLRRAVDELALPAADEEEPDDTDEE
FT                   PDALLGYAAFAGIIGTRLGQLHVALAQPSDDPAFAPEHATPEHVDGWCADAIASFEHAL
FT                   DVLHTRLDALDPATRAAADTLLASRDAAVRALGELVPRTLDAQCIRIHGDFHLGQVLDV
FT                   QGDALLIDFEGEPARPLERRRAKSHPLRDVAGLLRSLSYVSAIAQFAIEKAPPQAAGRK
FT                   RALFDRFGQAAADRFVDCYRAAAELAPARFVDPRYAYRLLALFLIDKASYELCYEAANR
FT                   PDWLSVPVGGLAALVERLLDGGAASDDGDTP"
FT   gene            complement(599116..602508)
FT                   /locus_tag="Bcep18194_C7034"
FT   CDS_pept        complement(599116..602508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7034"
FT                   /product="Alpha amylase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7034"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06079"
FT                   /db_xref="GOA:Q39N87"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N87"
FT                   /protein_id="ABB06079.1"
FT                   /translation="MDSTPIFAPHIQFCDARLVGPLDAWPQTFAQVAGMGFDHVLVGAF
FT                   WAASVAGFPRHVADFHRPAQSFATRASALETFSRLAQLAQGHGLRLLLEVVPDRVAREN
FT                   PLRAEHPDWYVERTHDDALIDPRGTAHAQDVAHANPGDDAARDALSAWWCKHLAAFADA
FT                   GAAGFLIDAPHHLPADWWPGWRAALRRARPDVAVLANVPGHARDALAQLEGTGFDAVFS
FT                   SVRWWDLRAPWFVDEHRLLRRIGSPIAFPDAFDGTRLADDWPDAPDDTVARAYRRALWT
FT                   AAAVGTGWLVPMGFERGVTVPLMARDADAARYRAAFERARFDLSGAIADANAWRRATPV
FT                   AAARGEIVQLSAPGAAATALLRGTGPSLEHDEAALLIALNPDLDAAVTVDPATILPGVP
FT                   GGFTRVATPDAAQTHPPAALEPFTLEPGAYALLHAWQAPPVTTRGDAAHERAALSAALA
FT                   AERIAIERVEPSVDGGRFAVKRVIGETLVVHASIFTDGHAHLAAALQWRAAGDDDWREI
FT                   PFEAEPNDGWHARVALDRLGRHEFRVLAWRDDWASLVHDVAKKHAAGQDVTLELREAQL
FT                   LLATALKLADPLDARALTQMKQLVAEFKDAPADARLAQLGAAPLADAFAALRYRPFVTH
FT                   DETTFPVDVERRAARFSSWYEMFPRSASDDPHRHGTFDDVIAHLPRIRDMGFDVLYFPP
FT                   IHPIGTTARKGRNNSLKAGPDDVGSPYAIGSPDGGHTAVHPQLGTLDAFRALVDAARGH
FT                   GLEIALDFAIQCSPDHPWLAAHPGWFAWRPDGSLRFAENPPKRYQDIVNPDFYAPDALP
FT                   DLWLALRDAVLFWVDAGVRIFRVDNPHTKPLPFWAWMIDNVRGRHPDVVFLSEAFTRPG
FT                   MMVRLAKVGFSQSYTYFTWRESKREFIDYLTELTTGPAREFFRPNFFVNTPDINPRHLQ
FT                   NAPRTQFVIRAALAATLAGSWGLYSGFELGESAPLPDSEEYANAEKYELRARDWSKAAH
FT                   IGAEVARLNRARRAHPALQTHLGLTFADADNDTVLVFVKATPAFDSVVVVAISTDPWHP
FT                   QVANFTLDASLWRGFGLVDGEPLDALEQDATHAETWRGHRQYVSLDPHVRPYAIWRVTP
FT                   SPGAARAAAREPGDARSPSGGHG"
FT   gene            complement(602651..603190)
FT                   /locus_tag="Bcep18194_C7035"
FT   CDS_pept        complement(602651..603190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7035"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06080"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N86"
FT                   /protein_id="ABB06080.1"
FT                   /translation="MPGADRPARGLRTDRTSNRCRHAPRGREAVRHPATGRRSARRHPP
FT                   GFAPANRLADRSSRPFVKEPRVNPTTDLLSYLVTNQLAVRMRSGAWPTTDQVVDAQRAW
FT                   LACHHAECGWLARVRIADASATIAQGIYDIAVANRDPDSGQHGRLDADSPELHALRERC
FT                   DALLQRIDDDRDIGPR"
FT   gene            603281..603523
FT                   /locus_tag="Bcep18194_C7036"
FT   CDS_pept        603281..603523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7036"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06081"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N85"
FT                   /protein_id="ABB06081.1"
FT                   /translation="MQNQQEAQVRDPYRGHEIRVWARRNDSGAWRDEVQVYVGGERIEL
FT                   VVPAADGPDWMTENEALLAGVERGRYMVDKRIDDD"
FT   gene            complement(603624..604298)
FT                   /locus_tag="Bcep18194_C7037"
FT   CDS_pept        complement(603624..604298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7037"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7037"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06082"
FT                   /db_xref="GOA:Q39N84"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N84"
FT                   /protein_id="ABB06082.1"
FT                   /translation="MRIETSFLFDLDGTLVDSVYQHVLAWKEALDAEGIELSVWRIHRK
FT                   IGMSGGLFLNQLLRETSGDLDAERVERLARLHAAAYQRLRAQVRPLPGARELLAALSSA
FT                   GIRWAIATSGRMETAAINLEALGVDPAKNVVVTRDQVKYAKPDPDLFLTAAAQLNVPIE
FT                   HTVVVGDSIWDMLAAARCRSLGVGLLSGGYGSDELERAGALRVYDDPADLLWHLDEIAA
FT                   RP"
FT   gene            604524..605708
FT                   /locus_tag="Bcep18194_C7038"
FT   CDS_pept        604524..605708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7038"
FT                   /product="Major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7038"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06083"
FT                   /db_xref="GOA:Q39N83"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N83"
FT                   /protein_id="ABB06083.1"
FT                   /translation="MATPDAVSSKHSWWGVLTLALTAFIFNTTEFVPVALLSAIGDSLH
FT                   MRPTDVGLMLTIYAWAVAVVSLPLTLATRHVERRKLLTGALLVFIGSHVVTGVAWNFAV
FT                   LMVGRLGIACAHAVFWSISVPLAVRLAPSDRKSRALSLLAMGTAIAMVAGIPLGRVVGE
FT                   TFGWRVTFLIIAGAAGVALLLLRATLPVSPSQGAGSLSSIGVFLRKPALVALYAITVLV
FT                   VTAHFTSYTYIEPFVQSVNHASSSRITYVLILFGVAGIPAAICFNRVYPHRPDDFLLGS
FT                   IVALAGCLLILFPCALNIVTLSVHTLVWGGAIVCFGLAMQAWVLKLAPEGTDLAVSIFS
FT                   GLYNVGIGAGALIGNHIASDFGLPWVGTFGGVVGAVAVGIAWLALRLHARQAVA"
FT   gene            complement(605771..606547)
FT                   /locus_tag="Bcep18194_C7039"
FT   CDS_pept        complement(605771..606547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7039"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7039"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06084"
FT                   /db_xref="GOA:Q39N82"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N82"
FT                   /protein_id="ABB06084.1"
FT                   /translation="MNANTKPAQLDGRIALVTGASSGIGRASAIELARRGAKVVVSARR
FT                   KAELDRLVDEIVTAGGEAKAFVADVANEDDLRKLFDFAVETYGRLDIAFNNAGTEGVFA
FT                   PLLEQDAERFDRVFEPNVRGVFNSMKYAAEIMLRQGSGSIINNASMGGLIGFENASVYI
FT                   ASKHAVIGMTKTASIEWFKRGVRVNALCPGLIETPFHHRGIWPSEDAQQAFAASTPAGR
FT                   WGSAEEMATIVAFLASDDSSYVSGHALVADGGYSVA"
FT   gene            606732..607634
FT                   /locus_tag="Bcep18194_C7040"
FT   CDS_pept        606732..607634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7040"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7040"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06085"
FT                   /db_xref="GOA:Q39N81"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N81"
FT                   /protein_id="ABB06085.1"
FT                   /translation="MLNRLDILKIFSAAAAAPTFREAAARLGVSPQVVTRAVRDLEEML
FT                   GETLFHRTTRSIRITAFGQAFARDAQTALAAVDGLFEPAAGQADEPVGVVRITAPSGMG
FT                   RHYVQPILSDLMQRYPGLVPDLRLSDVPSPVVDEQIDIGVRVGAIGDNRFVARMVGPLP
FT                   MWIVGAPSLIRRLGEPKNRKELESMPVTCLIDRASGRAWPWMFRGEHQFVPSSPAYLTD
FT                   DTEVEIEAVCAGVGLGQCSEYLVRPYIDKGRLVRLLPGLEPEPWKLHVYRPRRGPMPRR
FT                   IRVVYDELVAKLAGATWRG"
FT   gene            607874..608311
FT                   /locus_tag="Bcep18194_C7041"
FT   CDS_pept        607874..608311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7041"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06086"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N80"
FT                   /protein_id="ABB06086.1"
FT                   /translation="MPIPRIETRDAMGDPDVVYLNPDHVLWMSQPTAAQRRPGGTAIRV
FT                   DDRVKGGSLLMADNPPAAQLLQDLGPFVTVTLANPSSDYPDGLVHVRAHAIVKIATDDH
FT                   DKPLAERTIGWVHVQDGSAFKVRDFAGVAAQWQASVAGAGR"
FT   gene            608617..609330
FT                   /locus_tag="Bcep18194_C7042"
FT   CDS_pept        608617..609330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7042"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7042"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06087"
FT                   /db_xref="GOA:Q39N79"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N79"
FT                   /protein_id="ABB06087.1"
FT                   /translation="MNLSASDITPEELRLFGDIVARLEELGPVVDVRTVVLPAITQLLR
FT                   ADFAASFDCDEQTGLWRNGFSYNVDPLQIARYEAWFQHVDPVTSQLRARRVATCVDDVV
FT                   NRRELEQTEFYNDFLCRDGMHHGINVYAFDGATHVGDLRIWRAKGRPDFTGRDKLLLNG
FT                   IEPFFRRALLRRRHACAGLTERESDVARLVAAGYTDKDVARTLGIGVPTVRTHLRRVMA
FT                   KKGVANRASLAAALA"
FT   gene            609440..610942
FT                   /locus_tag="Bcep18194_C7043"
FT   CDS_pept        609440..610942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7043"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7043"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06088"
FT                   /db_xref="GOA:Q39N78"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N78"
FT                   /protein_id="ABB06088.1"
FT                   /translation="MPTLGTLTLTEARHALLRREFSCVDYAYALIERHARWRYLNGFTC
FT                   VDDARLLAEAARCDRDLATSATPHALLGLPIAIKDNIDTACLPTGNGTLALHNRVPPQH
FT                   APVVARLLAQGALIAGKANLHELAFGVSGNNRVTGAVRNPYDFNRIPGGSSSGSGALVG
FT                   AGVVPAALGTDTGGSVRIPAALCGAVGLRPTVGRYPSGGVAPISRTRDTVGPIARSVED
FT                   IALLDAILSGTGTGTGTGTGTGVPTAMPMRSTTRPVRLAVPRTTFWRGLAQDVEMVANA
FT                   AVAKLAQAGFECVDIDLNDYPGFFDDEPAVIAMVEFRSSMHAYLVENGYDLSVDDIVAN
FT                   VGSPDVAKIARHITGPDGIGEAAYRTALDRRTRSRAAYRQCLADSGADALVFPTTIATA
FT                   CPIPAGDAMILNGAPASVFSTYIRNTEPGSNAGIPGMTLPAGLTAAGLPVGLALDGAAG
FT                   TDRELIAVALEVERVLGRLPAPDDGYGVEGRLGGYPPSDGTS"
FT   gene            611576..612712
FT                   /locus_tag="Bcep18194_C7044"
FT   CDS_pept        611576..612712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7044"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7044"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06089"
FT                   /db_xref="GOA:Q39N77"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N77"
FT                   /protein_id="ABB06089.1"
FT                   /translation="MSSVTIERIETRLVDLPTIRPHKLSVATMHGQTLMLVKVFCSDGV
FT                   TGLGEGTTIAGMAYGPESPEAMKLAIDTYLAPAIVGKDATRIQTLMAFLGKLAKVNHFA
FT                   KSALETALLDAHGKRLGVPVSELLGGRRRDRLPVAWTLASGDTATDIAEAERMLDQRRH
FT                   NVFKLKIGAKSPETDIRHVAEIKKAVGDRASVRVDVNMAWSETQAARAIPALADAGCEL
FT                   VEQPVASAAALARLMRRFPVALMADEILQGPDSAFDIAKHHGADVFAIKIEQSGGLFAA
FT                   QRVAAIADAAGIELYGGTMLEGAFSTVASAHLFASFANLQWGTELFGPLLITEEILTQP
FT                   LDYSDFELTVPDGPGLGIELDEDKVRRFTRDGLTKVAR"
FT   gene            612763..613707
FT                   /locus_tag="Bcep18194_C7045"
FT   CDS_pept        612763..613707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7045"
FT                   /product="Catechol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7045"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06090"
FT                   /db_xref="GOA:Q39N76"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N76"
FT                   /protein_id="ABB06090.1"
FT                   /translation="MSVKVFESREVQDLLKAASNAGADSAKGGNARTQQVVLRLLGDLF
FT                   KAIDDLDITPDEVWAGVNYLNKLGQDGEAALLAAGLGLEKFLDIRMDAADKAVGLDGGT
FT                   PRTIEGPLYVAGAPVRDGVSKIDLDADDGAGPLVIHGTVTGLDGKPIAGALVECWHANS
FT                   HGFYSHFDPTGKQSDFNLRGAVKTGADGKYEFRTLMPVGYGCPPHGATQQLLNGLGRHG
FT                   NRPAHVHFFVDSNDHRKLTTQFNIDGDPLIWDDFAYATREELIPPVVDKTGGTALGMKA
FT                   DAYQDIEFNFVLTPLVQGKDNQVVHRLRAAATA"
FT   gene            613807..615180
FT                   /locus_tag="Bcep18194_C7046"
FT   CDS_pept        613807..615180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7046"
FT                   /product="benzoate 1,2-dioxygenase, alpha subunit"
FT                   /EC_number="1.14.12.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7046"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06091"
FT                   /db_xref="GOA:Q39N75"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N75"
FT                   /protein_id="ABB06091.1"
FT                   /translation="MGGANMSATIDQATDLDHLLATAVQDDKEAGVFRCRRDIFTNAEL
FT                   YELEMKHIFESNWVYLAHESQIPANNDYYTTWIGRQPIVITRDKTGELHAVINACAHKG
FT                   AMLCRRKHGNKGSFTCPFHGWTFSNTGKLLKVKDEKTTEYPVQFNTHGSHDLKKVARFE
FT                   NYRGFLFGSLSADVLPLEEYLGEARVIIDQIVDQAPNGLEVLRGNSSYIYEGNWKMQME
FT                   NGCDGYHVSTVHWNYAATMGRRKEDGTKAVDANSWSKSVAGVYGFDNGHILLWTQTMNP
FT                   EVRPVYQHREEIKARVGDVQADFIVNQTRNLCVYPNVFLMDQFSTQIRVVRPLGVDKTE
FT                   VTIFCFAPKGESETDRTIRIRQYEDFFNVTGMGTADDLEEFRACQAGYAGITAMWNDLS
FT                   RGAPLWVDGPDENAKKMGLNPRISGERSEDEGLFVCQHEHWVHVMRDALKKERGEVAA"
FT   gene            615177..615665
FT                   /locus_tag="Bcep18194_C7047"
FT   CDS_pept        615177..615665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7047"
FT                   /product="2-chlorobenzoate 1,2-dioxygenase"
FT                   /EC_number="1.14.12.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7047"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06092"
FT                   /db_xref="GOA:Q39N74"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR017641"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N74"
FT                   /protein_id="ABB06092.1"
FT                   /translation="MSFDYRTVCAALYREARLLDDRQWDEWLTCYTEDVTYWMPAWDDD
FT                   DRPTEDHQSQISLMYYPDRGGLEDRVFRIKTERSGASTPEPRTSHNVTNVEVLAERDGE
FT                   VDVRYNFHTLNHRYRVTDHFFGTMFVTLRKVGDELLISYKKIVLKNDYIRQVLDVYHV"
FT   gene            615710..616732
FT                   /locus_tag="Bcep18194_C7048"
FT   CDS_pept        615710..616732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7048"
FT                   /product="Ferredoxin/Oxidoreductase FAD/NAD(P)-binding
FT                   protein"
FT                   /EC_number="1.18.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7048"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06093"
FT                   /db_xref="GOA:Q39N73"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N73"
FT                   /protein_id="ABB06093.1"
FT                   /translation="MSSYKIALNFEDGVTRFIDCKAGEKVLDAAFRAKINLPMDCSDGV
FT                   CGTCKCRAESGSYDLGDDYIEDALTEDEKDGGLVLTCQMVPQSDCVIAVPTSSVACKTG
FT                   QSGFAATVTKVEQHNDAAVVLELDVGAAAPVFLPGQYVNIDVPASGQHRSYSFSSAPAD
FT                   AKVSFLIKKIPGGVMSTWLESAQPGDKLELHGPLGSFYLRDVQRPLLFLAGGTGLAPFL
FT                   SMLEVLARSGSQQKVHLIYGVTRDLDLVLVEAIEAFAATLPNFSFATVVADAASSHARK
FT                   GWVTQHIPADALNDGDVDVYLCGPPPMVDAVRKYFDDEGVKPNSFHYEKFTPNVTAKAA
FT                   "
FT   gene            616729..617505
FT                   /locus_tag="Bcep18194_C7049"
FT   CDS_pept        616729..617505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7049"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7049"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06094"
FT                   /db_xref="GOA:Q39N72"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N72"
FT                   /protein_id="ABB06094.1"
FT                   /translation="MIMQRFSGKVIVVTGAAQGIGRGVALRAAAEGGRVLFVDRADFVA
FT                   EVAAEATGGETAGFVADLETYDGAHAAIAHAVQAFGGIDILINGVGGAIRMRPFAEFEP
FT                   AQIDAEIRRSLMPTLYTCHAVLPHLLARGGGTIVNISSNATRGIRRVPYSAAKGGVNAL
FT                   TAALAMEYAAHNIRVVATAPGGTSAPPRRVPRNAAGDSEREQAWMGEAVRQVTESTFLK
FT                   RYGSLDEQIAPILFLASDEASYITGTVLPVAGGDTG"
FT   gene            617597..617995
FT                   /locus_tag="Bcep18194_C7050"
FT   CDS_pept        617597..617995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7050"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7050"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06095"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N71"
FT                   /protein_id="ABB06095.1"
FT                   /translation="MRDRKAIVPAGMEAVYEKIGYAPGLKVGDTLYVSGQIGRDAAMQL
FT                   VEGREAQIVQAFDNLKRVLEAAGASFNDVVDLTTFHTDMRDLPLFMQVRDRYLAAHPKP
FT                   AWTAVGAHMLGGAPGYIVEIKAVAVLPA"
FT   gene            618170..619033
FT                   /locus_tag="Bcep18194_C7051"
FT   CDS_pept        618170..619033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7051"
FT                   /product="amidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7051"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06096"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N70"
FT                   /protein_id="ABB06096.1"
FT                   /translation="MVRGNAASFLSFRRESAMKCLPRAIFAALAFTVAQAALAQVPGTV
FT                   QLEDMTWTELRDSIRAGKTTILIPIGATEQSGPYVALGKHNARVRVLSERIAEGLGNAI
FT                   VAPVIAYVPEGGYAPPTSHMRFPGTITVPDDVFEKTLESAANSFRVHGFTNIVFLGDHG
FT                   GYQNDIKQSVARLNKSWAGTGARAFVPSAYYGTSSDGYDQILREHGVPAADIGTHAGLA
FT                   DTSLLLAVEPRMVRVDKLRNAAKPGAVDGVYGGDPRHASVELGRLGTDAIVSRTVDAIR
FT                   KEIAGR"
FT   gene            619095..620273
FT                   /locus_tag="Bcep18194_C7052"
FT   CDS_pept        619095..620273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7052"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06097"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N69"
FT                   /protein_id="ABB06097.1"
FT                   /translation="MQPRFRRHIRFPRSAIVIVAALAGFGAHGAIAASAVAAVPGMPPV
FT                   IHPDNLYSEAQAGRMSAAVAGALPRIYVPNLRSNDVYVIDPATYKVVDRFAVGRSPQHV
FT                   VPAWDLQTLWVANNAEGRTDGSLTPIDPKTGKPGQAVSVDDPYNMYFTPDGKDAIVVAE
FT                   AHARLDFRDPKTMALKSSLDVPQCKGINHADFSIDGRYALFTCEFGGKLAKIDFVNRKV
FT                   VGYLELDRKGMPQDIRVSPDGKVFYVADMMADGVYVIDGDAFTKIGFIPTGVGTHGLYP
FT                   SRDGTQLYIANRGSNRVHGPHHGKGSVSVLDFATRKVVATWPIPGGGSPDMGNVSADGK
FT                   TLWLSGRFDDVVYAIDTASGAVRLIPVGMEPHGLTVWPQPGRYSLGHTGNMR"
FT   gene            620336..620998
FT                   /locus_tag="Bcep18194_C7053"
FT   CDS_pept        620336..620998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7053"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06098"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N68"
FT                   /protein_id="ABB06098.1"
FT                   /translation="MKPAQATAVAQTARGSCAGPARRRAWRPRLAGTRCHMSETQPARV
FT                   AAVAAATWRPNRRKPMTERQSPDTTPPHAEPSAHDALEHLLGSLHRHGFLHLATEVVSA
FT                   NARLADTFVDALDKPGMQSGMQNLAVLLMALSRIPPEQFGKAVFAAADALHHIGAWQPA
FT                   QHAHVAPGVRGAYRLLHDEALWDALTPLLEGLKVFAQGLARDPETPVTALGEKTTGT"
FT   gene            complement(621131..621841)
FT                   /locus_tag="Bcep18194_C7054"
FT   CDS_pept        complement(621131..621841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7054"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7054"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06099"
FT                   /db_xref="GOA:Q39N67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N67"
FT                   /protein_id="ABB06099.1"
FT                   /translation="MPIRILLVEDDAQLSALIADYLRMHQYEVDTLLDGTDAVATIVAR
FT                   HPDLVLLDINLPGKDGFEICREARMRYDGIVIMMTGRDELFDELLGLEFGADDFLHKPV
FT                   EPRILLARIKAHLRRMRMRPGDVEPVSPLRFQFGKFSIDRADRKVHLPDGSAPRLTSTE
FT                   FDLLWALVCRAGEVVSREDLTQLLRGIEFDGFDRSIDGRISKLRRKLHDDVTEPKRIKT
FT                   IRCKGYQFSKHAWD"
FT   gene            622332..622664
FT                   /locus_tag="Bcep18194_C7055"
FT   CDS_pept        622332..622664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7055"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06100"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N66"
FT                   /protein_id="ABB06100.1"
FT                   /translation="MEPLQVIQRIEVLTNAIEVAVARADWSEAVRAAETRSMFLMTLVP
FT                   DQPDEVHAAIGKMWEIDIRISTAARETLEALVTEGRKALHETGLAAQSLSRGAQALASR
FT                   SPAWLS"
FT   gene            complement(623042..623581)
FT                   /locus_tag="Bcep18194_C7056"
FT   CDS_pept        complement(623042..623581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7056"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7056"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06101"
FT                   /db_xref="GOA:Q39N65"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N65"
FT                   /protein_id="ABB06101.1"
FT                   /translation="MPLISSPPVLDTPRLILEGHPLGDFEALATMWAEPKVVEHIFNGE
FT                   PSAPRDSWMRMLAYRGLWPLLGYGYWAIREKASGRYVGDLGFADFHRLIEPSIRNVPEA
FT                   GWALATWAHGKGYATEALSAALAWLDGQQRFERSVCLIAPTNVASIRVAEKAGYGEPVQ
FT                   IRFNDTDSLLFSRASR"
FT   gene            623949..624950
FT                   /locus_tag="Bcep18194_C7057"
FT   CDS_pept        623949..624950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7057"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7057"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06102"
FT                   /db_xref="GOA:Q39N64"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N64"
FT                   /protein_id="ABB06102.1"
FT                   /translation="MTLESDWLSRFMALVTVTGKLEIRCAFGAPWAITYERSPACEIPY
FT                   HAVLRGRAILENPDDGTVRELGGGDLVLLPHGSPHVLHDGSGLPPVPAIKRPGGHVFIG
FT                   ENAGTGERLDMLCGRFVVAPPHDRLIRRHLPPDLVVRAATDSRTPDALAATARLTALVE
FT                   LMRAESLEQQLGGLAILNALSAALFALALRAISESGQAPTGLLALAGQPRLAAAIVAML
FT                   DDPAKPWTLPELAALCSMSRATFMRHFQSTLGHSAADLLTDIRMSLAANALRQPSASAE
FT                   AVSADVGYQSVAAFRRVFTRWAGMTPGDWRRQSLGGPRDTPASDDGEAGDAE"
FT   gene            complement(625235..625777)
FT                   /locus_tag="Bcep18194_C7058"
FT   CDS_pept        complement(625235..625777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7058"
FT                   /product="Alkylhydroperoxidase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7058"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06103"
FT                   /db_xref="GOA:Q39N63"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N63"
FT                   /protein_id="ABB06103.1"
FT                   /translation="MSRIAIPAIETATGATADVYAQVRKVAGGTVPNLFAAVGHLAPNA
FT                   LAAVLNAEGVLAGGTLSKQDLETIKLLVSADTGCDYCVAAHNLLGKMTGLSADALRAIR
FT                   SSEPNTGDAKRDALIRFVLNLQRTSGTITDDEFAAIREAGYTDTQLAEISLTIALTIFT
FT                   NTFNRINDTVVDFPPVK"
FT   gene            complement(625917..626138)
FT                   /locus_tag="Bcep18194_C7059"
FT   CDS_pept        complement(625917..626138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7059"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06104"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N62"
FT                   /protein_id="ABB06104.1"
FT                   /translation="MSDNFTSHTPNLSASAIWALERLADVRYGRDAPALGWSIARELVS
FT                   AGFVSHSAHGRSGASITAEGRTFLKSRK"
FT   gene            complement(626202..626465)
FT                   /locus_tag="Bcep18194_C7060"
FT   CDS_pept        complement(626202..626465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7060"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7060"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06105"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N61"
FT                   /protein_id="ABB06105.1"
FT                   /translation="MATVVYVEIGPAWNRNRGYTAREAAVDAARGFESDILLIANGISS
FT                   DAKDSAAIAALQVHGGTSAQVLATGPDEEAALQALLPVLQAR"
FT   gene            626502..626831
FT                   /locus_tag="Bcep18194_C7061"
FT   CDS_pept        626502..626831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7061"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06106"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N60"
FT                   /protein_id="ABB06106.1"
FT                   /translation="MCGAGPAVRQARVKRALPHDSGKPAAQPGCAILRGCAGILGETGR
FT                   KSGERRENDDYNTAFKICVLHYNVVCAEAGPPTRRREPAGRPGDAASAPGIFIDDSTPP
FT                   EWKLQ"
FT   gene            626816..627172
FT                   /locus_tag="Bcep18194_C7062"
FT   CDS_pept        626816..627172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7062"
FT                   /product="PhnA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7062"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06107"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N59"
FT                   /protein_id="ABB06107.1"
FT                   /translation="MEAAMNAAPACPQCAMENTYPDGTLTVCADCGHEWSAGAGTETGD
FT                   EPAGDVVKDANGNVLSDGDSVVLIKDLRVKGSSITLKMGTKVKSIRLVGGDHEVDCKTD
FT                   MGGFMLKACYLKKV"
FT   gene            627216..628064
FT                   /locus_tag="Bcep18194_C7063"
FT   CDS_pept        627216..628064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7063"
FT                   /product="Spermidine synthase-like protein"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7063"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06108"
FT                   /db_xref="GOA:Q39N58"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N58"
FT                   /protein_id="ABB06108.1"
FT                   /translation="MAEDRISYDAFIRFLATPLNDGRPFVLETQHALSLHFDHFGTQSF
FT                   MSLRDPGRLELGYTRVMMGFLLLQPEPAHICMLGLGGGSLAKYCYRHLPGSAIDAVEIN
FT                   PDVIALRDVFRIPADDGRFRVVCADGADHLERADVRTDVILHDAFVADGMRGRCAGATF
FT                   LAACHERLSETGVLAINFMDDDPALPAHLEQLRSVFGASYTLVPCGDDNNFIAFAWKGG
FT                   NRLPSLRILLERALACARAGELKLAATARRMKAGESVDPQRLVMCAQPHGRWEIGGANA
FT                   R"
FT   gene            complement(628098..628283)
FT                   /locus_tag="Bcep18194_C7064"
FT   CDS_pept        complement(628098..628283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7064"
FT                   /product="Helix-turn-helix protein, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7064"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06109"
FT                   /db_xref="GOA:Q39N57"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N57"
FT                   /protein_id="ABB06109.1"
FT                   /translation="METKTARLTVLIDPAKKEAFEMLCAEQDLTPSQVVRQLIREYLDR
FT                   HGVTYKTKSALGKRMK"
FT   gene            complement(628370..629128)
FT                   /locus_tag="Bcep18194_C7065"
FT   CDS_pept        complement(628370..629128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7065"
FT                   /product="protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7065"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06110"
FT                   /db_xref="GOA:Q39N56"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N56"
FT                   /protein_id="ABB06110.1"
FT                   /translation="MPAQYFRNLTGKHRSATANRQLGFSLAFVAGAANAGGFLAVKQYT
FT                   SHMSGIVSAIADQTALGDLRLALAGISSLGSFLIGASCSAILVNWGRRRGLHSQFMLPL
FT                   LVEAALLLLFGLLGSHLALWETFFVPVTVTLLCFIMGLQNATITKLSGAEIRTTHMTGI
FT                   VTDLGIELGKLFYWNRSAADVDTHAVVANRSKLRIHATMLTSFFIGGLAGAIGFKHVGY
FT                   VSTVPLAAVLVTLAIVPVIDDLLALLRSRR"
FT   gene            629310..629744
FT                   /locus_tag="Bcep18194_C7066"
FT   CDS_pept        629310..629744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7066"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06111"
FT                   /db_xref="GOA:Q39N55"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N55"
FT                   /protein_id="ABB06111.1"
FT                   /translation="MSSSAAGLRLRRRMAAPPAFAITSAHRFMTPIKFILRYTAIPFTA
FT                   IVAVVIWTVIPSSKEIDARQYAALSRAYASFPLPFRREISETMDHGRINDRRYQALVRD
FT                   SLGNGVALDWPASGVGELADERQKLAELIQADSDLQGHHQ"
FT   gene            629741..629953
FT                   /locus_tag="Bcep18194_C7067"
FT   CDS_pept        629741..629953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7067"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06112"
FT                   /db_xref="GOA:Q39N54"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N54"
FT                   /protein_id="ABB06112.1"
FT                   /translation="MKTLLVSVAFAMIIASLIFALYFMNHDRGKSKRMAWSLAARVGLS
FT                   VTLFLSLLIAYKLGWIEPTGLPIGR"
FT   gene            complement(630007..630486)
FT                   /locus_tag="Bcep18194_C7068"
FT   CDS_pept        complement(630007..630486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7068"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06113"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N53"
FT                   /protein_id="ABB06113.1"
FT                   /translation="MPPSRRGPIRGTTVDNGARNAASIAIRPRDAADDAASRCQWKDDQ
FT                   AFYEVALDEDIFVATQAGLRDPNGSGFGSGAFDTAGDLLGLAHTHCHHARWTTCFRWRS
FT                   RAGAVSVSIASGTKRVRRSTPPRWLCPDAFWILESIDFEIKSRYLDKYSYHNSSI"
FT   gene            complement(630577..631803)
FT                   /locus_tag="Bcep18194_C7069"
FT   CDS_pept        complement(630577..631803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7069"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7069"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06114"
FT                   /db_xref="GOA:Q39N52"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N52"
FT                   /protein_id="ABB06114.1"
FT                   /translation="MTKQIRIGSGDAAFDAYLALPEAGNGPTIVLLQEIFGVNAEMREV
FT                   ADLYAAEGYVVIAPDLFHQFAPNIELGYGDDDHAKAFDYYQRFDVARAIVDIRATVDYA
FT                   RALPESTGKVGVLGFCLGGKLAYLAAARCGVDCAVGYYGVGIEQSLDLVERIACPIALH
FT                   FGGTDTLNPPETVTAIRAALDSKPNVKLYEYAGAGHAFSRSGPTFVKTAAMSAHTRSLA
FT                   VFRKALGPDYDLGALADHHFHLEFAARDPEETMQTMVPEPYVNHVPTMTGGTGYTELKR
FT                   FYTHHFIHNNPADMAMVPISRVVGVDRMVDEFILTFTHDREIDWLLPGVAPTGKRVEIP
FT                   MIVVVAFRGPKLYNEHIYWDQASVLVQLGLLDPQGLPVSGVEAARKLLDETLPSNALMA
FT                   RWRESEPAR"
FT   gene            complement(631856..632704)
FT                   /locus_tag="Bcep18194_C7070"
FT   CDS_pept        complement(631856..632704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7070"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7070"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06115"
FT                   /db_xref="GOA:Q39N51"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N51"
FT                   /protein_id="ABB06115.1"
FT                   /translation="MSTTPTPEARLRDRSRNAAARLEGKVAIITGATQGLGADIARSLA
FT                   EEGACVLIAGLDADAGHALAASIGASARFAPTDVTDDAQLERAITTAIAAFGGLDLIVN
FT                   NACSYDDAGLASTREQWARLLDVNLVSAAILAQKAAPHLRRGGVVVNLGSVGGKFGAAG
FT                   RALYPASKAALLQLTRNLAVDLAPRGLRAVSVSPAWTWSPSLEHLAGGSVERADRVGRP
FT                   LHPLGRVGRGDEVGRVVAFLCSDDASWITGVDVPVDGGFSMLGPDQGVSPREWFGRQPP
FT                   Q"
FT   gene            complement(632701..633339)
FT                   /locus_tag="Bcep18194_C7071"
FT   CDS_pept        complement(632701..633339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7071"
FT                   /product="Isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7071"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06116"
FT                   /db_xref="GOA:Q39N50"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N50"
FT                   /protein_id="ABB06116.1"
FT                   /translation="MNAKPLSGTLARTAVIALHYQNDVLDPHGKIRVGFDADQPERAAV
FT                   LDAARALLAGARGYGLPIVHVRIAFRDDYADLPRNAPIFVRTAELGAVRDGSWGARFHP
FT                   TLDPDPARALDYVVHHRCTSGFIGTPLEQILAAHDVRHVIVAGVATHSTVEMTARHAAD
FT                   LGYRVTVAADACACADRRQHDASLESMRLIATISTVDELFGTDSQTEGE"
FT   gene            complement(633336..633869)
FT                   /locus_tag="Bcep18194_C7072"
FT   CDS_pept        complement(633336..633869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7072"
FT                   /product="Aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /EC_number="1.14.12.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7072"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06117"
FT                   /db_xref="GOA:Q39N49"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N49"
FT                   /protein_id="ABB06117.1"
FT                   /translation="MMLHDPAFDVSTVAVDPAARDATLLAHAAQFLFREARLLDTRAFA
FT                   PWLDLWTPDGMYWLPHEPGQASPHDHISLFWEDATLREVRAGRVTNLRNWSQQPTTRTA
FT                   RIVGNVIVDGRDAAGRLIVHSTLIVHEWRLGQRALAGLVTHKLDTSGDDWKIYLKRVDL
FT                   VNSTDALANLEVFV"
FT   gene            complement(633866..635203)
FT                   /locus_tag="Bcep18194_C7073"
FT   CDS_pept        complement(633866..635203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7073"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /EC_number="1.14.12.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7073"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06118"
FT                   /db_xref="GOA:Q39N48"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N48"
FT                   /protein_id="ABB06118.1"
FT                   /translation="MSLTNETLAGLVRPDSVHKRLYTDPEIFALEMERIYGQAWIYVGH
FT                   ESQVRAPGDYHTARIGDQDVVMVRGTDGAVHVVYNRCPHKGAKIVPDGDGSVGKFFRCP
FT                   YHAWTFRHDGTHLSAPLRNGLQNTCFDPKHPDFSMRRVARVDRYRGFVFASQSAEGPDL
FT                   RTFLNGVVSSIDNLCDRSPVGEVEVTGGVFRVLQRSNWKLFYENLHDTMHAPVTHESSV
FT                   VAAREKAAEMGTMPFELLVMDGNGEPYAFWEKLELRAYAYGHGYMEGIFDPAAAERDPV
FT                   STAHFAVLADAYGDERARRILGMNRHNTVIYGSGSPHTVFQQFRVIRPIAVDKTLVEIQ
FT                   LFRLKGAPDAVFERALTYANVINSPSSNVMPDDVEVYARCQEGNQTHGGEWVSMHRYAG
FT                   TDRATEDGFVSINGTSELPMRNQFAAWKRFMVDETTLPASTVEGAA"
FT   gene            complement(635242..636201)
FT                   /locus_tag="Bcep18194_C7074"
FT   CDS_pept        complement(635242..636201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7074"
FT                   /product="Ferredoxin/Oxidoreductase FAD/NAD(P)-binding
FT                   protein"
FT                   /EC_number="1.14.12.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7074"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06119"
FT                   /db_xref="GOA:Q39N47"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N47"
FT                   /protein_id="ABB06119.1"
FT                   /translation="MSLLRIRVARIEALTPAIRRLHLVASNGAPLPGFDAGAHIGVHVP
FT                   LSPRPPRRAYSLVNADAGAACVDHYEIAVLREAAGSGGSQWMHACVPGDEFDVDPPRND
FT                   FPLATNAQRHLLIAGGIGITPILSMARELTRAGRAFTLHYAARDAASMAYRDEVAALPD
FT                   ATCWFDNGDPARGMPLADTIGAPEPGTHLYVCGPTGLIEATLAVARRLGWRDDALHSER
FT                   FAAAVPSGSDAPFEVRLATSGRVLNVPAGASILDTLIEAGLDPLYDCRRGDCGVCTVRL
FT                   LDGEPDHRDICLTDEEHAGGSFCPCVSRAKSAGLVLDL"
FT   gene            complement(636305..637288)
FT                   /locus_tag="Bcep18194_C7075"
FT   CDS_pept        complement(636305..637288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7075"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7075"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06120"
FT                   /db_xref="GOA:Q39N46"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N46"
FT                   /protein_id="ABB06120.1"
FT                   /translation="MLTASLPIEPTLLRRYRYFESDDLDDTRERIAAVLQPHRLTPGSS
FT                   RGGYSAYMDHVRIDSVGFGTIGYAGTMSVDAGEIEDYYLAILSLGGYADLNVGGRRTIA
FT                   GPTQGVIVGPATRFGGTFSRDCEQFFVRIDRRAILAHTGHDHLQIEPTLDLTRQELQPW
FT                   LAQLRVMASSPETVALAQRDRRIALEFERLVISLLLAGQPHHCQTRPGGTALVPRTVKR
FT                   AEAYIVEHACEPITLADIALAAGVPVRTLLDGFQRFSHGSPMQLVRERRLERARDQLLH
FT                   AREAERVADVALGCGFANLGRFAILYRETFGESPSDTLRRARRSAG"
FT   gene            637434..637742
FT                   /pseudo
FT                   /locus_tag="Bcep18194_C7076"
FT   gene            638184..639626
FT                   /locus_tag="Bcep18194_C7077"
FT   CDS_pept        638184..639626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7077"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7077"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06121"
FT                   /db_xref="GOA:Q39N45"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N45"
FT                   /protein_id="ABB06121.1"
FT                   /translation="MYSILPAFVSALFLGFGLYVLATKGLTRVSVPFALMCATTFVWQG
FT                   TWAFLFQTTDADVANVLVKAGYLFILFLPTTFYHFVTEVVSRRDERPVIFASYGLCVLL
FT                   AVLLVTSNTVVDGFRLHFFGPYPKAGPLHPLHVVQTVCLVGRSGWLLIEARRQGRARDV
FT                   RQLLTQCLVSLGLYSLAATDYAVNYGAEFYPVGVLFIAISLGILAMSIVRYGLMGPYLL
FT                   AATVAHEVATPLAAIGLHADELRNVLPVLLRGYRLAVEQRLCADDLYPGQLERLSTLAS
FT                   SIRRQVDTTSTVVEMSLASFTLDRLDRHSFAAYPIRACVDAAVDRFPFRPGERDRVSVD
FT                   TIDPDIRFFGSDSLVIFVIFNLLKNALYAIHASGRGQIEIDAHRSNGYCVVRFSDTGPG
FT                   IPPDVLPQIFDAFFSTKSHGRGAGMGLSFCRRVCEALGGTITCESSPGVRTTFTIRLPE
FT                   PGAPADDTLRDPPALPRRYRIG"
FT   gene            complement(639640..640113)
FT                   /locus_tag="Bcep18194_C7078"
FT   CDS_pept        complement(639640..640113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7078"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06122"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N44"
FT                   /protein_id="ABB06122.1"
FT                   /translation="MLTRDAILHVLSNETAHQSEKTFHHVVDIYLKDSNAFMNTYFARY
FT                   FEWQGVCRERWFHECIHNNLLAAGGAFVTKRAHQEYVQETFPFQRVDCFLNTFEVRQCS
FT                   AYLLFRFYVDGRQVSLGYQQIVFAGSDKRIRRFPPGIIERVKAYELILPSAAN"
FT   gene            640345..641283
FT                   /locus_tag="Bcep18194_C7079"
FT   CDS_pept        640345..641283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7079"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7079"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06123"
FT                   /db_xref="GOA:Q39N43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N43"
FT                   /protein_id="ABB06123.1"
FT                   /translation="MQPFVRQPVLFPVSVVFVDDNPDFLQALRGAFPDERLNRFFTHPQ
FT                   AALDFVSSRDTEVPPLAADYFGAEKTGGNAIGEDALADPARFEAVGAVVVDYSMPEVDG
FT                   IQFLTSIRNANCTKILLTGVADEREAVAAFNAGLIDCYLKKTDVEMARKLATALDTAKR
FT                   KCCAARGHISLHEAGATYRDPRVVKLIDEVAAREGIVEYYWRPNQDAVLMFDAAGAPSV
FT                   LLAWNEEDWSFHCDIVSDAGGPAELRQGMEARRIMPLFWPSQAYRPGLADIRCAAPLPV
FT                   PEWPGTSYSWIRLDDPATERELPTWAKWRHA"
FT   gene            complement(641643..642563)
FT                   /locus_tag="Bcep18194_C7080"
FT   CDS_pept        complement(641643..642563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7080"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7080"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06124"
FT                   /db_xref="GOA:Q39N42"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N42"
FT                   /protein_id="ABB06124.1"
FT                   /translation="MDPLSEVLALLETRDSYFTGLRAGGEWAVAIPPPEGIKFNAVVEG
FT                   SCWLTVDGAGPPIQLRTGDCFLLASPRAFALASDPSVPQVPAADVYRNVERGIAHYGEP
FT                   VNCFLIGGRFSYEEGMPLLLGSLPPVVIVSGDSEQAAVLRWALQRLAHEFGKPSPGASL
FT                   MVRHLGHMMLVEILRRYVDDGANSDVGWLAGFADARVSTALVAIHAEPARRWTVDELAT
FT                   CCHVSRSTFALHFKRRLGFGPLEYVLRWRVQLAMRELRRSNASISAIAQRLGYDSDSAF
FT                   GHAFKRIVGCSPRAYRHDFASESGD"
FT   gene            642703..643668
FT                   /locus_tag="Bcep18194_C7081"
FT   CDS_pept        642703..643668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7081"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.3.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7081"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06125"
FT                   /db_xref="GOA:Q39N41"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N41"
FT                   /protein_id="ABB06125.1"
FT                   /translation="MTSRQHPLHSGFGAASTANDVLVDLDLDGKTAIVTGGHSGLGLET
FT                   TRALAQAGATVIVGARNADAAREATRGIAGVEIAALDLADLASVAAFAARFVEARRDVD
FT                   IVINSAGVMACPETRVGDGLEAQMAVNHLGHYALVNGLWPVLAQGDGARVVAVSSLGHR
FT                   LSPIRWDDAQFAHGYDKWLAYGQSKTANALFAVQLDALGAPYGVRAYSLHPGKIATPLQ
FT                   RHLTREEMMAQGWVDEHGLPIDPTFKTPAQGAATQVWAATSPRLAGIGGVYCEDCDIAV
FT                   VTQGNEESGVRPHAIDPEEAARLWAWSAALTGIDAFAVRR"
FT   gene            644061..645278
FT                   /locus_tag="Bcep18194_C7082"
FT   CDS_pept        644061..645278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7082"
FT                   /product="Acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7082"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06126"
FT                   /db_xref="GOA:Q39N40"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N40"
FT                   /protein_id="ABB06126.1"
FT                   /translation="MTARDAVDPRDALRDALAALPDLANAIGQDAAQREARRELPFEGF
FT                   SIFRRSTLGVLRIPAERGGLGGTLVDLFDTIATLAAADSNLAHALRIHYDQIETLRLSP
FT                   RTPFNDVQLERALAGAIFGGASTERGTSRPGENTTVLRRDGDHYRLTGRKYYSTGTAFA
FT                   DFARINVENEQGDAVAVIIPVARDGVQVLDDWDGMGQRMTASGSLLLNDVQAFADEVAA
FT                   RDGSTLVGRHCGALRQLHLVATGAGIVRNVVADARRYVLAHGRPVLHSPAPTARDDHFI
FT                   QQVVGELSAHSHAIDGLVRENARALDRSADAIEAGDADAHALVLDSALATARTQLIVSK
FT                   LALHAAERLFEVGGASATAREHNFDRHWRNLRTIFSHNPLLHKARVIGDYELNGVTTHL
FT                   TEGRVF"
FT   gene            complement(645344..646531)
FT                   /locus_tag="Bcep18194_C7083"
FT   CDS_pept        complement(645344..646531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7083"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /EC_number="1.14.14.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7083"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06127"
FT                   /db_xref="GOA:Q39N39"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N39"
FT                   /protein_id="ABB06127.1"
FT                   /translation="MSDTALATPVAPSPFVDVRSPADFPNSPVSRVLAQPLMLGLFLPI
FT                   QAGGWSASTLPRTTDWTFDYNADLVARAEALGFDLVFALSQWLPKGGYGGVFDGHALDS
FT                   FMTLAALTARTERIILVATSHVLYGPWHPLHFAKFTATLDHISRGRWGINVVTGHRAVE
FT                   HEMFGWNRIEHDRRYEMAAEFLDAVQQLWAQPDNFSYTPELSSWRLGGAFVTPKPRYGR
FT                   PLLINATGSDAGIDFAARYSDIVFVTSPAGTDAEQAIDALPAHTARVKAAAAARGRAIR
FT                   TLLNPLVICRETATEARAYRDAIVAHADEGSFHRFDSDAHAWRGGIEQRSQADSRAIGG
FT                   NISITGSPEEVADTIVRLHRAGIDGIQLSFYDFKPDLDFFGERVLPLLRDAGLRR"
FT   gene            complement(646939..648123)
FT                   /locus_tag="Bcep18194_C7084"
FT   CDS_pept        complement(646939..648123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7084"
FT                   /product="outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7084"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06128"
FT                   /db_xref="GOA:Q39N38"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N38"
FT                   /protein_id="ABB06128.1"
FT                   /translation="MIKKTVVLGLVSIGSVSAHAQSSVTLYGVVDAGFAYTNNQGGASN
FT                   IQQTSGKLSGSRWGLKGVEDLGGGLQAVFTLESGFRPSDGGLGQGGRLFGRSAYVGLAS
FT                   KGLGTLTFGRQYEPITDLVAPYSGSGFWSPATHVGDNDNMNQSFRLNNAVKFRSDTIAG
FT                   FTADLLYAFSNQANGGAGTGFSNNNAWGASANYVNGPLSVGAGYVRINHPNSTSNTSGA
FT                   VGGATSTTGNDYSGAFFYGLNGGVLKQQIGVAGANYTLGRATLGFAWSHTQLDYLDGSS
FT                   RKFNNYDVNARYQITPAATLIGVYTFTDGRASGLPGTGGQTLKPRWHQFTLGFDYALSK
FT                   RTDLYLSGIYQLAAGDPSTATAGGYRSIAAISNIGSASSTNRQVAFVSGLRVKF"
FT   gene            648608..648952
FT                   /locus_tag="Bcep18194_C7085"
FT   CDS_pept        648608..648952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7085"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06129"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N37"
FT                   /protein_id="ABB06129.1"
FT                   /translation="MSRDVLFLLEPGFADPKHPGQRFVCPHGLSIEGLLASAPDRAGRI
FT                   DVKRVGFERPRHAVIDALDDAHQGLPVLVLGRDQPAPDDAQTLGDVRFVTDARRILELL
FT                   VERHGFPVLH"
FT   gene            648999..649997
FT                   /locus_tag="Bcep18194_C7086"
FT   CDS_pept        648999..649997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7086"
FT                   /product="ABC nitrate/sulfonate/bicarbonate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7086"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06130"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N36"
FT                   /protein_id="ABB06130.1"
FT                   /translation="MSSISAARRRLLLAGAAVVAAPWAAKAAFAVPDVNADLAGTTLRV
FT                   ATYKGGWRALLQAAGLADTPYRIDWRELNNGVLHIEALNADALDIGSGSEIPAVFAARQ
FT                   KANVRLITRVREDLNNQVTLARKDTPIRSIADLKGKRVGYVRATTSHYFLYRQLTEAGL
FT                   SFDDIQPINLSPTDGLSAYDRGDIDAWAIYGYNGQLARNRYGARVLKTGKGYLSGNFPV
FT                   YANPRTLDDVRRRAATGDLLLRFRRAYAWANGHFRDYALVQNRETRVPVADLVAMFDQR
FT                   SEDYALLPVTPDVVAQHQQVADVFARIGVLDGPANVEPLWDTSFNALVATT"
FT   gene            complement(650132..650452)
FT                   /locus_tag="Bcep18194_C7087"
FT   CDS_pept        complement(650132..650452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7087"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06131"
FT                   /db_xref="GOA:Q39N35"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N35"
FT                   /protein_id="ABB06131.1"
FT                   /translation="MFQSPGDSFVNGSLLGLCVEVPLAALVSLAMHGVDWNGQRIAMLI
FT                   ATPVLIACIALLTRPVAFSTVWKHKRSPFVLDDNVRASIYGRLCGIAIGVVFGIMVATT
FT                   FA"
FT   gene            650761..651153
FT                   /locus_tag="Bcep18194_C7088"
FT   CDS_pept        650761..651153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7088"
FT                   /product="O-linked N-acetylglucosamine transferase SPINDLY
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7088"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06132"
FT                   /db_xref="GOA:Q39N34"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N34"
FT                   /protein_id="ABB06132.1"
FT                   /translation="MTLVGFRIYRACSGAGHGWNEPMATAKHHRFNAGATASCTLWCGL
FT                   PVLTVPGDRLASRYDASLLAAVGLPELIAPDIDAYGAIAVDLARSPGRLGAIRQRLREA
FT                   RGQSLLLLQRYASGLPPDTIDLAVAD"
FT   gene            651208..652863
FT                   /locus_tag="Bcep18194_C7089"
FT   CDS_pept        651208..652863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7089"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06133"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N33"
FT                   /protein_id="ABB06133.1"
FT                   /translation="MRNKDDGQMGAVSLHNLLSGIGMSFDEDFNGVAAQVREAEAAGQF
FT                   DRAADLFHVLFERYPRSDVALKSCLDALLRQGQAGKALEACERAIAATPESTVPWRERA
FT                   LLCFNHLNDPAAAIASLKDGLAAFPSNAELHLMLADASFQMLDFETSRRHGMKAAEFGD
FT                   LTIALRARHRFIEDHEGAVHIARAILERYPTEIGALVQGGISLYLLGRFEEGIGYLYRA
FT                   AEHDPYRGEVIFPLANLLLLLGDTKAGWRRYEMLADLASLRSGPRELTTYHDRLWRGQP
FT                   LDGKRILVISHLGLGDCLMYARYARDLKAAGAHVTLCVKPELMQLLRELEGVDELLSAW
FT                   PLETWGNYDYWIFENLLPARLGASDGIVPTYRDGYIKLKDPDAAKALNERSRPSERLRI
FT                   GLCWDTSPNYFAGRSRSLLPEDLQPLAEIENVDWFVLQKHPLEPDFAARSGLSILNRSD
FT                   EWSDLYDTAVFAASLDLTISICSAPVHLAGSLGLPAWVMLGAPEWRWGAQGDTGPWYPH
FT                   IRVFRQATPGNWRSVTEAVRAALESERGGLRRVA"
FT   gene            complement(652974..654299)
FT                   /locus_tag="Bcep18194_C7090"
FT   CDS_pept        complement(652974..654299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7090"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06134"
FT                   /db_xref="GOA:Q39N32"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N32"
FT                   /protein_id="ABB06134.1"
FT                   /translation="MLAISKPAMRIHPHQRITGDTLTRDQSELDAAYKAYLRDKSASTG
FT                   LALSRALRLSGHAEEAIRVAKEIADQVEDPFLRAQVGIDMNYLGLFAQAEPLLMQSLAE
FT                   LHHEPDRRVLKVELVIAQYAQGRFREAHALNRRSRDAWGRAGVVSNIYPSDTSEYGRIV
FT                   NKLLRFDESAAGRRVLILQEGGLGDVIMFSRYLHLLRDEGASAIVLQAPGILAPIFASY
FT                   DWVTLVENASDAIDQSDCILCTFDLFARYQTTPYFPSWTNSYVQAPAGREMTPRVANIF
FT                   NNRRDGVREIGLIWRSGTSVRHEPYRSIALEQLAPLFGAPECRFHALQFGKITDEEHAL
FT                   LDQHGIGVIGDELNDLGDTAVILNALDLLITVDTGPAHLAGALGRPVWLLLSAACDERW
FT                   SNTHRDTPWYRSMHLYRQPALGDWSSPILEMADALSGKDVAW"
FT   gene            655629..657272
FT                   /locus_tag="Bcep18194_C7091"
FT   CDS_pept        655629..657272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7091"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06135"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N31"
FT                   /protein_id="ABB06135.1"
FT                   /translation="MKKLVLAWVLVLGVVFAPVPSSMFAQTTTAKVLVLYDAPPNDAYS
FT                   KLGLAYAIMLRNLLGHFNTNVTLAPVDSYTAGTVEKYQATFYLGDYYNNTIPSAFLADV
FT                   VKTSKTVVWFKNNLWEVAWDPSYNFTARYGFTFTGISGLANTPTSSNPNPNFFDTVLYK
FT                   NMSMVKYYAFNASTGVVSADPDIGVTAVSDATKANVLVTIKNSQTGAQAPYVMRAGNFW
FT                   YFADMPFSYIGPRDRYLVICDLLHDILGTNQPVLHRAMVRLEDVNAFTTTSSMKTLTDY
FT                   MYSKRIPFSIATIPRYEDPLGAYNNGVPLTVHLAQATGLKQSLNYALARGGKVLMHGYT
FT                   HQYNSTPNIVNAVSGNDYEFWLATQNRPVDEDSTQWASARLSAGLQEFSSNGYVPFAWE
FT                   APHYQSSPLSIKAVPPLFKTTYQRAVYYTSDRPNLNSTAPNHDFSVGQFFPYIINSDYY
FT                   GQRVLPENLGNIEYNICSIDPSSCLAYTWQDLYTNAQYALTVRDGFASFFFHPFWLEPD
FT                   LGTPGLQDLQSLVSGITGLGFQWVAAYDAK"
FT   gene            complement(657860..658729)
FT                   /locus_tag="Bcep18194_C7092"
FT   CDS_pept        complement(657860..658729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7092"
FT                   /product="Peptidase U61, LD-carboxypeptidase A"
FT                   /EC_number="3.4.17.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7092"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06136"
FT                   /db_xref="GOA:Q39N30"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N30"
FT                   /protein_id="ABB06136.1"
FT                   /translation="MESSRKTVGVVAPAGVPDPQGIERGIALVESWGFKVTTGAHLGSR
FT                   YRYFAGTAEERTDDLRRALMDPSIDIVWLARGGFGCAHLLEHLPDEIATPKTIIGFSDA
FT                   TSLFCALADRPGVRLLHGPTFHSLATKVDDATRADMRAVLTGGERAPLSLRHLSGASGA
FT                   VRGRLCGGNVTVLASVAGTRWSLRSRDAIVLLEDVTEFGYRLDRSLTQLRLSGAFDGAR
FT                   AFVLGQFTRCPIPDGADFTLEQMLVDVLGGFGLPIYSGLPIGHEHRNITWQYGNQAAIE
FT                   NSAIRFVE"
FT   gene            658809..659063
FT                   /locus_tag="Bcep18194_C7093"
FT   CDS_pept        658809..659063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7093"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06137"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N29"
FT                   /protein_id="ABB06137.1"
FT                   /translation="MNAERCHSPSSANPICFHRRDGKALAEGNAASEAGRQHQAAVSFP
FT                   YSEYARSRQRSGRHVIASNLEPGVERLRRPACLSAQERA"
FT   gene            complement(659041..661074)
FT                   /locus_tag="Bcep18194_C7094"
FT   CDS_pept        complement(659041..661074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7094"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7094"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06138"
FT                   /db_xref="GOA:Q39N28"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N28"
FT                   /protein_id="ABB06138.1"
FT                   /translation="MLATIVGSSAEEHVLAISDRNDSTSPEVTATAKAGRRASKGKAQA
FT                   QALTPTDIASLARQNEERQRQMRALIALGRERGYLTHADINDHLPDNFAQTAAMDTIVS
FT                   TFSDMGVAVYEQAPDAEALLLTEAAPAVASDDQADEEAEAALSTVDSEFGRTTDPVRMY
FT                   MREMGASELLTRAGEIEVAKRIEDGLQDMIQAIAACPSIVSTILADVDRIVAGELRIDE
FT                   LVDGISVDTDESEMTPESQEEEAEVLAADDDSDEDDVETDAGDSEKVNAARLEELTNDS
FT                   LVIFARVRALFEQLPDVPVTGEARSAAAAQVRAAIQRELAPIRFTAKTIDRLCEIVHGQ
FT                   VTEVRAIERSVLAIAVDRCGMPRDAFVESFPGHETDLDWTSRTAATSQQFGAALERHQP
FT                   AIQAAQQKLVDIESRVSLPLQQLKQINRQMSAAELKMRQAKREMIEANLRLVISIAKKY
FT                   VNRGMQFLDLIQEGNIGLMKAVDKFEYRRGWKFSTYATWWVRQAVTRALADQARTIRVP
FT                   VHMIETINKLNRISREILQQTGQEAHPAVLAKRMEMSEEKVRSILKIAKQPVSLETPVG
FT                   DDADATLGDMIEDVSASSPAEAAIHANMRAAIDEALNGLSPREAKVLRMRFGLDTNSDH
FT                   TLEEVGKQFDVTRERIRQIESKAMRKLMHPSRADKLRPFLER"
FT   gene            662413..662802
FT                   /locus_tag="Bcep18194_C7095"
FT   CDS_pept        662413..662802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7095"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06139"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N27"
FT                   /protein_id="ABB06139.1"
FT                   /translation="MANVPLTGTYTSSDKNFTFKITSADPSNGVIAGVYTTNYSPIGAF
FT                   TSEGNVGHYGWVFSKAQGKDGVAPFNISFGGSQRPDQRPYNIVDSWNGAYLTNNTIVAE
FT                   GTRSFVNSDGVVEVGSLGTLKFTLG"
FT   gene            complement(662897..663970)
FT                   /locus_tag="Bcep18194_C7096"
FT   CDS_pept        complement(662897..663970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7096"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06140"
FT                   /db_xref="GOA:Q39N26"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N26"
FT                   /protein_id="ABB06140.1"
FT                   /translation="MRLIIPLRFSLWKRAAVLFAADALLMTVALWITGRIDNAGTIDLQ
FT                   TGNFALFVARLLAMLLYASLVWAWIMRPARHNLEYFPSVDNRDRVLGAWFVLLLCGTLF
FT                   ALALLCFDTSTVNRMKERSSQTRSVLAREFDWQAETGGGKGIPRHRYTATGLLFPDAAN
FT                   RGIERVRRPGGRFGGGTTCFVEHVGWLGYGWISDVQPCDRPVEHIRIVRLNDVEVDRGE
FT                   KRGSQCVDDPGAPASEPRHDPSQCPPVVDEDGQWRVTAGASVVLPLPSDYWIAPRVVSV
FT                   SPDGNRILVGDVELPSQLFLWTRRSGTWVALQLPEAGRPPPSDTYVLTDDAQTILDCPR
FT                   GSAGECERWVIVQRDIQ"
FT   gene            664181..664495
FT                   /locus_tag="Bcep18194_C7097"
FT   CDS_pept        664181..664495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7097"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06141"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N25"
FT                   /protein_id="ABB06141.1"
FT                   /translation="MSWFVYEVPEYHEDAPRIEPYSDLRSRVLKISGVAMADELESVRE
FT                   NAAATADSPERPLRTPENPHVFPIPYADSMILVGFIFDLKREFRQLVVSPVEMPWLKDA
FT                   "
FT   gene            664962..666332
FT                   /locus_tag="Bcep18194_C7098"
FT   CDS_pept        664962..666332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7098"
FT                   /product="Major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7098"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06142"
FT                   /db_xref="GOA:Q39N24"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N24"
FT                   /protein_id="ABB06142.1"
FT                   /translation="MAAMQSAATPLSDEEARRQLRRAVIASTIGTTIEWYDFFLYSTVT
FT                   GLVFAKLYFPQSHPLVGTLQAFLIYAVGFVARPVGAAIFGHYGDRIGRKATLIVTLLLM
FT                   GLATFAVAFVPTYATIGIWGAVILTVLRFIQGVGVGGEWGGSVLMSMEWARTNAHRGFV
FT                   ASWPQFGVPAGLFLANLAVLAMSWFSGSAFLTWGWRVPFFLSIVLVAIGLYIRLNILET
FT                   PIFAKLLAERRIEKTPMLEVLRKQPRDIVLSAFARMAEQAPFYIYTAFVFTYGITALGV
FT                   TRELLLAAVLVASVVEFFTIPLFGHVSDLIGRRRMYMIGAAAVGVFGFVYFAMVDSRNP
FT                   VWIFAAIVLSLVPHSMMYGPQAALIAESFTGRLRYSGASMGYQLASVIAGGPAPLIATA
FT                   LFAYYHSGYAIAVYVLACAVLSVVAASKLGDYTNKDISREYDDARGLADHGHAPPVT"
FT   gene            666409..666684
FT                   /locus_tag="Bcep18194_C7099"
FT   CDS_pept        666409..666684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7099"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06143"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N23"
FT                   /protein_id="ABB06143.1"
FT                   /translation="MRAHRSSFGRRHVIKPVANANATAIAFDTVTRISGAVVNAGATAL
FT                   GDAISSAGDTLGRATRRHRTPQNTEPSRPGRSDDGARYAVHVPQRS"
FT   gene            complement(666793..666981)
FT                   /locus_tag="Bcep18194_C7100"
FT   CDS_pept        complement(666793..666981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7100"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06144"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N22"
FT                   /protein_id="ABB06144.1"
FT                   /translation="MAAKRLRINMITRRQSTFDGRHLDTEAARRLGAHAQDAIPAHLKG
FT                   TQGAESEWLPRVKVSER"
FT   gene            complement(667355..668035)
FT                   /locus_tag="Bcep18194_C7101"
FT   CDS_pept        complement(667355..668035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7101"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7101"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06145"
FT                   /db_xref="GOA:Q39N21"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39N21"
FT                   /protein_id="ABB06145.1"
FT                   /translation="MMIEIPGVFSPAEAAQLVERLRAAQWIDGRATAGAQSRRVKENRQ
FT                   LDGDDPLAREIGDEIIRRLAQNAVFMSAALPKRIYPPLFNRYAGGESFGYHVDNAVRGI
FT                   RASRERVRTDLSATLFLNDPASYDGGELVVRDTYGEHHAKLAAGSMILYPGSSVHKVEP
FT                   VTRGERLASFFWVESLVREDAQRSLLLDMDVAIQRLTQRDADGESLLQLTGAYHNLLRM
FT                   WADA"
FT   gene            complement(668079..670451)
FT                   /locus_tag="Bcep18194_C7102"
FT   CDS_pept        complement(668079..670451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7102"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7102"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06146"
FT                   /db_xref="GOA:Q39N20"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N20"
FT                   /protein_id="ABB06146.1"
FT                   /translation="MSSSHQRAGRSPSAVLSNLLGATLGLAMLSAAHAQPGVSAAAPDA
FT                   SSSPGATLPAIDVNAHSSPYRTEFLQSDQFTAPLLDIAQSVAVIPKKVLDEQQAQSLQD
FT                   ILKNVPGITFTSGEGNLGWGDMFTIRGFSGEQSMTVDGIRDAGLAGRTDTFNVERVEVF
FT                   KGTGTIESGVAAPGGSVNLVSKEAHAGDAYHLSTTLGTASYRRVTADLNKQLTPTSAFR
FT                   LNLMRHYNAVDGRAVTDYDRWGVAGSLALGLGTPTRVTIDYLHQNDVNTPDTGVPIERG
FT                   TGGARMPGVPRNGWYGDPNLFTDREVTDRATVKVEHDFNDNLRMSSISRFEQTDRITVL
FT                   SPARFNSTGGTSYGYTGTGPLVTSSAGLASYSGFAPIANASPLAVLRGSNYGTSKRYDI
FT                   VANETNLNLSFDTGGLHHDVVTGAEVYHERYGDLARTILAPSVNPVMNLTNAYGTNMVG
FT                   VPTLEGGAGDYASLTDAGVYLRDTVTVTPKWIVEGAVRYDRFSLKQVNGAANAHTVARS
FT                   NDGALSGRIGITYKPVPFGSLYATYSRAAQPSAVGATTNNVIYGNTSSQDLQAAVAQTW
FT                   ELGSKWDLLDHRLSVTGALFRTELSDSWDYGDGTTTVVRALPPRRVDGLELGVSGNLTD
FT                   RWSAFAGFAAMRGRITKGANAGLRPANVPNATFNLWTTYAVTPKLSVSYGAQYVGTRRY
FT                   TDNRYVGGQSNNSSTVNGASGKHPVYVADGEKAPSFWLHSIAARYEVDKHLTFGLNVQN
FT                   LFNTFYYSAIGASLDGFQLYGVPGAGRTVMATADVRF"
FT   gene            complement(670488..671318)
FT                   /locus_tag="Bcep18194_C7103"
FT   CDS_pept        complement(670488..671318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7103"
FT                   /product="ABC cobalamin/Fe3+-siderophore transporter,
FT                   ATPase subunit"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7103"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06147"
FT                   /db_xref="GOA:Q39N19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N19"
FT                   /protein_id="ABB06147.1"
FT                   /translation="MSGLTIEGLTVRYGRRDVLASLSAGPLPRGRITALLGPNGSGKST
FT                   LLRTLAGLTRAASGSLALDGTPPFVPGLRDARSHGVVYLPQTLPAGVRLQVLESVVVAR
FT                   RATRQGFMPAGRGGSEEGDDTVALALLARLGIDALALRTLDELSGGQRQLVGLAQALAR
FT                   DPQVLLLDEPLSALDLNHQHQVMAALRDITRERQLVTVVVLHDISAALRGCDRAMLLHR
FT                   GRIARFGTPEDVVTPAGLADVFGVAARIERCSHGQLQVLIDGLAAHDPVAAPSR"
FT   gene            complement(671315..672397)
FT                   /locus_tag="Bcep18194_C7104"
FT   CDS_pept        complement(671315..672397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7104"
FT                   /product="ABC Fe3+-siderophore transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7104"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06148"
FT                   /db_xref="GOA:Q39N18"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N18"
FT                   /protein_id="ABB06148.1"
FT                   /translation="MSDAVLQELVPGRIRAASLLDYRRLTRRRAAALVVVALLIVVSVL
FT                   FDLSSGPSGMPVSTLLRTLVERTGADPAARVIVWQIRLPYAAMAVLVGAALGLSGAEMQ
FT                   TILANPLASPYTLGVSAAAAFGASLAIVLDVTIPGIAQTWVVSANAFVFAFLSALVLDA
FT                   VARWRGMNTTGVVLMGIALVFAFHALVSLMQFIASSDALQGLVFWTLGSLARADWPKLA
FT                   VLGTALAIALPLSMRHAWTLTALRLGEDRAASFGVDVKRVRLATLLRVSALSALAVSFV
FT                   GTIGFVGLIAPHLARTLFGEDHRFYLPGSLLLGALMLSLASIASKLIVPGVLIPVGIVT
FT                   ALVGIPLFLGIVVRSQGGQA"
FT   gene            complement(672394..673599)
FT                   /locus_tag="Bcep18194_C7105"
FT   CDS_pept        complement(672394..673599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7105"
FT                   /product="ABC Fe3+-hydroxamate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7105"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06149"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N17"
FT                   /protein_id="ABB06149.1"
FT                   /translation="MAIFRQAWGRRACIGAIAWMVGATVAHATAAAAEPVPAVSPAPVA
FT                   VTDLAGRTVRVPAQAPRRILLGESRLLSAVALLDGAQPLARIVGWQGDLPLMDPQTYDA
FT                   YAQAFPQIRRIPLIGQATEDSISAEKALSLKPDLAIFSLGGHGPSRYNALVKQLEATGT
FT                   TVVFVDFRLHPLQNTLPSIALLGAVMHRTGQANAYATFYRAHLARIESVVNRIPDAQRP
FT                   KVFVDLLAGVWDAGCCHTAGNGNFGEFVTAAGGRNIATGLLPGVLGDISMEQAIAARPD
FT                   VYIATGSRTKPGLASLRVGARTSAHDAAASLAQLAARPGFDAIKAIHDGRVHGISHNYY
FT                   DSPYNILAIEAFAKWFYPQQFKDLDVHATQAELHRRFLAIAPQGAEWVDAPLPAATSQA
FT                   AR"
FT   gene            673757..674470
FT                   /locus_tag="Bcep18194_C7106"
FT   CDS_pept        673757..674470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7106"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7106"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06150"
FT                   /db_xref="GOA:Q39N16"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N16"
FT                   /protein_id="ABB06150.1"
FT                   /translation="MDHILVIDDDPNIRTLLGDYLRAMNYRVTLAENGLQLRQALGTST
FT                   VDLVVLDLMLDGEDGLDLTRDLRQRHDVPIVILSARGGLLDRILGLEMGADDYLPKPFD
FT                   PRELVAKIKVVLRRTRAIPGTRRTEASSRVSFAGWHLDTRMKQMMSPDGVVVSLGGSDY
FT                   RTLRALLDHPNRPLSREFLLDRVFGKELAPLDRSIDVCVSRLRHHLKDAARNAALIRTV
FT                   RNEGYMLVADVVHDA"
FT   gene            674476..675885
FT                   /locus_tag="Bcep18194_C7107"
FT   CDS_pept        674476..675885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7107"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7107"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06151"
FT                   /db_xref="GOA:Q39N15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N15"
FT                   /protein_id="ABB06151.1"
FT                   /translation="MRRMTLRVWPDSLFGRLVAILAAGMFAGQMLTGTIWFDTHDNRML
FT                   EIPARLFASRLADTLRLVDAAPDPAARDAVIAALGDARYRLKRIDAPSPAGTLNFAQHA
FT                   TAGLIAGVLSRRLGADVPFRLVESALHDDAGHHAGPLSLFDSQMPTGEFHVQVGLPSGG
FT                   WLDVRADEGQAGMHGMPASLVFDYLLRLYLIRFVAVCAVAFVAVRFALKPLTQLARAAE
FT                   ALGRDMHRPPLAVDGPSEVRRAAESFNAMQQQLIDSFAGRARFLGAVSHDLRTPLTRLR
FT                   LRTEMLPDPEWRDRLRGDLDEMESMVRGALDAVRGVEVTEPRCDIDLDSMLEGLAEDAR
FT                   DIGQAVTIGGHAAAPVSGFARNLKRCLQNLLDNAAHYSGGAPVTIDVRDGKEAVRIVVS
FT                   DTGPGLPDDWLERVFEPYRRGKHADLDDGGTGLGLTIARSIATLHGGTLILRNRSSGGL
FT                   DAVLALPRERA"
FT   gene            676263..677021
FT                   /locus_tag="Bcep18194_C7108"
FT   CDS_pept        676263..677021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7108"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06152"
FT                   /db_xref="GOA:Q39N14"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N14"
FT                   /protein_id="ABB06152.1"
FT                   /translation="MPPLIEAIVDWTTVSLGGLGLLAMILGVLAPDRWMFDAGYGCVPD
FT                   GRDLVLSPRRVRINRFVWWLLGFGFGTLGLACLIAVPALAGLLTGDELHAWYEWLGLGI
FT                   TVVLLVGAGVLMTWIGCKLMRARWFGGPLREARFYWRDGERWIDVTTTRLLRRPVRHTY
FT                   ACRDLERVLIGARRSLDGAVVGGSWTSLQQNLVQLMLVFRAHPPIDLMGRFNDGAGARR
FT                   MIDMIGTWCGVEVQRVEGLPDVTPFNFDRI"
FT   gene            677217..679328
FT                   /locus_tag="Bcep18194_C7109"
FT   CDS_pept        677217..679328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7109"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7109"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06153"
FT                   /db_xref="GOA:Q39N13"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N13"
FT                   /protein_id="ABB06153.1"
FT                   /translation="MPVDTGFDRNAFREYPLDGALLRFHPATGTHVRIENAATHHLRRL
FT                   APRVAMFGITNKCNLSCDFCSRDTRRDSAWSVQSAAEVLRGLSEAGTLEVAFGGGEPFA
FT                   FRGFAELIDILHDTTPLALNVTTNGTLIRRNTYAPYAGRFGQVRVSLYDEVRWRDAGTV
FT                   LSEYGQRWGANLIVDDAVLPGLPARLAELATLGCQDVSLLSYIGPDLRRHLSPRGRAQL
FT                   AAIVQDSPIACRLSVCFGDAIPVPRLFDGADGSGDCGAGLDFVSITPDQRMQGCSFHDG
FT                   GLPATRAEEILHGWRNERARLEQPSARRGCARRNAGASRSRSTPSVSVWQAFSGNNSGE
FT                   CVMVAKFETLADADAYLAQLLPSWTPDAEYSSEWKRLFKEEAVACPGLSGGGSPRELAA
FT                   IGRSVIATGYEADDLFPELRALAWKKGAYVVPDGIHAHDVFLLAAVRASSADDARNLAG
FT                   LTPHPAARTWLHGDVILVTLELQGDSVPGELVETRQWLTAYAAGRPLAAELVFDDVDEA
FT                   AMLSVMKRLGAEISRTARLALHFGWRDDSGQKAVRFAQMIVEGQTNVAGKCVLVSGLER
FT                   RKRLAVLAYRQGAHVSALDGEEVRVSAYFAVPGAKPQKGRRAEPGEIDIGRVREALHQR
FT                   FPGGMRFDVKAGYRRDTAYVNIVTADPGYAFAQLDQLAAWLGATLSVGVHEVDPLAFAV
FT                   RRVIADVRS"
FT   gene            complement(679340..681682)
FT                   /locus_tag="Bcep18194_C7110"
FT   CDS_pept        complement(679340..681682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7110"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7110"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06154"
FT                   /db_xref="GOA:Q39N12"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N12"
FT                   /protein_id="ABB06154.1"
FT                   /translation="MQAHMKTHYARMTRLASNAAPARNPELLAAQYRVFAGQIPVSYLI
FT                   LISSTWSLAITHLRSTPWWLSVAIPAAMTLAALARLLHWHRTRLLEPTPDTVMRALTVT
FT                   NWLVVPVAVTFTTWALLLFPYGDAWQKAQVAFYLAITVIGCIFSLMYLRTAALSVAVIV
FT                   NVAFIVFFISTGQPTLVATAVNMAFVSAALIAVISVNYRGFLRTVDAQAESRMREQAQT
FT                   RLMRMIDDMPVAVMTADPETFRINYLNATSRNLLRTIEHLLPIRADDALGASIDFFHPH
FT                   PQHQRRLLADPANLPHRARIGLGPEVLDIQVSAVRDADGRYIGPMLSWSIVTQQAEAEA
FT                   RIHQLAHHDSLTGLPNRATFLAEFDASLRRSDKVLGLLFIDLDGFKLINDACGHSAGDE
FT                   VLRQVGERLRGQCPEPGMMLGRIGGDEFAVLLRDTDADRAMGAAARLVDTLVAPYAPSP
FT                   DRQFRIGASIGCVLAPDHGNDGGVLLSRADMALYAAKKAGKGTYRMFSPDMETSAQERV
FT                   ALESKLRVALDENQGLYVFYQPIVDVRTRQITTREALLRWHHPRAGWISPGRFIPVAER
FT                   GGLIDRLGRFVLEQACREAARWPDGARVAVNVSAGQLGHGTIVPTFAAALAGAGLTPDR
FT                   LEIEVTETALLHDEGKAIADLRALRSMGVRVALDDFGTGFSSLAHLRAFPFDKIKIDGS
FT                   FVRDAVTRPDCAAVVRAVADLGKRLGVTTVAEGVETEEQLACITDAGCREVQGFLIGRP
FT                   APGEQDAPAIRWIERAALAAQATARQA"
FT   gene            complement(681725..683866)
FT                   /locus_tag="Bcep18194_C7111"
FT   CDS_pept        complement(681725..683866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7111"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7111"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06155"
FT                   /db_xref="GOA:Q39N11"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N11"
FT                   /protein_id="ABB06155.1"
FT                   /translation="MASAHATDRGRKVLVTVFGCIVHRHNHWLVLLAALLCGGGSWVTA
FT                   RLFQRTVNTAGTQRLGWQVLTAISAGVAIWCTHFIAMLGFDAGAPVHFNLPLTLVSLLI
FT                   AVGGSTIGFALTTCRIVKVAPALGGAIVGVAIVLMHYTGMLAWRVEGIVSWDLSYLIAS
FT                   VLLAMTLAALALHLAMRPSPHAVNQMAGVLSLAILALHFTGMCALRITPLVLDGSWTDV
FT                   SELRPLALAVAGTSLVIVCTGLVSYVIDSNVRAESLEHLRRLALSDMLTGLPNRASFNE
FT                   RLDLEIALAQAHGRKLALIGIDLNRFKEINDLRGHHAGDEVLRILARRMTNLLREGEFV
FT                   ARIGGDEFAALCRMDDDTRLMNLLERLEPALYKPVRLDDYEVVPGASFGVAIYPDDATT
FT                   KAVLINNADLAMYRAKGSIAQSICFYEPAMDLIVRARRSLAADLRRAVADNQLSVHYQV
FT                   QTSLATGEIRGYEALLRWQHATLGTIPPAEFIPLAEENGVILDIGAWVLREACARAATW
FT                   EPPYAVAVNVSAVQFMHADLTALVADVLEETRLPASRLQLELTESTIFAGRERALDTLR
FT                   QIKALGVSIALDDFGTGYSSLDTLRSFPFDRIKLDQSFVADAEAKPQDRAIIRAVLALG
FT                   KSLGIPILAEGIETRDQLALLADEGCDEAQGFLLGRPAPLNEIVGSGQIALTGGNRVRP
FT                   PVPASESAVNADLDPDPRG"
FT   gene            complement(684329..685075)
FT                   /locus_tag="Bcep18194_C7112"
FT   CDS_pept        complement(684329..685075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7112"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7112"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06156"
FT                   /db_xref="GOA:Q39N10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N10"
FT                   /protein_id="ABB06156.1"
FT                   /translation="MTNGTAIVTGGAGTLGLAISRSLRDDGWSVIILDRQEALANFSPP
FT                   DGMRADALDVTDFDACRRYFAKLTELSVLVNNAGMARLSLVRDISLEDWNQVLDLNLTA
FT                   PLVLTQLATDLLVRSGHGAIVNIASIAGIRAGFGRVAYGASKAGIIQLTRQTALEYAAL
FT                   GVRCNAVAPGPVNSNMLREQLSKADFDEYLDDIPFNRMAEPEEVGDAVAYLASKRSRYI
FT                   TGQCLAVDGGFLAAGAGIKKAHKLVE"
FT   gene            685641..686363
FT                   /locus_tag="Bcep18194_C7113"
FT   CDS_pept        685641..686363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7113"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7113"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06157"
FT                   /db_xref="GOA:Q39N09"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N09"
FT                   /protein_id="ABB06157.1"
FT                   /translation="MLQKENKRGGSSAKPDAPEINAKAQIKEYKETLIVDAAAKLFYEK
FT                   GFQRTTIDDIAASLGFTKPFVYTYFTSKHSILERLFDRIYDQVLQSATNFDESSHAHPE
FT                   QRLRHFVYGYIRKNLEQPQFAAVLLEEEKNLSAEKLEYMRVKQHGFDDQLAQLIAACAE
FT                   AAGSYIAEPKLAALSISGMVRCLHRWYSPQGRMTIEQVCEELTNISMRIAGVPPEPLSK
FT                   RSGRTSGASVPRKRAKPA"
FT   gene            complement(686540..688117)
FT                   /locus_tag="Bcep18194_C7114"
FT   CDS_pept        complement(686540..688117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7114"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7114"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06158"
FT                   /db_xref="GOA:Q39N08"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N08"
FT                   /protein_id="ABB06158.1"
FT                   /translation="MVWATGSMDYVELDGRIDKVACGLMRLGVTAGDKVGLLAGNGPEY
FT                   VVAIFALWRIRAVAVPLNLRYREADLVDVVRRGECTLLIMTGRAGPIDFADLIRRSLAA
FT                   DLEQGNLRTVVIGDGCLPGSVAWPALEGGDYSSAEWRALSDRRAACTASDLALIVFTSG
FT                   TTGRPKGVMHDHSCVRGVRDRARMWGVKPGETAINYLPMFHLYSLSEVILQCVFGGCRQ
FT                   VIMERFDADAALDAIERESVNIIHGFETHYADLLNRQAERPRNVRSLRFGTLPSGMDTS
FT                   AAVAVQVQRVFCPTVTGTSLSESWSWMCTCAPDEPEDVRCYSSGRPLPGLEVRLVDPAT
FT                   DKDVPIGTPGEMWFRGYSIMKGYLGDPRATADTIDADGWLHSGDQGVMRADGFLRFTGR
FT                   YKEMLKVGGENVSPQGVEQALSELVGEILQVAVVGVPHERLVEVPVAYVVLRDGAAITE
FT                   EAILSACKGKIASFKIPRRAVIVDALPQTASGKIQRGLIRKRAIEELSLRDEPRFFGLS
FT                   GEGEGHAT"
FT   gene            complement(688243..689004)
FT                   /locus_tag="Bcep18194_C7115"
FT   CDS_pept        complement(688243..689004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7115"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7115"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06159"
FT                   /db_xref="GOA:Q39N07"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N07"
FT                   /protein_id="ABB06159.1"
FT                   /translation="MNYSLTIRDRVAVVTGAGSGCGRAIATTLAAAGAKVVVTDLNELG
FT                   AEETVTRIREQGGQAESIVADVSKAADVARLQAFTQDSFGLADLIVNNAGWTPTEPFLE
FT                   NSLAFIEKIIAVNYTSAVLVCQQFLRPLVAAGRDGRVVNISSGAGRIGNAGETVYAGAK
FT                   GGVNAFTKSLAREMAKHAITVNCIAPGAIDTPLLRLQSERMLQHFNRAIPLRRLGQPQD
FT                   IANGVMLFAADQSAYLTGQILSVDGGLTMVD"
FT   gene            complement(689183..689947)
FT                   /locus_tag="Bcep18194_C7116"
FT   CDS_pept        complement(689183..689947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7116"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7116"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06160"
FT                   /db_xref="GOA:Q39N06"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N06"
FT                   /protein_id="ABB06160.1"
FT                   /translation="MSDELLVEYRNGIQILTINRLEARNACTKAIAEAIAAELDTLERR
FT                   DDLRAAIITGAGGAFCSGMDLKGFLKGERPSIPGRGFAGITEAPPGKPLIAAVEGYALA
FT                   GGFEVVLASDLVVASETARFGLPETKRGLVAAAGGLLRIQHQLPERIALELVLTGDMLD
FT                   AKRAFEYGLVNRLTPPGDALAVAIELAGKIAANGPLAVAASKRVMRASRDWSTAEMFVR
FT                   QREITDPVFASRDAREGAAAFAEKRVPQWEGR"
FT   gene            complement(689991..690758)
FT                   /locus_tag="Bcep18194_C7117"
FT   CDS_pept        complement(689991..690758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7117"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7117"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06161"
FT                   /db_xref="GOA:Q39N05"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N05"
FT                   /protein_id="ABB06161.1"
FT                   /translation="MDFAGTVAVVTGGASGLGLASTKRLAGKGAHVVIADLSTSNGAAV
FT                   ADSLGAGVSFVAADVTSADDMTGVFEAARRRGTLRSLVHCAGRGGAVRLVEKDGSPGSL
FT                   EAFESVVRINLVGTFNVLRLAAAEMARNEPDAGGQRGACVLTASVAAFEGQIGQVPYAS
FT                   SKAGIVGMTLVAARDLASKGIRVCTIAPGLFDTPLLARLPEEVRTSLGRMVPFPPRLGE
FT                   ADEFASLAVHVLENTMLNGETIRLDGAIRMQPR"
FT   gene            complement(690788..692059)
FT                   /locus_tag="Bcep18194_C7118"
FT   CDS_pept        complement(690788..692059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7118"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7118"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06162"
FT                   /db_xref="GOA:Q39N04"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N04"
FT                   /protein_id="ABB06162.1"
FT                   /translation="MRAAAPTWRTAMPVNHSSFNYRIETTMIRSAVIVDAVRSPMGRTK
FT                   AGGAFVQLHPADLLSQVIQALVARNDLDPGTVDDVMIGCVSQVGEQSTTPGRVAWLAAG
FT                   FPAHVPATTIERKCGSSQQAIHFAAQAIMAGVNDIVIAGGVESMSRVPMGSARIDRDPY
FT                   GARFHARFPQGLVGQGVSADLVAQKWDLSREALDAYSAESHRRAEAARTAGQFAREIVP
FT                   IDVPGDGGLRRVDTDETIRVGTSVERLASLAPSFENAELAQRFPGIRWNVTAGNASQIS
FT                   DGAAALLVMSEQKAARLGLKPRARIVAFDVCGDDPLMMLTAPIPATERLLKRQGLSVHD
FT                   IDRFEVNEAFAAVPLAWQKALGADGARLNAAGGAIALGHPLGASGARLMTTMLNSLEAS
FT                   GGRYGLQTMCEAGGMANATLIERL"
FT   gene            complement(692081..693010)
FT                   /locus_tag="Bcep18194_C7119"
FT   CDS_pept        complement(692081..693010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7119"
FT                   /product="Acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7119"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06163"
FT                   /db_xref="GOA:Q39N03"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N03"
FT                   /protein_id="ABB06163.1"
FT                   /translation="MSAHGSEAMVDELGRTEPAMPTGDATLSQLLTLDPVAPGRWRSRR
FT                   ADPNANGRIFGGQLLGQAMAAALDGVPENRTPTMMQALFLHGALPGEPLEFETSVLQEG
FT                   KRFSSRRVSAWQPGGRAVLDAQVTCAIPLDAPRHGEPTPVPAGERPESLPSLCDLPDAM
FT                   FDTVRHLGGYDRDCKPSIEFRIPDPARQLSPHTSGPRFRYWMRAARPLPCDARIHAAAF
FT                   AYLSDWWLNFSALALHQRAIGTRRLYICSLNHGLWLHRPVQADAWLHVETISPAANAGC
FT                   GLSIAKIHDAAGDLVASASQQTLMTFTG"
FT   gene            complement(693014..694123)
FT                   /locus_tag="Bcep18194_C7120"
FT   CDS_pept        complement(693014..694123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7120"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="5.1.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7120"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06164"
FT                   /db_xref="GOA:Q39N02"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N02"
FT                   /protein_id="ABB06164.1"
FT                   /translation="MNANAHRNGPLAGLKVIEFAGLGPGPLAGMLLADLGADVVCIDRP
FT                   AEAAGRFAGVSSRGKRSVVLDLKREDGRAAARALAARADMLIEGYRPGVMERLGLGPEA
FT                   LLALNPRLIYGRITGWGQTGPLAQAAGHDLNYIALTGALAAIGPRAGKPVPPLNLVGDF
FT                   GGGTMFLLFGLLAALVERQASGRGQVVDAAMIDGALALLGPILELRAQGLWRDGRGSNL
FT                   LDGGAHFYGTYRCADGAYISIGSIEPAFYALLREKLGISDDPAFDAQMNAADWPALSER
FT                   MEAIFLTKTRDEWTSLLEGTDVCFAPVLDFDEAAAHPHNLARTSHITVAGVRQPAPAPR
FT                   FSRTPAQTPAGPPVIGGDTDTVFSDWGVA"
FT   gene            complement(694120..695748)
FT                   /locus_tag="Bcep18194_C7121"
FT   CDS_pept        complement(694120..695748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7121"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7121"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06165"
FT                   /db_xref="GOA:Q39N01"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N01"
FT                   /protein_id="ABB06165.1"
FT                   /translation="MTIDHHQSDAYKGSVGPRDACVLRYVLQRQAESRPDKVFIRERDG
FT                   SGITYAAFAADVERTAAGLAALGIRQDETVGVWLPNGIDMLRVWFAINWLGAVYVPVNT
FT                   AYKGELLRHVLDSSAARLLVTCRDLAPRLAGLTLATLRTVVEFGASDVELPGIARIDAA
FT                   VLEQGGEVPPLERSIEPWDTQSIIFTSGTTGPSKGVLSPYAQLWETSGERSFSMLDEHD
FT                   CAIVFGPLFHIAGTIPVVAMLNRGGTIAFAEFSTERFWADVCALGATFAILLGVMCEFI
FT                   AKIPPSADDRDHPLRKVMMIPRPDNAAAFASRFGVDFWTMYNMTELNVPLMSERNPAIA
FT                   GTCGRARHGTELRIVDAFDRELPDGTVGELIVRCDSPWRLNAGYFRHPEATVQAWRNGW
FT                   FHTGDAMWRDAAGNYFFADRMKDAIRRRGENISSFEVEKEILAHPDVRECAVVAVPALS
FT                   EDDVLAVVCPIPGGRIDPGELLAFLVPRLAHFMLPRYIRIMDALPHTPTQKIEKYRLRQ
FT                   EGITAETWDRERHDVRVRRDRIRVS"
FT   gene            complement(695785..697257)
FT                   /locus_tag="Bcep18194_C7122"
FT   CDS_pept        complement(695785..697257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7122"
FT                   /product="Flavin-containing monooxygenase FMO"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7122"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06166"
FT                   /db_xref="GOA:Q39N00"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39N00"
FT                   /protein_id="ABB06166.1"
FT                   /translation="MSNGKRLKIAVIGAGASGIMAVVKLREIGQTDVQVFERAADIGGT
FT                   WRDNRYPGVACDVPSHLYRYSFAPNPDWTRVCASGEEILQYLRRVYDEFEVGRHVTFDA
FT                   EVKDATYDNGAWTLTTQAGRYGPFDVVITAMGILRHPSYPDIEGLDSFAGRMFHTGRWP
FT                   EDVDLDGKRVGIIGTGSTATQIVPAIVDRVASLSLFQRTPQWIMQLPNTEIPPEERDAF
FT                   RRDPGLLKARYEALGHEFNSKFAAAVVGQNPRVYAHMERLCREYLETSVTDPVLREKLR
FT                   PDYKVGCKRLVMSDRFYPAIQRPNAALVTERIERIEAAGVRTGDGHLHEFDVLVLATGY
FT                   DAHSTLFPMRVTGRDGLAIEQAWRNGNEAYLGVTIPDFPNFFMIGGPNSPIGNFSFLMT
FT                   AENQCGYAVSMIRFLAESDVAAVSPKRQAMRAFNDAVKRQMGETVWASGCRSWYMDRNG
FT                   NIASWPWTYEHFREVMSEPDLDHYDLHSPVDA"
FT   gene            complement(697330..698079)
FT                   /locus_tag="Bcep18194_C7123"
FT   CDS_pept        complement(697330..698079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7123"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7123"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06167"
FT                   /db_xref="GOA:Q39MZ9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ9"
FT                   /protein_id="ABB06167.1"
FT                   /translation="MKEVVIVTGSSQGVGKGIASVYLREGAIVVGCDRRPPHESLAGHE
FT                   NFRHVDVDLTQDDAAAKVIAACIERHGRLDSLVNNAGLGNAKPFEQTSPEDYQRYYDIN
FT                   VGSLLALCGSALPHLKASRGSIVNIASAFGLVGVAQAAAYVPTKYAVVGMTRMLATEFG
FT                   CHGIRVNAVAPGLVRSPGTEQRIASNPWWHKMMIEGAPLGRVGEPEEIGHACRFLSSPQ
FT                   ASFITGVVLPVDGGWSIAKFLPDPSAG"
FT   gene            complement(698167..699789)
FT                   /locus_tag="Bcep18194_C7124"
FT   CDS_pept        complement(698167..699789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7124"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7124"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06168"
FT                   /db_xref="GOA:Q39MZ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ8"
FT                   /protein_id="ABB06168.1"
FT                   /translation="MLTSPVLFGELPAYAATRWPDSRAVTCEGRVFTFEQLNESVDIAA
FT                   RALMSRGVGKGDPVGIWLTNRPEFIIAFYAIVKIGAIAVPLNTRYRSDDIRYVVRHAEI
FT                   KLLFVCERSGPVDYMSLLTEAIPGLSGDRFDGSDAYPALREVVIVEPSNVASPLSWERF
FT                   LAGADRTTRVELDAVASAVQVSDLALMVFTSGTTGNPKGVLHDHRNLRAVCERAASWPL
FT                   RHGDTVLNFLPMFHLYGLSEIVMATMTQGIHQVLMSVFDAQRALRLIEQERVTGLHGFE
FT                   THYADLLKHHEALGTDLRTLKFGTLPAGMENSTAVARVVQERMCPTVTGFGISETWAWV
FT                   CITTLDDPVEQRCATSGRPMPGIEVRIVDPSSGDVLPNGSVGEIVCRGYNVMRGYFKDT
FT                   ESTRASIDPDGWFHSGDRGMFRSDGYLQFLGRYKEMLKVGGENVSPAAVELELLRLVPA
FT                   IDQVAVVGFPDERLAEVPVAFVVPKPGMTCTLDDVQARCNGKIASFKIPRHVIEMESLP
FT                   MTASGKVQRTALKALALRDIAAR"
FT   gene            700144..700407
FT                   /locus_tag="Bcep18194_C7125"
FT   CDS_pept        700144..700407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7125"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06169"
FT                   /db_xref="GOA:Q39MZ7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ7"
FT                   /protein_id="ABB06169.1"
FT                   /translation="MIDAAIDGVSEWRHRPRRRRAWWRVMRWTARKVRDEGAVRDRAIR
FT                   QALGVCRDGSRDECGGSIEQAEEVKCRLRAVNHPVPINKQDF"
FT   gene            complement(700535..701521)
FT                   /locus_tag="Bcep18194_C7126"
FT   CDS_pept        complement(700535..701521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7126"
FT                   /product="Acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7126"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06170"
FT                   /db_xref="GOA:Q39MZ6"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ6"
FT                   /protein_id="ABB06170.1"
FT                   /translation="MFVEAIEAILADCCTPSIVRNIEAGASPAALWRAIAESGFLEMLT
FT                   PEAAGGAGLSLAAVYPVIECLGRHAVPVPVAQSILARALLTEHDVPVPDGMITFSSACK
FT                   ADRDGATYCPIVPYGTIADVVLADHDGDLVVLQCARAERIPTGVHGSQCATVRWAEPLA
FT                   PVARVPGAARALHACAAIVSAALLAGAMSRAFALTLQYANDRAQFGKPIGKFQAIQQQL
FT                   SVMAEQVAAATIAAELGFSGERGLPDALRAAIAKARTSEAVVPVAATAHALHGAIGVTE
FT                   EYDLQLLTRRMHEWRTAHGSEHYWNAIVGDALLASGLPVGDFVLQSA"
FT   gene            complement(701557..702714)
FT                   /locus_tag="Bcep18194_C7127"
FT   CDS_pept        complement(701557..702714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7127"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7127"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06171"
FT                   /db_xref="GOA:Q39MZ5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ5"
FT                   /protein_id="ABB06171.1"
FT                   /translation="MDNVLDVFRLAALPPDAEAFRSDVKAFLHEHMPATPADVRARTWM
FT                   GFDAAFSRRLAQRGWVGLTLPAEYGGAGMDAFRRFVLVEELLAAGAPVSAHWIADRQSG
FT                   PLILKFGSDAQKRFYLPRICAAEAFFCIGMSEPNAGSDLASVRSRALRVDGGWRLNGRK
FT                   IWTTNADHCHYMIALVRTSGAPEDRQKGLSQFVIDLKQPGVEVRPIRDLTGDAHFSEVT
FT                   FDDVLLPEDALIGEEGSGWAQVNAELAFERSGPERIYSSVVLLDCWLAFLRRHGASASD
FT                   KAVAGRFATHLATLRNMSIAVTTKLARGESPVVEAALVKDIGTEFEQGIPAAIEAALAA
FT                   QPGADVDAELYRTVAYLSQISPTFSLRGGTREILRGMIARGLGLR"
FT   gene            complement(702768..703565)
FT                   /locus_tag="Bcep18194_C7128"
FT   CDS_pept        complement(702768..703565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7128"
FT                   /product="Enoyl-CoA hydratase / short chain enoyl-CoA
FT                   hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7128"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06172"
FT                   /db_xref="GOA:Q39MZ4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ4"
FT                   /protein_id="ABB06172.1"
FT                   /translation="MNPFLLYEQEGHVVTLTMNDPERRNPLTGNTAVAEFLAAIERIQG
FT                   DRSVRAVIITGAGKAFSTGGNIRDMERQASGEVPGLQIREEYRQGIQRLPLALFNLEVP
FT                   VIAAVNGPAMGAGLDLTCMCDLRIASEQARFAESFVKLGIIPGDGGAWLLPRVIGLARA
FT                   AELTFTGDPIDAATALEWNLVSRVVPHEQLLPAANEIAARIAANPPHAVRLAKRLLREA
FT                   LHSRLDTLLELSSTYQALSHQTADHRESVAAFLEKRPPVFSGN"
FT   gene            703960..705267
FT                   /locus_tag="Bcep18194_C7129"
FT   CDS_pept        703960..705267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7129"
FT                   /product="Major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7129"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06173"
FT                   /db_xref="GOA:Q39MZ3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ3"
FT                   /protein_id="ABB06173.1"
FT                   /translation="MSATPEITQALAGTRGTPRQNAKIIFAGSVGNVVEWFDWSVYTAF
FT                   AIYFSKQFFPADNETAALLATFAVFAVGFGMRPLGGWVIGAFSDRFGRRNALTLTVMMM
FT                   AGSSLLISILPTYASIGWLAPALMTVLRMIQGLSVGGEYGAATTFLTESAPPHRRGFYG
FT                   SFLFFSIAAGLLIAAAVASAMTHWMPRAELEAWGWRVPFFIGGCGSLIGFWMRRNVGET
FT                   EAFENLRRKGEIEARSLRWTWTHHRDALLRLVGISVLGAFSFYLFISFMPVYAIRHAGA
FT                   HPEDAFAASTASIAIFMLAQPLFGALSDRLGRRPQLIVFAAAYLLLLYPVVTSIGPDFR
FT                   SMLLVECFGLLTYGLYSSIAPAVMAELFSTEVRGIGIGTAYNIVVALLGGTTPYLMTWL
FT                   QSQHREGWFLGYVCVGAAISLITFLRMPETRGAGIG"
FT   gene            705309..706613
FT                   /locus_tag="Bcep18194_C7130"
FT   CDS_pept        705309..706613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7130"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7130"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06174"
FT                   /db_xref="GOA:Q39MZ2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ2"
FT                   /protein_id="ABB06174.1"
FT                   /translation="MQDTAIRTPSTGDTPAGHRPKPLAGINVLDLSRILAGPWCTQNLA
FT                   DLGADVTKIERPGTGDDTRTWGPPFLHDGEGRATSESAYYLCTNRGKRSVAIDIASPEG
FT                   AALIRSLAEQADVLVENFKVGGLAKYGLDYPGLAAVNPRLVYCSITGFGQTGPLAHRAG
FT                   YDFLIQGMGGLMSFTGEPDEAPGGGPEKVGVAVTDLMSGMYATTAILAALMERERSGLG
FT                   QHIDISLLDSQFAMLANQASNYLTTGVAPRRLGNAHPNVVPYQTFAARDGHLIIACGND
FT                   GQFKALCGAIGLPGLAEDSRFATNSARSVNRALLLPTLVDAFLARPRDEWIAIFESCGV
FT                   PCGPINDVAQALASEQARAREAVRHIAHPLAGSAPVVASPLRLSATPVEYDRAPPLLGE
FT                   HSADVLRERLELSDARITALAEAGVIALHSASQSA"
FT   gene            706698..707540
FT                   /locus_tag="Bcep18194_C7131"
FT   CDS_pept        706698..707540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7131"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7131"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06175"
FT                   /db_xref="GOA:Q39MZ1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ1"
FT                   /protein_id="ABB06175.1"
FT                   /translation="MTDMHSATDPQDATPATELPGPRATTRIVHILRLLAELPDGATLT
FT                   HLSELTATPKTSLLALLRALTFAEYLVHADGKYSLGVEAFKLGAAIVAQRRFPEIARPV
FT                   MERIALEAGETVLIGQLASDRPSLVYIMSAESRHAIRFIAGIGERRELYSSSGGRILLA
FT                   FMPAEKREQYLKSVTPTLLTPYTTTNKRDLRRLVSEAASSGIAITVDQNDLDVVGFGAP
FT                   IFNEAGEAIATLVMGTPKSRGIPQMDRFKGLILDGAREISQMLGFDPSPAARSKRQTS"
FT   gene            complement(707807..708580)
FT                   /locus_tag="Bcep18194_C7132"
FT   CDS_pept        complement(707807..708580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7132"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7132"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06176"
FT                   /db_xref="GOA:Q39MZ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MZ0"
FT                   /protein_id="ABB06176.1"
FT                   /translation="MNRLAGKVAIVTGAGSGTGMGAVIARVFAAEGATVVVTANANRQD
FT                   NMDTLVREITDLGQSASSAVLDVTRQDQWASVVADTVQRHGRIDILINNAGTPGPRDGS
FT                   WDKATAEDFHHVIDVNLNSQFYGIKAVTPHMERQGNGAIVNISSAAGIIVFPDVPPGYS
FT                   ASKGASRHLTKAAAVDFARRGIRVNGIYPGLIETPMAAHFTENPEMLAGLLKGIPIGRV
FT                   GTSEEIAKAALFLASDDASYVIGAELVVDGGLTSI"
FT   gene            complement(708632..709702)
FT                   /locus_tag="Bcep18194_C7133"
FT   CDS_pept        complement(708632..709702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7133"
FT                   /product="Monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7133"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06177"
FT                   /db_xref="GOA:Q39MY9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY9"
FT                   /protein_id="ABB06177.1"
FT                   /translation="MSRREALIVGGSLGGLSTALALARVGISSIVLERTAGRTQRGVAI
FT                   RAAGPPLERTIGRAAYRRVADVLGDAAIRQGTLPHAWWDVYTALRTATDAEPAIHIVEG
FT                   VKVVGIGQDGETVSARSEGGEIWHGDLLIGADGYRSVVRRHVAADQCHARYAGYVAWLG
FT                   QSEIPEADRRHIRGVDFFPQDNELLAVYPLIDSSMTLTRVGWAWFDAGHNALMRETGAV
FT                   EGGHVMYTPRADVIPDAIYDSLIERAGRRWKEPWRSGIVNAIRRREVIATPISEYVPSR
FT                   VTRGRVVLVGDAAHAQTPMTGAGFEEAVLDAAALADVLNAQPDVLQGLQRYESLRLDAM
FT                   RQRVEDGQAFSRSLIA"
FT   gene            complement(710166..711119)
FT                   /locus_tag="Bcep18194_C7134"
FT   CDS_pept        complement(710166..711119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7134"
FT                   /product="Aldo/keto reductase"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7134"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06178"
FT                   /db_xref="GOA:Q39MY8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY8"
FT                   /protein_id="ABB06178.1"
FT                   /translation="MTPDNLTPPIIAMGTWAWGDSGETGNGYFGSSHTRAGLEEVADNA
FT                   HAAGFSLWDTAIVYGMGRSETVLGEVLKRFARSDYQLSTKFTPQAAGAGADPVADMLEQ
FT                   SLARLGTDYIDLYWIHNPADVARWTPHLIPLLESGKVKHVGVSNHNLSEIERANHILGE
FT                   AGFRVEAIQNHYSLLYRGAEHAGILDYCRNQGIPFFAYMVLEQGALSGKYGPEHPLPEG
FT                   SNRAETYNGMLPRLKVLTDTLASIGRKRGAAAPEVATAWAIAKGATPIIGVTKPRHVDG
FT                   LVRAGRITLTTDEIAELEALADAADVNTRGWWEQAM"
FT   gene            711409..712188
FT                   /locus_tag="Bcep18194_C7135"
FT   CDS_pept        711409..712188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7135"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7135"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06179"
FT                   /db_xref="GOA:Q39MY7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY7"
FT                   /protein_id="ABB06179.1"
FT                   /translation="MPSVCRPQLCLVAQGHKEVTLDDRVFRYAPGRYGIVTYDLPVTGK
FT                   VVEATPDKPYLCLYLDFDPVMLGHMALRVPPPEAPSPPIGKTVSGASAGLLDAALRLLR
FT                   LLDDPAALPVLGPLAEQEVLYRLLAGPDGARMRHITSSQGPVAQVGRAIAWITQNFRER
FT                   FSIEQLAAEAGMSPSSLHDHFRRVTAMTPLQFQKQLRLQDARSLMLVQGIDATTAAFCV
FT                   GYESASQFTREYRRHFGEPPARDIARLRASPRWVGVT"
FT   gene            complement(712116..712385)
FT                   /locus_tag="Bcep18194_C7136"
FT   CDS_pept        complement(712116..712385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7136"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06180"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY6"
FT                   /protein_id="ABB06180.1"
FT                   /translation="MRMDPDPWLDQYNAERAHQARWCHRKTPIRTFLDSLELAREKRIP
FT                   HRWLIPCRPDYPPDRVLAITTQVTPTQRGEARRRAMSRAGGSPK"
FT   gene            complement(712598..714562)
FT                   /locus_tag="Bcep18194_C7137"
FT   CDS_pept        complement(712598..714562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7137"
FT                   /product="NADH-flavin oxidoreductase/NADH oxidase"
FT                   /EC_number="1.5.8.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7137"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06181"
FT                   /db_xref="GOA:Q39MY5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY5"
FT                   /protein_id="ABB06181.1"
FT                   /translation="MYKHVFSPLRIGAVEIPNRIVRTAHATRLADRYVNDDLIAYHLAR
FT                   AKGGAGLSIIESTSVHPSSTFSLTASDDGSIAPMRKLVDAIAPTGMKLFTQLWHGGYTD
FT                   PAADGGLPWAVSALAGRYSIAPPIPMTTDQIEEVIDAYAKAAVRMQAAGLDGVEVLAGA
FT                   GYLFSQFFSPVLNQRTDAYGGSFDNRIRAFMETLRAIRAATSPEFALGVRIGGSSDPRI
FT                   LTDEDVNAIALRAQAEGLIDFVNITHGDYYFHVDRYAGMDAPVGYQLPHVERISEGVTV
FT                   PRIIVGRYATLDDAEQALKTGQADMINIVRGMIADPLLVVKSREGRGTEVRPCIGCNQG
FT                   CLGGAFAGRMGCAVNPAVGYEQTLSDETIVKAGTPRKVVVVGGGVAGMEAARTALLAGH
FT                   RVTLVEAMSDLGGLLNCAKHLPKLHPIGDIAIWLENEIYRLGADVRLSTYVDADDVLAE
FT                   EPDAVIVATGSQPADVREFRQTADPAAQVPIAREATVLTSLDLAMAPPQDLGRTALVFD
FT                   DVGHYEAIGCCEALINRGVEVTYVTRHLMFAPAVETTGRTQAALRRLHNAGRLRIVTQS
FT                   ALVSIDSSSAEIRPLFGTETERIAADTVVLVGYRESQNEIWAALRGRVDQLHLVGDARS
FT                   ARDIQPSIREGHIAGRSIK"
FT   gene            complement(714565..715347)
FT                   /locus_tag="Bcep18194_C7138"
FT   CDS_pept        complement(714565..715347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7138"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7138"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06182"
FT                   /db_xref="GOA:Q39MY4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY4"
FT                   /protein_id="ABB06182.1"
FT                   /translation="MDMKLARRRVLITGASQGIGEGLARAFAAEGCHVVLTARSADKLE
FT                   QLAADLRAAHDVRVDVLALDMTAPGAIDEVVAFAGDVDVLVNNAGAIPGGTLWDVDEEA
FT                   WRKGWELKVFGYINLTRAIYTGMKARGGGVILNNIGNGGQNFDFNYIAGSTGNAALMAF
FT                   TCALGGRSLEDGIRVVGVNPGPVGTERIAKVLRNHAARLLGDEARSDELMAGYPLGRAA
FT                   TVDEVADLFVYLASPRSGYTSGTIVTVDGGITSKRSVA"
FT   gene            complement(715504..715827)
FT                   /locus_tag="Bcep18194_C7139"
FT   CDS_pept        complement(715504..715827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7139"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06183"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY3"
FT                   /protein_id="ABB06183.1"
FT                   /translation="MNEHKNSGDAFHESPPANVGRSGDWLNRAAAARAHAANGIRVTRF
FT                   PARPFLDRSRRSRRCPRERVPLIRRNEAADRRRERIRVVRVKRQSGKPDGASADAYGAV
FT                   PAG"
FT   gene            716102..716842
FT                   /locus_tag="Bcep18194_C7140"
FT   CDS_pept        716102..716842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7140"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7140"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06184"
FT                   /db_xref="GOA:Q39MY2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY2"
FT                   /protein_id="ABB06184.1"
FT                   /translation="MTDKSALKAEFERLHGYWSDVHDQALAEDPVFFNDYLVMARAALD
FT                   AGHLEPKLCDLVMIAASASVTHLNGDAVALHIQGALRHGATRREIAEALQISSVLGIHS
FT                   YMVGVPVLFEEIEANGQSVDTAFPLDEKFEQVKSAFTASRGYWSDQLTSMVRSSPAFFD
FT                   GYTAFSSTPWREGTLAPVVKELLYVAIDVSTTHMFEPGVRIHTRNALRYGATPAQVLQV
FT                   MQIVSCLGMQSFLLGVPPLRRAAA"
FT   gene            complement(716853..717764)
FT                   /locus_tag="Bcep18194_C7141"
FT   CDS_pept        complement(716853..717764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7141"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7141"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06185"
FT                   /db_xref="GOA:Q39MY1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY1"
FT                   /protein_id="ABB06185.1"
FT                   /translation="MTSVMDIGFLGLGKMGAPMAERLLGQACRLHVYDPSAQAVAPFVD
FT                   GGAVAHASPRAVADAASIVFACLPNRDVSLAVGLGPDGVVHGSAVRLYVEMSTIGQDMI
FT                   ERIGEGLAQRGIDIVDAPVSGGPSAARAGTLAMLVSGMPSAVEQVSPLLERIGKEVFPM
FT                   GDRPGMAQIMKIVNNVVMAANLVVCAEGLAMGAKAGLDADRMMRLIDSGSGQSFACSKI
FT                   MSRAVSGAFDFGAALAVIEKDMALGLAEARLMDVAMPAIERARDVWHAAYEAGRGGEDF
FT                   TSILRYVEERNGTRVRGRAVPA"
FT   gene            complement(717917..719584)
FT                   /locus_tag="Bcep18194_C7142"
FT   CDS_pept        complement(717917..719584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7142"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7142"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06186"
FT                   /db_xref="GOA:Q39MY0"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MY0"
FT                   /protein_id="ABB06186.1"
FT                   /translation="MQYPDETVSMRRDGAPAAPDLDVIVVGAGFAGLYALYKFRKLGLS
FT                   AQALEAGSGIGGTWFWNRYPGARCDVDSVEYSYSFSDDLQQEWNWPERFSAQGDILRYI
FT                   NHVADRFDLRRDIRLNTRVQSASFDESNGVWRVETVDGQVVTARFCVMATGNLSLPRVP
FT                   EFKGLDTFKGEWYHTGLWPDEPVDFTGRRVGVIGTGSSGIQVIPIVAKQASQLFVFQRT
FT                   ANFTLPARNRALSGDELGRHKARYEFWRAEAQNTPFGIAGHAAPTKNALDDTPEDRLAT
FT                   FEEKWKAGGSISFLYAYKDLLTNKAANDTAAEFVRNKIRSTVKDPATAELLVPKDYPIG
FT                   ARRLCLDTGYYETFNLPNVTLVDTKSAPIIEITETGVKTATGDYALDTIVFATGFDAIT
FT                   GALADIDIRGRDGLPLKQKWVHGPRTYLGLMTAGFPNLFIVTGPGSPSVKSNMVCAIEQ
FT                   HLNWITDCIGKLAAQGTATIEADSDAETRWVEHVNEVADATLYPLAESWYTGANVPGKP
FT                   RVFMPYVGGFHRYRAICDDVVRDDYRGFVIADVQAAEA"
FT   gene            719849..720721
FT                   /locus_tag="Bcep18194_C7143"
FT   CDS_pept        719849..720721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7143"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7143"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06187"
FT                   /db_xref="GOA:Q39MX9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX9"
FT                   /protein_id="ABB06187.1"
FT                   /translation="MQPERSLPRHAGKKSLSGPYGIDLAWPRTSGSNQADGTVVVAPVA
FT                   RGLSILSAFTPDKPSLGNQEIADATGIPAPTVLRLLRSLVTLGYLHRDDRSKRYSLASA
FT                   SLALGYAAIADPEMLRLASIEMRAFAEATDTYVLLGTRDRLDVILLETHVNRRSLLELQ
FT                   LSPGMHVPIAYSMMGWALLAALPEDEREYLRAQVERHAGATWPPAIRHRMNDKIAQVHE
FT                   LGFCMLHGEWEPELTCVAAPLTLPGRPPLVLCCVGRTARVAQAAVERELGSRLVACARV
FT                   LQERLPARR"
FT   gene            720757..721539
FT                   /locus_tag="Bcep18194_C7144"
FT   CDS_pept        720757..721539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7144"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7144"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06188"
FT                   /db_xref="GOA:Q39MX8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX8"
FT                   /protein_id="ABB06188.1"
FT                   /translation="MPHEAEKTTMTLERGMQVLNAFHAERIALTNGDLVQRTGLSRSVV
FT                   SRLTSTLIQLGFIRRVAGGPRFELAAGIFGIGHTYLETNPVTRLAQPLMQRLADTLGAA
FT                   VALAVPHRLDMLYVAHCYSVRNSTLQLGVGSLLPMSTTSIGKAWLWGLQEDARNDYVAR
FT                   LLNAADARASALKASFDAAFDELDSTGVCTSIGEFQHDVYGIALPISVGCYATPMALSC
FT                   GAVDLHPDIDAIRNRIAPPIKLTAAELAAALRDVPFMP"
FT   gene            complement(721595..722710)
FT                   /locus_tag="Bcep18194_C7145"
FT   CDS_pept        complement(721595..722710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7145"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7145"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06189"
FT                   /db_xref="GOA:Q39MX7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX7"
FT                   /protein_id="ABB06189.1"
FT                   /translation="MDFTYSEEQQMMADSLRRFVETEYAFERRRKRSRNAGAFDRAVWS
FT                   SLGELGVLGLTIDADHGGFGEGPASRLVVQRELGRGLALEPVVPSAVVAGAVFGRYGND
FT                   AQKQAWLPAIASGEKIVSVAYLERDSRYQPENVQTSAERSGAGYVITGRKALAWHGEVA
FT                   DALLVTARLAGSGDIGLFVVPRDARGVTVTGYPTMDGLRAADITLDGVTVAGDAMIEGG
FT                   LDALQHGIDHGIAALCAEAAGAMERLIEITAEYLRTRQQFGKPLGAFQALQHRMADMLI
FT                   QKEIALSMAYVAAQALDETGADERTRKIAAAKVMVAKAGRYVGQQAVQLHGGMGMTDEL
FT                   EVGDYLKRLAMFDPLFGDSDYQMARYTAAMA"
FT   gene            complement(722720..723916)
FT                   /locus_tag="Bcep18194_C7146"
FT   CDS_pept        complement(722720..723916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7146"
FT                   /product="Acyl-CoA dehydrogenase-like protein"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7146"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06190"
FT                   /db_xref="GOA:Q39MX6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX6"
FT                   /protein_id="ABB06190.1"
FT                   /translation="MDLRYTAAEHAFREEVRAFVDANLPNDIRDKVLGHRRVEKDDYVR
FT                   WHRILNAHGWGAPAWPKEHGGTGWSPLQRLIFEIESFKLGAPRLLPFGLLMIGPVLMKY
FT                   ASPQMQARFLPRIPDMDDFWCQGYSEPGAGSDLASLKTRAVRKGDKYVVTGQKTWTTMA
FT                   HFADWLFCLVRTNPDAKPQEGISLLLIDMKSPGVTVRPIVTLDGGHDVNETWLEEVEVP
FT                   VENLVGEENKGWTYAKYLLGHERTGIAGIGHCYRELRQLKHYAQVTPNGTGGVMIDDAR
FT                   MRDKIARIEMDVMALEMLLLRVATQGAGKAPGPEASILKIRGSEIQQDIAMLQQEVAGP
FT                   HGWPYSPDWLLDGAIQPVSGPDWAAPAASTYFDMRKISIFGGATEVQKNIISKMILGF"
FT   gene            724322..725404
FT                   /locus_tag="Bcep18194_C7147"
FT   CDS_pept        724322..725404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7147"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7147"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06191"
FT                   /db_xref="GOA:Q39MX5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX5"
FT                   /protein_id="ABB06191.1"
FT                   /translation="MSRLKTPLCELLNIEYPILQAGMGGVAFGPLAAAVSKAGGLGTIA
FT                   AISPTPERVEQEIKLVRSLTDKPLCVDIGFPLRAPKNLASIKIENLPSPIVQLQKEIEA
FT                   LGIEVKPVDDQAMGIEDAKTKLEICFKHKVEVIACALGTPAWVVDECHARGVKVVSMVG
FT                   SARHAKAAIKAGTDVVVVQGTEGGGHTGDVGLITLLAEVLEFSPVPVVAAGGIVTGSQI
FT                   AAVLTQGAQGVWVGTRFIGSQEATVGPNYKQSIVDAGYDQTIRSLLFDGLYVRQLKNRY
FT                   TEVWEGHEDEMLPYPEQRVAIGPVRFASVEADLKDHQPLPAGQGSSLIRDVPPAGDVLR
FT                   RLVDETVATLKDSRGRVEFA"
FT   gene            725898..726812
FT                   /locus_tag="Bcep18194_C7148"
FT   CDS_pept        725898..726812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7148"
FT                   /product="protein involved in meta-pathway of phenol
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7148"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06192"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX4"
FT                   /protein_id="ABB06192.1"
FT                   /translation="MWKLFSASLLACLISSEAFSAQGVAYGGPVGGTDIQNAVLPDKAG
FT                   FYGGLVVGYVKSYSLMGNGGQNSIADFSTSSGLSEFALLYIYPFKLFGGTLGTMVADGG
FT                   GIGRVKLNDRYESWRGFNDVYSDILMWSTHVGDNPVRGLTVKLAYSMMLAAGTYDSRRI
FT                   VSTGQNTFYYIPNFALTYLTGPNRLGDGLELDGHVFFDIAGRNPTTNYNNGLVIDIDAA
FT                   ISEIIGRWQIGVAGYYARQVTEDRQNGQIVPGDRFGIAVAGPVIAYSIPEWGASVKLKA
FT                   QFGIWARNTAKANGLLLFFSKAF"
FT   gene            complement(726789..727040)
FT                   /locus_tag="Bcep18194_C7149"
FT   CDS_pept        complement(726789..727040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7149"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06193"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX3"
FT                   /protein_id="ABB06193.1"
FT                   /translation="MEVARPVTRVERHVEPFYKMDLGAWPLSFPRRRPVETGTPADVTS
FT                   PAISIESYAKSGAASSMSAPRDRSSQEQSIRSERFAEK"
FT   gene            complement(727164..727610)
FT                   /locus_tag="Bcep18194_C7150"
FT   CDS_pept        complement(727164..727610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7150"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06194"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX2"
FT                   /protein_id="ABB06194.1"
FT                   /translation="MISDIDRLVAIEDIKTLQYKFFRAVDYEKDKIAGLLTHDVRISFS
FT                   DETPAEAVKLTQPVVLNGPDTFVSFLKQFVGAERSVHLGLMPQIEFDSADKANGIWWIQ
FT                   GVGTDPKARGLKIGLGFETMECDYVRVDGKWLISSLSARIQVHM"
FT   gene            complement(727781..728998)
FT                   /locus_tag="Bcep18194_C7151"
FT   CDS_pept        complement(727781..728998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7151"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7151"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06195"
FT                   /db_xref="GOA:Q39MX1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX1"
FT                   /protein_id="ABB06195.1"
FT                   /translation="MRQAVICEPVRTPVGRYGGVFKDIPVATLAETVIRELVRRTALDP
FT                   ARIDDVIFGQCYPNGEAPAIGRVASLDAGLGIRVPGLQLDRRCGSGLQAVIDAAMRVQT
FT                   GAADLVLAGGAESMSQAEHYMLGARWGGLRGDSSPMWDRIARGRITSGGRHHPVEGGML
FT                   ETAENLRREYGITRDAQDALAYRSHSRAIAAHESGRFGDEIVPVQVKTKGGTTLVDRDE
FT                   HPRADVTMESLAALRPVRQKVDAESTVTAGNASGQNDGAAVCIVTTPEQAADLGLRPLA
FT                   RLVTWAVAGVEPERMGIGPVPATELALRRAGLALKDLDLIELNEAFAAQVLACTAGMGF
FT                   DAGDYERLNVNGSGISLGHPVGATGVRILATMLRELDRRGGRYGLETMCIGGGQGLAAV
FT                   FERVAA"
FT   gene            complement(729075..729224)
FT                   /locus_tag="Bcep18194_C7152"
FT   CDS_pept        complement(729075..729224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7152"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06196"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MX0"
FT                   /protein_id="ABB06196.1"
FT                   /translation="MGLPIRFSATLSQFDRPVMALAPGDANDEIDSRLLALDACEIAEG
FT                   GIGA"
FT   gene            complement(729396..729848)
FT                   /locus_tag="Bcep18194_C7153"
FT   CDS_pept        complement(729396..729848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7153"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7153"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06197"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW9"
FT                   /protein_id="ABB06197.1"
FT                   /translation="MPGLYFEDCREGLVVEHAIRRTVTETDNVLFSAMTYNCAPLHIDA
FT                   EYSKGSIYGQRLVNSMFLLALVAGITVYETTLGTTLGNLGFQEIKFPKPTFHGDTIRVR
FT                   TEIVSARLSKSRSDSGIVVFRHVALNQRDEEVCTAVRTGLMMLRPK"
FT   gene            complement(729869..730744)
FT                   /locus_tag="Bcep18194_C7154"
FT   CDS_pept        complement(729869..730744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7154"
FT                   /product="HpcH/HpaI aldolase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7154"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06198"
FT                   /db_xref="GOA:Q39MW8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW8"
FT                   /protein_id="ABB06198.1"
FT                   /translation="MRPARSLLFVPGNKPDWIEKSIASKADALILDLEDSVPVPLKVEA
FT                   RAVVRSKLAWLAEQRQRVYVRINRSPYLYDFDDILAVVGPHVEGIVISKPVGPEDIDCV
FT                   SMMLTEAEFRNGAALGSTRVIPLLETARSLQFAYEIASRERVGAIVGATAKNADVARAL
FT                   GYVWTPDGRESLYFKSRAVMAARAAGKHAIGGVWQQVKDLDGLRKSSLLDRNLGMSGEL
FT                   ALHPSNVATINDVYSPSADEVAYYEGMIAALDDAQAGGRASCIYDGEHIDIAHVKTAHE
FT                   IVARAKSLNH"
FT   gene            complement(731034..733040)
FT                   /locus_tag="Bcep18194_C7155"
FT   CDS_pept        complement(731034..733040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7155"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7155"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06199"
FT                   /db_xref="GOA:Q39MW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW7"
FT                   /protein_id="ABB06199.1"
FT                   /translation="METAWQVADVAWRPEPEAARASTLAAFMRYVGIEQADPAGYRQLL
FT                   EFAETRPDDYWSALIRHMDLRFYQPYDAVVDTRDGIEWAKWCVGGTTNAVLNCLDRYRG
FT                   TARDRQEAVVWEGEDGTVRRWTYAELDAQTSRLAAGLREIGCRQGDVIALYLPMVPEAV
FT                   AGMLAISKIGAIVLPLFSGFGAQAVASRLQDAGAVAVLTADASTRRGKVTPLKQTIDAA
FT                   RADVPTLKHVVVLRHRGAETEWDARVDHEWHELIDGQPTDAPTTEMPADAPMMLMYTSG
FT                   TTGKPKGTVHSHCGLITKLALDMGLCADMRAGDRLMWLSDMGWLVGPMLIYGTTLLGGT
FT                   IVMAEGAHDFPDSGRFWRLMEQHRVSVLGIAPTIVRSFMQAGGAGIENHDLSALRVALS
FT                   TGEAWTVDAWRWMFDKVCGGSRPIINYSGGTEVGGGIVTGTVIHPLKPCAFAGPIPGMG
FT                   ADVVDDAGRSVGPGGTGELALRAPSIGLTRGLWHDNERYLASYWGTTSGMWRHGDRAAI
FT                   DADGFWYVLGRADDTLKVAGKRTGPSEIETLVMATGQVAEAAAIGVPDCVKGETVGLVV
FT                   TLMPGVPADADVEKALSAAVVSGLGTAFRPALVLFVDDLPKTRNMKIMRRAVRAACLGL
FT                   PPGDLSSLANPETLDAIAAAASRHGISKTVDGR"
FT   gene            complement(733356..734840)
FT                   /locus_tag="Bcep18194_C7156"
FT   CDS_pept        complement(733356..734840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7156"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7156"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06200"
FT                   /db_xref="GOA:Q39MW6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW6"
FT                   /protein_id="ABB06200.1"
FT                   /translation="MKSESEHPGLAAALAWCRSGAKQHFIDGKWVPAASGRTMETLNPA
FT                   TADVLAHIAEGDKADVDLAVAAARRAFESSGWRGMSPHARTAVLLRLADAIEQHADELA
FT                   ALETLDNGMPAWFSAAVVKMTVDTFRYYAGWPTKILGTTVPTDPSAFIYTLREPIGVCG
FT                   QINPWNVPLLLAGVKFGPALACGNTIVAKPSELASLTCLRLVEIFHEAGLPPGVMNVVT
FT                   GYGQTVGAAISEHPGIDKVAFTGSTAIGKQILLASAGNLKRVTLELGGKSPHIVFPDAD
FT                   LDKALAAAVNGFTRNSGQICSSGTRLFVHRSIHDEFANEVAKLAARLKVGNPFDADTKL
FT                   GPLISSKQRDRVMSYVAAGNDEGATLLTGGRQACDAGYYVEPTVFSGVSNAMRIAQEEI
FT                   FGPVVCVIPFDTEEDVIAQGNDSTYGLAGGIWTRDIGRAHRIAAALKGGRIWINTFGET
FT                   DPVMPFGGYKQSGLGREFGAESIQTYTEAKSVMLRY"
FT   gene            complement(734899..735261)
FT                   /locus_tag="Bcep18194_C7157"
FT   CDS_pept        complement(734899..735261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7157"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06201"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW5"
FT                   /protein_id="ABB06201.1"
FT                   /translation="MHRATDRTNQAQAVAGCFTALCEQLEIQMIEQAWRVKRIASDHWR
FT                   RRLRESGALSTHVGVTNTCGRSAPGLTIDDALPARDRRDGLCFNSKIAHQFHRKAASSG
FT                   RRNRRCTQQGRGPSRR"
FT   gene            735517..736677
FT                   /locus_tag="Bcep18194_C7158"
FT   CDS_pept        735517..736677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7158"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="5.1.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7158"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06202"
FT                   /db_xref="GOA:Q39MW4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW4"
FT                   /protein_id="ABB06202.1"
FT                   /translation="MKDNAGAGPLAGLKIIELGGIGPGPFCAMLLADMGADVLRLDRIV
FT                   PSDSGVHMDHRFNLLNRGRRSVAIDLKRPQAVELVKRLTASADAALEGFRPGVAERLGL
FT                   GPDDLLAHNPRLVYGRMTGWGQDGPLAQAPGHDMNYISLSGALHTIGERDGPPVPPLNL
FT                   VGDFGGGAMYLAFGMVCAMLEAARSGTGQVVDASMVDGSAHLMTLIYGMYAAGAWSDRR
FT                   GDNRLDSGTPWYSVYRTRDDRYVSLASNEPRFYRETLALLGLSDTPLPDQHDRHGWPVL
FT                   REHFTRVFATKTRDEWCALAAGTDVCLAPVLSLAEAPHHPHNVARGTFVEVDGIVQPGP
FT                   APRFSRTKPTLRGGAPAPGAHTTDALRDWGIDAREVDALRAEGVLQ"
FT   gene            736674..737915
FT                   /locus_tag="Bcep18194_C7159"
FT   CDS_pept        736674..737915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7159"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7159"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06203"
FT                   /db_xref="GOA:Q39MW3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW3"
FT                   /protein_id="ABB06203.1"
FT                   /translation="MNATDNTQANTVDRPLDGVRVLAIENFIAGPYASMWLADAGAEVV
FT                   KVESREGGDFSRSTSPVKTDAHGVAHGLSFLRSNRNKKSVTLDLKHPDGKRIFIELARE
FT                   ADIVVENLRPGVMDRLGIGYDVLREHNPRLIYVAISGFGHTDVKPSPYTDYPAFDIVGQ
FT                   AMSGLMYRPERTGDRPTYLGFSLADLQGGILAMQGALLALYQRQRTGRGKKVDISLYDA
FT                   SLIQNEISVAMYSALRQPTPPGVHAVTAPFGTYRANDGYIVIAVLGEHIWRRFCDVIGR
FT                   PELPDDPRFVDGISRRANGDVLNSHIDAWLAARTRADAVRMLRDGGVPASVVNDVADLF
FT                   DCPHVAARDMLMTLDDPVWGPIQVAGNPIKMSDVPEPEAGLPPQLGQHTQAVLEAWLQM
FT                   DGDEVAALRSRQVI"
FT   gene            complement(737991..738749)
FT                   /locus_tag="Bcep18194_C7160"
FT   CDS_pept        complement(737991..738749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7160"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7160"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06204"
FT                   /db_xref="GOA:Q39MW2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW2"
FT                   /protein_id="ABB06204.1"
FT                   /translation="MNRMKGKTVIITGAASGMGAAGAGLLAREGANVLVTDIRADGAAQ
FT                   VAAGIREQGLSAEHCGLDVTDAAQWQAAVDKALAAWGRVDVLVNNAGLPGTPDTWEQAT
FT                   LESLNKLIELNLNGQFLGIKTVIPAMERTGGGSIVNMSSIAGMIAFPGLHPGYGASKGA
FT                   NRLLSKCAAIDLAGRGIRVNSVHPGVIRTPQSEYLFDDPDVIKVIHSKIPLARAGRPEE
FT                   VATVVLFLASDESSYMTGAELVVDGGFTAL"
FT   gene            complement(738849..740219)
FT                   /locus_tag="Bcep18194_C7161"
FT   CDS_pept        complement(738849..740219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7161"
FT                   /product="Major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7161"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06205"
FT                   /db_xref="GOA:Q39MW1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW1"
FT                   /protein_id="ABB06205.1"
FT                   /translation="MRQFDLQAVIDEARFGRFHAVVLCWCILIMILDGYDLAIVGISLP
FT                   LIMKAMHISPVMAGVIASSSLFGMMVGSILLGSVADRIGRRPAIVLCVLLFSVFSAAAG
FT                   AVSSAVAFCALRFLAGLGLGGIAPTCAAQMTEYSPRRMRSMLVSLMFAGYSGGGVLAAL
FT                   LGKTLLENYGWRSIYYAAAVPIVLVPVIWRTLPESLSFLVLKGRDADVRRIAQRLMPGE
FT                   VPRPGDRFAMPKEEAGPTRLLGALFSEGRAFSTLMFWVTCITNLFMVYGLSSWLTKLMA
FT                   SAGYSLGSALTFVMAMNLGAVVGAIGGGWLADRLNIQRVLIGMYLVAAVSIALLGYQAP
FT                   TAVLYAVVTVAGACTIGTQIVVYAYAGQFYPTNVRSTGVGWAAGIGRLGAMFGPILIGV
FT                   IVGLALPLRFNFYAMAIPAVIGALAVALVNDRLSDRIRSRAAHDRAGELGAVGEGSA"
FT   gene            complement(740604..741557)
FT                   /locus_tag="Bcep18194_C7162"
FT   CDS_pept        complement(740604..741557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7162"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7162"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06206"
FT                   /db_xref="GOA:Q39MW0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MW0"
FT                   /protein_id="ABB06206.1"
FT                   /translation="MSALSVHGLTRRVDLFTLRLFLTVVEERQIRRAATRENIAPSAAT
FT                   KRVQDLEDIAGVQLLERIPNGVVPNAAGEVLARYLRQMFENFEDMRRELCEFSAGVRGH
FT                   VSVASTGASVVQYLGREFGEFARNFPQVELELKQEPNTNLVRAVMTGDVDLCVYVVSAD
FT                   VDDSQLDTLPYRTDSFVAVVPRNHPLAEQRTVKTLDLVREPFIAQPVNTTLMFKVNEAA
FT                   HALGETIRARFTVSGADVALSLVQAGLGVTVLPECMVSMDSHERCAVLHIQEPWAERVL
FT                   RVGTRKGKATTSATRALIDQLTGRPKAAPSSGPLAD"
FT   gene            complement(741891..742394)
FT                   /locus_tag="Bcep18194_C7163"
FT   CDS_pept        complement(741891..742394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7163"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7163"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06207"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV9"
FT                   /protein_id="ABB06207.1"
FT                   /translation="MGSKEEGEEEGIMTEAMSGGYLDRFVIGATYRHPIQHTLTEACNL
FT                   LFSTLTHNAEPLYLDVEHGGSSPYHARVANSTFVLCVASGAHAYELNQTIRSIGLGCTD
FT                   VRFVRPVFVGDTIWAESETVDRCDAGHEGAVIEFECRVYNQRNELVIKFRSQWSMSTPA
FT                   LPLQ"
FT   gene            complement(742844..744541)
FT                   /locus_tag="Bcep18194_C7164"
FT   CDS_pept        complement(742844..744541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7164"
FT                   /product="ZmpA-like peptidase, Metallo peptidase, MEROPS
FT                   family M04"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7164"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06208"
FT                   /db_xref="GOA:Q39MV8"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV8"
FT                   /protein_id="ABB06208.1"
FT                   /translation="MKKLSRLLSISAITVASLSAFAQAGDPSATVDKALQLIQQNPSAF
FT                   SLAVGGAARTLKFAGPQASAPADGDQFQVRDVIVDPDGTEHVRFDRFYAGLPVIGGDVV
FT                   VHSSKGQLKQASVTQLAPINLAGNIGKVGDRSVIRNAPDVGAARVKRIAAARFNSDVRR
FT                   VDDAELVVFARDVTPTLAYAVRVYGKATDAHGDAVLYYVDARNGTVLDAQDLIKTAAAT
FT                   GTGRSLYYGNLTLTTDQTGTNAYRMLDPSRGSGSVYDGRGLTSDDVEQATDLPIFTSST
FT                   NVWGNNTTTDRQTVAADIDYGLALTWDYYKTMHNRNGIFNDGRGVKSYAHVVFNTGSGT
FT                   TGANAAWLNSHVMVYGDGQPGTSLPKPVVSVDVAGHEMSHGVTEATANLNYSGDAGGLN
FT                   ESTSDIFGTLVKYYANNPNDPGNYVIGARVVSGGLRKMYKQDLDGRSFSCYPSGGFSWS
FT                   NPRHDPHFTSGVGNRLFYLLAEGPTVPSTDTGLTKAQLVCNGDTTFSGVGREKAGKIWY
FT                   RTLTVYLNANSSYPNARRASIQAANDLYGANSAESTAVARAWSAVGVN"
FT   gene            complement(745157..746449)
FT                   /locus_tag="Bcep18194_C7165"
FT   CDS_pept        complement(745157..746449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7165"
FT                   /product="Major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7165"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06209"
FT                   /db_xref="GOA:Q39MV7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV7"
FT                   /protein_id="ABB06209.1"
FT                   /translation="MGARLGKGGAHVSTGSGPRMSDKPVLAAGAPCEPAASTAPLMALA
FT                   CLLVFMAQMATTVYLPSLPVVMRELTMTQGGAEFSISAYVIGAALPIPFWGAAAERWGR
FT                   RGPLLISLLLFVSSSLLLAICTVAPALLVLRALQGIGGGGAAIIARIIVRDNWRGDELA
FT                   RRLSVLSIAFITALGGGQFVGGLIGRYSHWQTGFVLMAVIAALAIGLSYALPLKAGSRA
FT                   AVTSGMAGTYRALLRRPGFLWPACAGGLGFATTVTLQEVSPFVFQAHFKLAVTSFGSIG
FT                   LLLGVAYFSGAMLVNRLVKRLGGVRLMHAGAALVALATTLMLASWLGGLLTHFTGLWIF
FT                   IALYCLAIFGQAVLFPNSMATAVSDAHEHGAHAMALCGFLQQGLAGIAATAAVLQHHGG
FT                   TWTLAVFVLGALTWLVVRLKVRAGQAANVTG"
FT   gene            746716..747291
FT                   /locus_tag="Bcep18194_C7166"
FT   CDS_pept        746716..747291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7166"
FT                   /product="Adenylate kinase-like kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7166"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06210"
FT                   /db_xref="GOA:Q39MV6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV6"
FT                   /protein_id="ABB06210.1"
FT                   /translation="MRQNTQLQNSAPVKHMRVVVVGTSGAGKSTFSSALAAAAHCPYVE
FT                   LDRLYWGPDWTAVPPEQFENAVLAATAGDRWVADGNYSAVRDALWSRATHVIWLNFGRR
FT                   TVFSRVLWRTLSRGLMRTELSHGNRESLRMAFSRESVLLWSYTTFARNRIKFAALRDDP
FT                   KFAHLHWTEITQPSHTRAVIDRLTRAGG"
FT   gene            complement(747310..748059)
FT                   /locus_tag="Bcep18194_C7167"
FT   CDS_pept        complement(747310..748059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7167"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7167"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06211"
FT                   /db_xref="GOA:Q39MV5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV5"
FT                   /protein_id="ABB06211.1"
FT                   /translation="MTLLEGKVAIVTGASTGIGRAVALMFAAHGASVVLGARSEAPLNQ
FT                   VADEIRRQGGQPRACAGDVGDVDTHRRLVATAVREFGGLDIAINNAGTVGPLKPLADLS
FT                   LDEWQQTLSTNLTAAFLGASSQIPAMLERGGGSIVFTSSFVGTSAGLPGMAAYGASKAG
FT                   LTGLVKGITADYAARGIRANALLPGGVDTAMGGDRDQKEWAAGLHAMKRIARPDEIASA
FT                   ALFLASPMASFVTGSALFADGGNAAVK"
FT   gene            complement(748313..748720)
FT                   /locus_tag="Bcep18194_C7168"
FT   CDS_pept        complement(748313..748720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7168"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7168"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06212"
FT                   /db_xref="GOA:Q39MV4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV4"
FT                   /protein_id="ABB06212.1"
FT                   /translation="MTAITQTMKLNHLSFPSADTLATARFFERHLGFTIAGSWDQSWIL
FT                   KRPGFDVVIDHVSDDTPAWPTNFHVGFELPSFDDVRTLFERFREEGVEMVTNVFNNGRG
FT                   SRFFCRAPGGVMFELNTRADAAPEYQGTFDD"
FT   gene            complement(749070..749993)
FT                   /locus_tag="Bcep18194_C7169"
FT   CDS_pept        complement(749070..749993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7169"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06213"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV3"
FT                   /protein_id="ABB06213.1"
FT                   /translation="MIGKFAWLSVASLLVAACGDRSGLADAASNAQSAAASATPAVAGQ
FT                   GGGSEKIPVPVPPRPGRVLEGIYQKDAHGEDTMEIANGSQASYWYGHAFDLNGNHYFTG
FT                   FAYDTPNKYAEQEKTAAPAPDARVTLTEATFEWTTDGGVAGWNMVESERSIGEFGGYEK
FT                   ADTIDDREPAVSTTTPDGQIVLAVPTWYLASGTRIKSFSLFVYQRTNASSNPDDTDWTY
FT                   AGNVSRGNENGAACDADGTGNHVPCVTGSSTLTFVSTDRRDWPRVRVAMKGTGIDHAGQ
FT                   KKTYGAADVVEYRFNPKTKIYEAEKT"
FT   gene            complement(750154..750507)
FT                   /locus_tag="Bcep18194_C7170"
FT   CDS_pept        complement(750154..750507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7170"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06214"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV2"
FT                   /protein_id="ABB06214.1"
FT                   /translation="MCNSYERKRVACARCQRISSVTAKAGNDARQRRRWMIYLPIVVII
FT                   VDWRNATRVERVRARLPSPYWRRQRQMKTMKSVNKMLPAQRFALPRQIRLPAYAAHAVM
FT                   PSAFLADYDTRCR"
FT   gene            complement(750798..755153)
FT                   /locus_tag="Bcep18194_C7171"
FT   CDS_pept        complement(750798..755153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7171"
FT                   /product="Hemagluttinin/Autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7171"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06215"
FT                   /db_xref="GOA:Q39MV1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV1"
FT                   /protein_id="ABB06215.1"
FT                   /translation="MKRKQISALAAAMFTGAGVLISGAAHADNFVDRGNPDNALSGQCI
FT                   DGTNPLCVSTKSGTYAAVSSTNVTMGTNARAGTSGIAIGDQSNAASKGGTSSGGSIAVG
FT                   VGAQALANSATAIGTVAVAQGNTALAIGRQSAAVGDFSMAVGNVADARGTSSIALGHSA
FT                   LASGDRSVAIGGANPTTSDGVSAGASYDAATQTRAGGTQSVAIGAGAQTNDNNQVAIGS
FT                   GSAGANNGGTPVFGGTAAPVGGAVSFGAIGKERQLKNVAAGAADTDAVNVQQLKNVNGT
FT                   LSTSIATVDARVTSVGNSLSTTISNVDQRVTNVGNSLSTSIVTATKNVVKYTDDSHAAI
FT                   ALDGSNGTTINGVAAGVADTDAVNVGQLKGTVAPLQTSISTAASNITNLQTSVTGINTS
FT                   LSTATTNISNLQAADARNVKYDGQSGFDSVTFAGTNGTTLHNVAAGVANTDAVNVGQLT
FT                   GGLSSLSTSVTNNISTTLGSLSTSINNQIGNATKNAVQYDDDAHSGVTLGGKGAQSPVA
FT                   LHNVADGVATGDAVNVGQLGKATDTLNQSITNVGNSVTTLGNQVTTNTGNIAALQQDAL
FT                   LWNTNLGAYDASHGGNGPQRIGNVAAGVADTDAVNVGQLTSTVAPLQTSISTAASNITN
FT                   LQGNVTSINTSLSTATTNISDLKAADARNVKYDGQSGFDSVTFAGTNGTTLHNVAAGVA
FT                   NTDAVNVGQLNGGLSSLSTSVTNNINTTLGSLSTSINNQIGNATKNAVQYDDDAHSGVT
FT                   LGGKGAQSPVALHNVADGVATGDAVNVGQLGKATDTLNQSITNVSNSVTTLGNQVTTNT
FT                   GNIAALQQDALQWNANLGTYDASHGGNGPQRIGNVAAGKNGTDAVNVDQLNAAIQDGTS
FT                   QLDALAVKYDDASKKQVSLGGGNGASPVRLTNVAEGNVAAGSTDAVNGAQLRRATDGTA
FT                   AALGGGATANPDGSITAPAYKVGGGSFNNVGDALTNLDGRVGSNTTTLENHETRIGNAE
FT                   TNIAGNTAAIAGLQQDALQFDPKAGAYNAARGGAPTKLTNVADGNIAAGSTDAVNGGQL
FT                   SGVKSSLEQQITQVSNQAGEAVKNVVKYDVDTNGNRLNSVSLIGGDTNAAVVLKNVAAG
FT                   TDDTDAVNVKQLKGVQSSLNQLGALAVQYDDSSKSSITLGGAGGTRITNVQAGALSATS
FT                   TDAVNGSQLYATNQQVAKNTTDITNLQGNVTNIANGKAGLVQQQDPNGAITVGKDTGGS
FT                   SVNFSGTAGDRVLTGVAAGVNENDAVNMGQFNNALKNAAANDQIRAAATDANTTWIARA
FT                   DAGSIGSTATATGKNAVAVGQGSVADRDNSFSVGAKGSERQVTNVAAGTAPTDAVNVQQ
FT                   LNDNLSAASNQAKGYTDQRIGQVYNSFNDLKKDMYGGVASAMAVAGLPQPTGAGRSMVS
FT                   AATSNYHGQQGFAAGYSYVTESNRWVVKASVTGNTRSDFGAVVGAGYQF"
FT   gene            755532..755774
FT                   /locus_tag="Bcep18194_C7172"
FT   CDS_pept        755532..755774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7172"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06216"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MV0"
FT                   /protein_id="ABB06216.1"
FT                   /translation="MRDGHAFGVTSIDALGPESHNVRPNPPCLVLLGATLHSKFGRIMR
FT                   HDRKLLKATFFIDCKIQYIQCVTLKIRISQTISRH"
FT   gene            756289..757095
FT                   /locus_tag="Bcep18194_C7173"
FT   CDS_pept        756289..757095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7173"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7173"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06217"
FT                   /db_xref="GOA:Q39MU9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU9"
FT                   /protein_id="ABB06217.1"
FT                   /translation="MHPSISALGDAHILIVDDQPDQLRLLIDILRGTGCRISIASDGLQ
FT                   ACQRAQALTPDLILMDVRMPRMDGFTACRLLAADPLTCAIPVIFLTVAGALHERLEGFE
FT                   IGCVDYVVKPFEPAEVLARIRVQIAREKRERPVDMESPFVAGKDDDIIVRAAIRHLART
FT                   LNDPPTVEQLARAVGTHEKRLSRAFRDNLGQTVFEYLRHERLRIAQDLLDSTSLSIASI
FT                   AKEIGFSTPANFATAFRERFGLTPTEWRRQRHAGERTARREPQRDA"
FT   gene            complement(757117..759306)
FT                   /locus_tag="Bcep18194_C7174"
FT   CDS_pept        complement(757117..759306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7174"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7174"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06218"
FT                   /db_xref="GOA:Q39MU8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU8"
FT                   /protein_id="ABB06218.1"
FT                   /translation="MVRTGTARRARAIAAGSALVAAATGGAHAQASGAAATPPAGAAAA
FT                   VLPTIDVTGKADGASSGLVGLRTTAGTKTDTPVAEIPQTINLVTAQQIEMTGAADLNQA
FT                   LRYVPGFATFGADSRTDWYAALRGFTPTLYVDGVAAPNTAVIANWRVDPYTIDSIAVLR
FT                   GPTSVLYGAGEPGAIVDAHTKLADGERVREAGVQIGNDARKQFMVDVGDTLDPDGRYAY
FT                   RFVGVARDGNAVTGPNGDRRVALAPSFRWRPNADTSLTLSATFLQDSGDISSNFLPASG
FT                   TVLPNPNGRLSQDIYMGAPGFNDYRKKQWSLGYALEHRVNAIWSLHQDVRWSHLSLDDA
FT                   TVFGIGLVPRSTTNMMRFAGLFQLNYSRLDIDNHAQARFGTGPLEHTLLLGVQYDRQTT
FT                   TNSVWLALAPSLNLYHPVYRPVTDAIFSGPTSLGHVDQYTAMNAFGVYAQDQIRWKRWT
FT                   LTLGGREDFVNARFDDRTAGTQAQQDVSAFSGRVGLTYQGDAGLSPYLSYSTSFDPVIG
FT                   VRMFGGGLPKPTRGKQTEAGLRWQPPGKNLMLSAAVYQIDQTNVVTPTPVNLDPTGTTS
FT                   VQTGKVRSRGIELSAVGKVTRELSVVASYVYQDVKNVQANDASLNNWPVSVPLPRQMAS
FT                   MWADWTWRTGALSGLGIGGGVRYQSASAGAPDNSLTVPSVTLVDLALHYEMPHWRFALN
FT                   VANLFDRSYVSGCQSYAVCVFGNERTVLATAKYNW"
FT   gene            759747..760718
FT                   /locus_tag="Bcep18194_C7175"
FT   CDS_pept        759747..760718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7175"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06219"
FT                   /db_xref="GOA:Q39MU7"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU7"
FT                   /protein_id="ABB06219.1"
FT                   /translation="MPRLPIRPLCAALLAVSALLCAMPPARACDIPAAVTTIDPPGYYD
FT                   DDAGYARAVKPMRDFIARLNASANKGDWSCAVSLLESWARADALMGPITGYQGDYERSW
FT                   AGTDFAMVILRMPRDVRDANRARFDAIDPWLERIAIATRDAAAINHLHNNLVYWAGLDL
FT                   IAIGTVTGNTSLVDSGLLRVREGIRDIGPDGSLAREVKRGDRALHYHTFALLPLVFAAE
FT                   LVQRRHIDLYRESDGAIGRLANLVIDAVDNPASFTAITPVRQDLFPWTFRDELSWVEPY
FT                   YARFHDARLPAIIASRRPFTEWRLGGDVTAVWGAPLPQRIGE"
FT   gene            complement(760735..761802)
FT                   /locus_tag="Bcep18194_C7176"
FT   CDS_pept        complement(760735..761802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7176"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7176"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06220"
FT                   /db_xref="GOA:Q39MU6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU6"
FT                   /protein_id="ABB06220.1"
FT                   /translation="MHGASAIEHDGRTSMAQFSGTGWLPDTACFNHDNLLLQSNDVDEV
FT                   RARVADVFKPHRLTPTGESRALHSCMHHARWGNLSLNLLDYGGGVSIEPGPLEHFFLLQ
FT                   IPLRGDAEIECGSARFVSSPGTASLISPTLPLKMRWGDACPQVILRIEREVMERHAQRH
FT                   FGDDRRAPVEFEPEFSLSSSQGTCLAQMLPILAGAIATDAHPLRHPLAFEPLESTLLNL
FT                   LLHGHPNSARNGTRHLPVALAPFYVRRVEDYIRAHLDEPLTIERLAELAGVSPSTLFAG
FT                   FRHRHGITPMGFVRQLRLQHVREELLADASPGHASVTDIALKWGFAHLGRFAIEYKRAF
FT                   GESPSATLRMRRVRG"
FT   gene            762112..763359
FT                   /locus_tag="Bcep18194_C7177"
FT   CDS_pept        762112..763359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7177"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7177"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06221"
FT                   /db_xref="GOA:Q39MU5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU5"
FT                   /protein_id="ABB06221.1"
FT                   /translation="MQGRHIEIPSPDGGTFRAYLSTPAAGKGPGIVLCHEIFGANATMR
FT                   EAADYYAEEGYTVLVPDLFWRQAPGVELGYTATDMERAMALYREYDENKGVEDVGAALD
FT                   ALKQLPACTGEAGVLGYCLGGKLAYLAACRLPGVAAAVSYYGVGIEQALDEASHLHGRL
FT                   VLQIAGQDRFCPPDAQQRIADALAGRDGVEVYMYPGVDHAFARIGGDHFDKAAAIMAHQ
FT                   RAIAAFRAALGPRYDLSTLWEAHLKHEFDTRNVDATMATMVAEPYVNHIPTLTGGVGYD
FT                   ALKRFYTHHFVHANPPDTTITPISRTIGASQIVDELLFCFTHTTEIDWMLPGVAPTGKR
FT                   VEIPLVAIVKFRGDKLYHEHIYWDQASVLVQIGLLDPAGLPVAGVETARKLLDETVPSN
FT                   GLMRRWQDSEPSSGTH"
FT   gene            763400..764188
FT                   /locus_tag="Bcep18194_C7178"
FT   CDS_pept        763400..764188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7178"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7178"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06222"
FT                   /db_xref="GOA:Q39MU4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU4"
FT                   /protein_id="ABB06222.1"
FT                   /translation="MTALAGKVAIVTGGATLIGAAVAQDLNRAGACVAILDLDVENGTR
FT                   VADSLGERAMFVALDITDDRAIEHAVAAIVERFGAIDVLVNLACSYVDNGIQATRNDWL
FT                   AAMDVNVVSAAMLAKAVHPHLVRRGGGAIVNFSSISAQCAQTGRWLYPTSKAAIRQLTR
FT                   SMAMDLAPDRIRVNSVSPGWTWSRVMDEMTHGDRAKTDRVAAPFHLLGRVGDPSEVAQV
FT                   VTFLCSDAASFVTGADYAVDGGYAAMGPEQAVPAIPRLAE"
FT   gene            764256..765494
FT                   /locus_tag="Bcep18194_C7179"
FT   CDS_pept        764256..765494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7179"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06223"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041654"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU3"
FT                   /protein_id="ABB06223.1"
FT                   /translation="MRRIAIVGAGQSGLQLAFALLDQGYHVTLATNRDAEQIRTGKVMS
FT                   SQCMFHTSLQIERDLGLNTWEEACPSVEGIGIAVPHPDGNGRKVIDWQSRLTRYAQSVD
FT                   QRVKMADWLDGVRRRGADVRIADIGVPELEELARSHDLVLLAAGKGEIVNLLGRDEARS
FT                   AFDRPQRALALTYVKGMTPSQPYSRVRFNLLPGIGEYFVFPALTTTGPCEIMVFEGIPG
FT                   GPLDCWADVKTPEQHLDRSLSFLQQYVPWEFERCRDVELTDPNGTLAGRFAPTVRKPFF
FT                   RLPSGRTVFGMADAVVVNDPITGQGSNNAAKCAKAYFDAIVARDAAPFGEDWMQQTFEG
FT                   YWAYAQHVVRWTNSLLTPPPPHILELLGAAGQFHSLAAAIVDGFDDPRRFSPWWFEPSA
FT                   CAATIREHSARAE"
FT   gene            765500..766027
FT                   /locus_tag="Bcep18194_C7180"
FT   CDS_pept        765500..766027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7180"
FT                   /product="Flavin reductase-like, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7180"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06224"
FT                   /db_xref="GOA:Q39MU2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU2"
FT                   /protein_id="ABB06224.1"
FT                   /translation="METTATDRPALDPMQLRAAFGQFPTGVTVITTCAPDGRKVGLTAN
FT                   SFSSLSLDPPLVLWSLRKVAPSRPDFVAATHFAINILAHDQIELSRRFATPSADKFDGV
FT                   LHVDSETGGVPCLDGASARFVCRNVGHYEGGDHLLFIGQIEQFDAFGKAPLVFHAGQYR
FT                   AIADHPDLFRTI"
FT   gene            766064..767020
FT                   /locus_tag="Bcep18194_C7181"
FT   CDS_pept        766064..767020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7181"
FT                   /product="protein involved in meta-pathway of phenol
FT                   degradation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7181"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06225"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU1"
FT                   /protein_id="ABB06225.1"
FT                   /translation="MKLGSRVLVVAGLTIAGMAASAPAGATDLPAVNLGMTSFLDGMPP
FT                   AGSGWYGTQYLQYYTAGRVNDNAGNKVGLPKQDIDLFAGLSQLVYQSPLTFAGMHPGLD
FT                   VILPWIASARTDDGIGNVALNARAGFGDLLIGPFIQFDPVMGAQGPRFAQRVEFQFIAP
FT                   TGAYDPSRAINPGSHFWSFDPYWAATLWLTPKWTVSWRLHYLWNATNHQPATSLGPDAT
FT                   STQAGQAIHANFATEYEVRPGLRLGLNGYWLRQTTDMKENGQDVPGTREAVFATGPGAM
FT                   YSFSPQDHLMFNAYFETYARNRPQGTRMVLRYVHHFQ"
FT   gene            767152..768414
FT                   /locus_tag="Bcep18194_C7182"
FT   CDS_pept        767152..768414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7182"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7182"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06226"
FT                   /db_xref="GOA:Q39MU0"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MU0"
FT                   /protein_id="ABB06226.1"
FT                   /translation="MATSATFRFLSNASRRLVHGMVAVAPAVMIGLAVSACGGDSSPTS
FT                   NTPAFANAARPQIDALLADTLTPGAVVYVQSPQGNWLESFGTAVRGTNTPIPTNAHFRV
FT                   GSVTKTWTGTVILQLVQEGRLSLGDSVSKFVANVPNGDTITIEQLLTMRSGLYNYSTNL
FT                   AFNQTLDAQPDMVWTTSELLGIAEGQPVYFPPGTDFRYSNTNTILLGLIIEQLTGMSAA
FT                   DAMNARLFAPLGLANTMLPPQQDTSLPAPAPQGYQWGTNAETTDSDALSPQRQADAKSG
FT                   VLQPTNVTSVNTSWAWTAGSGISTVTELAAYVQRMVGGGYLNADLQAQRLASCTPVDPT
FT                   DPMSASYCLGLAKFGTFYGHTGEIPGFNTFMGYDPVTKTTIVTWSNTAAAPDGRAPANE
FT                   IARIIMGELSKAAEIPDEGRP"
FT   gene            complement(768577..769236)
FT                   /locus_tag="Bcep18194_C7183"
FT   CDS_pept        complement(768577..769236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7183"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7183"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06227"
FT                   /db_xref="GOA:Q39MT9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT9"
FT                   /protein_id="ABB06227.1"
FT                   /translation="MKERNPSIDAQAAPDALKPEERRALLMRMRGHTLARIEKAVLELF
FT                   SGRDFHEVGLADVARAANVSLQTIYKYFGSKEVLVCAMLDVMLGRLAERMIDHLQGIDD
FT                   VRERLRKTCWVTLDYMDKHPSVMLMMFTTMPMSRYKNIGIYESRELMEAFLGVFKDGQA
FT                   RGTLNDKVSSKVLLDVFMGVLGRVMVMHLMRGETRPLTAQFDELFAILWRAMSAGE"
FT   gene            769450..770604
FT                   /locus_tag="Bcep18194_C7184"
FT   CDS_pept        769450..770604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7184"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7184"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06228"
FT                   /db_xref="GOA:Q39MT8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT8"
FT                   /protein_id="ABB06228.1"
FT                   /translation="MAIQNFAPSWMTHEHQMLFDTANRFFKEQWVPRDEAWRQAGMMDR
FT                   HAWEEAGANGFLCASMPEEYGGAGGDFGHEAALILAQGAAGIGGFGGSLHSGIVAPYIL
FT                   RHGTEAQKQRWLPRLATGELIGAIAMTEPGTGSDLQAVRTTAAREGDLYRINGSKTFIT
FT                   NGQLANLVIVVCKTSKDEGAQGMSLLVIETDQASGFRRGRNLDKLGMDAQDTSELFFDD
FT                   VQVPVDNLLGGNEGMGFIQLMQELPQERLIVAVAGIAAMELAMQETLAYTKERQAFGKP
FT                   IFSFQNTRFKLAECQALLMASRALVDAAIVAHLNGELGVDRAALIKYWVTDNQCKLIDE
FT                   CLQFFGGYGYMKEYPIARLYADARVQRIYGGTNEIMKELASRYL"
FT   gene            770652..771857
FT                   /locus_tag="Bcep18194_C7185"
FT   CDS_pept        770652..771857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7185"
FT                   /product="Acetyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7185"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06229"
FT                   /db_xref="GOA:Q39MT7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT7"
FT                   /protein_id="ABB06229.1"
FT                   /translation="MTEAYIFDAVRTPRGKGKKDGSLHQATPVWLLRTLLQALQARSRL
FT                   DTARVDDVVLGCVTPVGEQGADIARTAVLDAGWAQSVAGVTLSRFCASGLEAANLAAAK
FT                   IMSGMEDMVVAGGVESMSRWAMGSDGGAWVMDPRVNSGTGFIPQGISADLVATLEGFGR
FT                   SDLDAFAAESHRRAAHAQAHGYFARSIVPVTDLNGRLLLDRDETVRPGASVESLAPIGA
FT                   AFETMGEMGFDATALDKYTTIEKIHHHHHAGNSSGIVDGAALLLMGSQAAGEQAGLKPR
FT                   ARVRAFAVTGTEPTIMLTGPTPAVRKALAKAGMAASDIDLWEINDAFATVPMKTARDLG
FT                   VSLERVNVNGGSIAMGHPLGATGAILLGTALDELERTGQSTALATLCVGAGMGIATIIE
FT                   RV"
FT   gene            771872..774019
FT                   /locus_tag="Bcep18194_C7186"
FT   CDS_pept        771872..774019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7186"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase / short chain
FT                   enoyl-CoA hydratase"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7186"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06230"
FT                   /db_xref="GOA:Q39MT6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT6"
FT                   /protein_id="ABB06230.1"
FT                   /translation="MTTYTTLSFDVDANGIGLATLDQPGRAMNVLAPALMEEFTRVIGH
FT                   VEQEAGIKGLVITSGKPSFVAGADIDQLSRITSAEQAFQLSEQLKALLRRMETCGKPVV
FT                   AALNGTALGGGLELALACHARFAIDDPKAKIGLPEVKLGLLPGGGGTQRLPRMIGIQKS
FT                   FELITQGIELSPAKALGLGLLNELAATREELLQKARAWCVAHPAPVQPWDTKGFRIPGG
FT                   DSKSPAVVQMLAIAPSIANAKAHGNYPALTHIMSCLFEGCLLDFDTGSQVESRYFAACV
FT                   MSQVSRNLIGTLWYQLNAIKKGQSRPAGMPPAKVKKVGILGAGMMGAGIAYVSAKAGID
FT                   VVLLDTTQENAEKGKAYSQGLLDKALARGKTTQDKRDALLARILPTTRYDDLRGCDLVV
FT                   EAVFEDRAIKADCTTLAEAVIGDDAVFASNTSTLPITGLAHVSRRPAHFIGLHFFSPVD
FT                   KMPLVEIIVGAKTSDETLARGFDYVLQIGKTPIVVNDSRGFYTSRVFATYVMEGIAMLA
FT                   EGVHPRSIEVAGLKAGMPMPPLALQDEVSLGLSLHVTDQTRRDLEAEGKDYPPHPAEAV
FT                   LRKVGLDLGRVGKKAGKGFYDYQGKEKSLWPELTALYPPRADQPAQQELVDRLMFIQAN
FT                   EAARCFEENVVRSVADTNIGSIFGWGFAPHHGGALQFINAMGAQRFVQRARELAAQYGA
FT                   RFEPAAIVVELARAGGRFEDA"
FT   gene            774012..775064
FT                   /locus_tag="Bcep18194_C7187"
FT   CDS_pept        774012..775064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7187"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="5.1.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7187"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06231"
FT                   /db_xref="GOA:Q39MT5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT5"
FT                   /protein_id="ABB06231.1"
FT                   /translation="MHDAALAGGALPPLLSGLRVLDLSRNLPGPFATRMLTDLGASVIK
FT                   VEPPEGDPTRPLAGLFDALNHGKECRTVDFRNDADLDRLRAWTKDADVLLDSFRPGVLQ
FT                   SLGLDGAALHAINPRLTMVSITGYGQRGPWAGKAGHDLNFMAMSGVLDQMRAPTGEPAQ
FT                   SNVQWGDLAGGSAMACIAVLSGVFDAQRTGRGKHLDVSMTHGLHAQLVMPRATGAMLAA
FT                   ALGRRPGAGEDLLNGALPCYGLYATHDGRHLAVGALEFKFWKAACDVFDRPDWAARHWQ
FT                   RGQLPGSSDCVALRVEVERLVASQPLAVWRERFASADACVTPVLTLDEAHAHPLFANHA
FT                   RPQPWAEIGA"
FT   gene            complement(775128..777071)
FT                   /locus_tag="Bcep18194_C7188"
FT   CDS_pept        complement(775128..777071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7188"
FT                   /product="Heavy metal translocating P-type ATPase"
FT                   /EC_number="3.6.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7188"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06232"
FT                   /db_xref="GOA:Q39MT4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT4"
FT                   /protein_id="ABB06232.1"
FT                   /translation="MNSLAEPATQPDAAPAGTTAYALSSDERRTITRQIALALLAGGLL
FT                   VLSFAWRMLSTGGDTLAQLLAALASLIVAGPVFASAWHSLRAPSLHGVTDRLIALAMLA
FT                   AWAIGDMTTAALLPIVMTFGHALEERSVLGSQEAIRALGRLTAGRVRRIGADGSVVEVA
FT                   YDALRSGDRIEVVAGARIPVDGVVVAGTSSVDNGPITGESVPHDVDAGSTVYGGALNLD
FT                   GVLRIDVTHTGKDSTLGKIIALMQHAEQAKPPVTQVLERHMGAYLALVLLIAAIVWFTS
FT                   ANASAMLAVIVAACPCALVLAAPSTAIAGIAVGARHGILFRNAAFLDKIAEVDSLVIDK
FT                   TGTLTRGELQVRQVWLQPGVDGAQTRTLAARLGESSAHPASRALVRDAAASGLTGAAVA
FT                   PFERTRELRGLGVVADTPDGTAVLGRPALLADHVGNLPPAPDGFDGPIVGLALDGRLLA
FT                   WFGFADTLRPDARDALAELRTLGLARQTLLTGDLERVASKVAAETGIETVVAQALPHDK
FT                   LDYVMHEIGAGLHPLVVGDGLNDVLAIKAGSTSIAMGERGVDIAIASADVVLLGDDLKR
FT                   IPTCIRLGRQCRRTATTNAAIGLAWTLAVIALAATGMLGAVWAAILHNVGTFIVIANAG
FT                   RLLRIDEDVRDA"
FT   gene            complement(777068..778111)
FT                   /locus_tag="Bcep18194_C7189"
FT   CDS_pept        complement(777068..778111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7189"
FT                   /product="Membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7189"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06233"
FT                   /db_xref="GOA:Q39MT3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT3"
FT                   /protein_id="ABB06233.1"
FT                   /translation="MSEPSAPPLGPGAQAVRLSFWFVAALAVLAACAWAGSNIRRIPAD
FT                   SRAVVMRFGALVRTQDAGLVIAWPQPFESVLLVPGAARVLEQRIRSLDRDPRALAPSAQ
FT                   GVARLPDALAGSGYVLTGDGGAVALSAVLYYRVSDPYAYVLQRDRLDAALERIVSASAV
FT                   EVAATRDLDAILVARPEQLAADRQMAARRERLRGDLADAIARHLRALDAAHAGLGVEVA
FT                   RVDVQPAFPGAAADAFNAVLTSLQVAERTIAQARTAAEQRRQDAQQDADRIVQDAQAHA
FT                   AERVATAQTDTLEIRQLDATLRENGDPGLLARLYRDRVQRVLSQAGRVTTIDPHDTSNL
FT                   ILPGNAR"
FT   gene            complement(778108..779211)
FT                   /locus_tag="Bcep18194_C7190"
FT   CDS_pept        complement(778108..779211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7190"
FT                   /product="Membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7190"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06234"
FT                   /db_xref="GOA:Q39MT2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT2"
FT                   /protein_id="ABB06234.1"
FT                   /translation="MPCRCTARGRRRTRGDIVSLFHSHAHDHAHHGHGHDHPHHAHHGA
FT                   PQPPGAFRLRVIVAVLCVLVALAVASFVQVRAGEASVITRFGRPVHVLLEPGLAWRLPA
FT                   PIDAVTPVDLRLHTTSSGLQDVGTRDGLRIIVEAYVAWRVPADARDIGRFMRAVGNEPD
FT                   EAARQIRSLVGSALQTTSAGYDLASLVNTDPAQVKIGEFEEALRRQIDAQLYAAYGVRV
FT                   AQVGLERLTLPAVTLAATVDRMSAERETVAAQRTADGNREAAQIRSDAERDARIALADA
FT                   NVKAAGIEAQSRKDAADIYGKSYAGNPHLYTMLRSLDTLNTVVGTNTNLILRTDAAPFR
FT                   VLVQGPGDASAQAAPAPKASSAHKAAR"
FT   gene            complement(779254..781149)
FT                   /locus_tag="Bcep18194_C7191"
FT   CDS_pept        complement(779254..781149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7191"
FT                   /product="Membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7191"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06235"
FT                   /db_xref="GOA:Q39MT1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT1"
FT                   /protein_id="ABB06235.1"
FT                   /translation="MGQQAEGNDDIPGSPAGRDALAPVAGAAALLVATLGTLGAVDLLP
FT                   ADLRWCAPLASAWCNVLVVAIGVLLAGRARRHSPEISAAALIGDWVRNAFSRKHEPEHD
FT                   DNPWPAIAAAIDWRPWAVAGGGVLSVALAALAWQPPSPAMLVRAMASPEPTLAAGAACL
FT                   VLAFLTLVAERHHAAAASRSAVSASLTRVLRVALVTALAGVLAAAWFAFRHRTADWLVQ
FT                   AVALFNAAVAAELALRGVLSWFAGPRGAVVPTSAIAGLLSRRPSPFASLGAELRHRYGI
FT                   DLRQSWGWRSFVRLLPGALAATVACAWLLTAVVVLNPEQRAVYERFGAPVSVWQPGLHV
FT                   GLPWPFGRARIVDNGAVHQVAIAGSANDGSADTTPVPADGPTPERLDRLWDVPHPWETT
FT                   QVIAGANGDRQNFQIVNADVRVDYRLGLTDAAARAALYRTIDPESTVRTSANRELVHYL
FT                   ASHTLESLLETNQAAMADQLKRAIQQQLDRLQSGVDVIAVVIESVHPPTGAAAAFHDVQ
FT                   AAQIRAQGSVAQARGFAAGLLGNAQQQALERVAHAEAQAGDTVSSARVQQIDFDADLVA
FT                   YRLGGPAFPFEYYLDRLQRGLRNARMTIIDDRLADGTRATVDLRNSPAGDLAGIH"
FT   gene            complement(781449..781682)
FT                   /locus_tag="Bcep18194_C7192"
FT   CDS_pept        complement(781449..781682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7192"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06236"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MT0"
FT                   /protein_id="ABB06236.1"
FT                   /translation="MGCGDHRDDHPGRVSDRQVVRAQGRARPESQPEVRTRHHGCQARR
FT                   ADRWRRAELLPAHCRPRSRNTASTLRRRQGRF"
FT   gene            complement(782236..783210)
FT                   /locus_tag="Bcep18194_C7193"
FT   CDS_pept        complement(782236..783210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7193"
FT                   /product="putative Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7193"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06237"
FT                   /db_xref="GOA:Q39MS9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS9"
FT                   /protein_id="ABB06237.1"
FT                   /translation="MQNLSVVQAVMLGGLFIFVAGGVLIAMLLFAPRSIQRRLQQAGGA
FT                   GATGAAGTGDGDDMASRWVAKLVELSTPISKLSVPKEGWENSPLRIRLMNAGWRNQSAA
FT                   ALYFTAKTALALGLPCAALLVLITTSLGDERAILSAILVAFAGIGYYIPNIVLSQRVKV
FT                   RQQKIFEDFPDALDLLTVCVEAGLGLDAALMKVSEELRFSSEVVASELDLLLLEMRSGF
FT                   TKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESLRVLSDMLRTRRRMRAEERAA
FT                   KIALKLLFPLIFCIFPALMLVLLGPAMIHVYRVLLPTFVGIAP"
FT   gene            complement(783247..784224)
FT                   /locus_tag="Bcep18194_C7194"
FT   CDS_pept        complement(783247..784224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7194"
FT                   /product="Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7194"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06238"
FT                   /db_xref="GOA:Q39MS8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS8"
FT                   /protein_id="ABB06238.1"
FT                   /translation="MNTIFYGFVILTFVAVVLAIEGGYQWWNARHGSAARRIESRIRSM
FT                   SAGGNVQQERLSILKKRMLDESKPFDRLLLRLPRVHRLDLVIQQSGLDWTLPKLIMLSV
FT                   VFAAFAWVALSFATLPQLAALPVALFAGCVPMMYVMRCRGKRMRKLERQLPDICDMISR
FT                   ALRSGHSFTSTLGMVGDEFPDPMGGEFRVTFDEVNYGVSLHDALMNLATRVPVQDLRYF
FT                   VIAVLIQRETGGNLAELLDCISALIRERFKLFDKVRVLSAEGRLSAWILGLLPFGTAAV
FT                   MALLNREFLSVLWEDPAGIRMVGGMLVSMLFGLFWIRRIVRIRV"
FT   gene            complement(784258..785625)
FT                   /locus_tag="Bcep18194_C7195"
FT   CDS_pept        complement(784258..785625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7195"
FT                   /product="Flp pilus assembly protein ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7195"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06239"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS7"
FT                   /protein_id="ABB06239.1"
FT                   /translation="MSLREQMSLHRAQPLAAGSEPASPAHSSVRDAYQKLRREIHLAVL
FT                   ERVELERLSRMPQESVRMEIGLLITRILDEERLPANDIERRQLAIDVYDEMFGFGPLEA
FT                   LLRDPSISDILVNTYRQVYVERFGQLELTDVTFYDDAHLMKVIEKIVSRVGRRIDESSP
FT                   MVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVRYHSLTPPMAELLDALS
FT                   RAKINVLVSGGTGSGKTTLLNILSGYIPRNERIVTIEDAAELQLQQPHVLRLETRPPNI
FT                   EGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATIHANTPRDA
FT                   LTRLENMISVSGLTLPPKTMRQQIASAISVVVQAARLTDGRRKIVSIQELTGMEGDIIN
FT                   MQEIFTFKRMGVDRDGTVRGHFCATGVRPKFVERLQAFGINLPDSLYDPSQRYETN"
FT   gene            complement(785644..786852)
FT                   /locus_tag="Bcep18194_C7196"
FT   CDS_pept        complement(785644..786852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7196"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7196"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06240"
FT                   /db_xref="GOA:Q39MS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS6"
FT                   /protein_id="ABB06240.1"
FT                   /translation="MINILVASDDTARLTQIARLVADCGRYRATRATGRPSQIEHRTDG
FT                   LDAFDILLVDGTSLDPSELAAIERICRAHAGLTCILVTADPSPHVLLDAMRAGARDVLQ
FT                   WPLDTQALGNALERAAAQSTRRDTDDTRIVSFMSCKGGAGTSFAASNIAFEIAEGFKRR
FT                   VLLIDLNQQFADAAFLVSDETPPSTLPQLCAQIERLDSAFLDASVAHVTENFHVLAGAG
FT                   DPVKAAEMREDALEWILGVAAPRYDFVIFDVGVCINPLSMVALDRSDQIQLVLQPAMPH
FT                   VRAGRRLLEILVSLGYSTDQMRLIVNRATRASDRTRTALEEVLGLQAACTIPEDADTVL
FT                   EAINQGHPVSRLARGTAVVRALQGCAKQLVDGEVRAGHSAASSEPLMSRLFGRKATPKL
FT                   KSM"
FT   gene            complement(786875..787318)
FT                   /locus_tag="Bcep18194_C7197"
FT   CDS_pept        complement(786875..787318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7197"
FT                   /product="TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7197"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06241"
FT                   /db_xref="GOA:Q39MS5"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS5"
FT                   /protein_id="ABB06241.1"
FT                   /translation="MSARHVPLSRRRTQRGAAIVEFALIASVLIMLLIGIFEFGRVLFY
FT                   WSTASEAVRLGARTAVVCDVNAAGVVKRVRSLLPLLSNANVSVNYSPASCDVNSCAFVT
FT                   VSVTNVTVKTMIPFVNVTVTMPPFTTTLPRESLTSATGGANCN"
FT   gene            complement(787315..787848)
FT                   /locus_tag="Bcep18194_C7198"
FT   CDS_pept        complement(787315..787848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7198"
FT                   /product="TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7198"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06242"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS4"
FT                   /protein_id="ABB06242.1"
FT                   /translation="MKKPPIRRSRARGAVAVEFALVLMPMIMLATGVAEFGRAIYQFET
FT                   LTKATRDAARYLSVWLPTDSAYPVSQAQCLVVYGSTTCGASGTELVPGLTTSMVTICDA
FT                   QRTTGCSDGSDPSQFANLPTYDANNNAASGTATGAINVVEVKIKGYKYQPIPAFPGLPS
FT                   ITFNNIVTVMRQVS"
FT   gene            complement(787861..789132)
FT                   /locus_tag="Bcep18194_C7199"
FT   CDS_pept        complement(787861..789132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7199"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06243"
FT                   /db_xref="GOA:Q39MS3"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS3"
FT                   /protein_id="ABB06243.1"
FT                   /translation="MNSAARHPKVMRRSLHRQRGAVAIIVGLSLAVMIGFVGLALDLGK
FT                   LYVTRSELQNSADACALSAARDLTSAISLSVAEADGIAAGHLNFVFFQNKSVQMSTNAN
FT                   VTFSDSLTDPFLTRSAVTTPSSIKYVQCTATLSNIAHWFIEVLNVLPGTKLANAAEVSA
FT                   SAIATVGGGQTTCAIPVFVCRATGSPSYNVGDWITSLSGSSTTYGPGNFGWAALDGSTN
FT                   EPTIASELSGNTCNITSPPDLGSTGLKSASLRAWNTRFGIYTNGANGSSGQPDFTGYAY
FT                   VGPNYGPPGTAGIKGDAYTQFVTDRTTFKPYQGDGAPPSGSGIATNGTVTASTYQTTGG
FT                   DRRVALAPEGDCSTLNGASGKVHVTQWDCVLMLDPVPFSPGKGGIVAHLEYLGSSVSGN
FT                   NPCATHGLPGSGSASGTQVPMLVQ"
FT   gene            complement(789158..789484)
FT                   /locus_tag="Bcep18194_C7200"
FT   CDS_pept        complement(789158..789484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7200"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06244"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS2"
FT                   /protein_id="ABB06244.1"
FT                   /translation="MKPSKGTLMKSAYLVIARRMALAAPLAFALAGCMSSTPVWDTRFG
FT                   DSVRAVTQAQIIDPHAAEHAASVSAPGVDGGAATAALDNYDKSFKQTVPPANAFVIGIG
FT                   KATQ"
FT   gene            complement(789481..791439)
FT                   /locus_tag="Bcep18194_C7201"
FT   CDS_pept        complement(789481..791439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7201"
FT                   /product="Flp pilus assembly protein secretin CpaC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7201"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06245"
FT                   /db_xref="GOA:Q39MS1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS1"
FT                   /protein_id="ABB06245.1"
FT                   /translation="MKIKPQCTGTGPLRTRVARGTMMAAILCSGWLTVYGALAQEGIES
FT                   AVLTKGGASAPAAVGKGPMQMTISMAPVAAAAPAASAGPLRGPNCVGAVRESTSVSVPL
FT                   GKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGRSGACRVIDV
FT                   AVGADAGGLQASLMQLMPNERDIHVSTAAGTIVLAGTVSSSMAAQQAMQIARAYGDSAG
FT                   DPAGGGKAGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSALNIQGGFGSWSGALV
FT                   SNLLAGVATGIAFSKANNKPFNLAADAQNTDNLVKILAEPNLVTISGQEATFLAGGKIF
FT                   IPIPQSSGNGTSSITLQEEEFGVALKFTPTVLSNGRISLKVAPEVSELSQTGVTLSATN
FT                   IGGTSILPLITTRRASTTVQMGDGETFAIGGLIKDNGTGALKALPGVGEIPVLGALLRS
FT                   TSFQQDRTELIFVITPHLVKPLQTADVPLPTDSFSKPNEVDVYATGNMEGRGGVRKPGA
FT                   QPANGAAAAPQNPAQAPAPVPAPAPAPAPQSEAPAGPAAALPAPRAPQGADAQPPVPAE
FT                   PQKTPAPVAAAAPQHDAAGAANAARIARIEAAAARLAATGPDTPAQPAGQPKRRTPAEP
FT                   HAQQVARVSAAPESTDR"
FT   gene            complement(791539..792378)
FT                   /locus_tag="Bcep18194_C7202"
FT   CDS_pept        complement(791539..792378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcep18194_C7202"
FT                   /product="Flp pilus assembly CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcep18194_C7202"
FT                   /db_xref="EnsemblGenomes-Tr:ABB06246"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q39MS0"
FT                   /protein_id="ABB06246.1"
FT                   /translation="MKNSRAVMMLVVAMVAGLAAVVFASHWLVQTSTSSVTPVAVATTD
FT                   LNLGEPLGPNQIHMVSWPSGSVPTGAFTDTKGLEGRVVRTSLSRGEPVIESKLAPVGTK
FT                   GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEH
FT                   ILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLN