(data stored in ACNUC7421 zone)

EMBL: CP000153

ID   CP000153; SV 1; circular; genomic DNA; STD; PRO; 2201561 BP.
XX
AC   CP000153; AAJA01000000-AAJA01000003;
XX
PR   Project:PRJNA13019;
XX
DT   02-NOV-2005 (Rel. 85, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Sulfurimonas denitrificans DSM 1251, complete genome.
XX
KW   .
XX
OS   Sulfurimonas denitrificans DSM 1251
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Helicobacteraceae; Sulfurimonas.
XX
RN   [1]
RP   1-2201561
RX   DOI; 10.1128/AEM.01844-07.
RX   PUBMED; 18065616.
RA   Sievert S.M., Scott K.M., Klotz M.G., Chain P.S., Hauser L.J., Hemp J.,
RA   Hugler M., Land M., Lapidus A., Larimer F.W., Lucas S., Malfatti S.A.,
RA   Meyer F., Paulsen I.T., Ren Q., Simon J., USF Genomics Class;
RT   "Genome of the epsilonproteobacterial chemolithoautotroph Sulfurimonas
RT   denitrificans";
RL   Appl. Environ. Microbiol. 74(4):1145-1156(2008).
XX
RN   [2]
RP   1-2201561
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Kyrpides N., Lykidis A.,
RA   Richardson P.;
RT   "Complete sequence of Sulfurimonas denitrificans ATCC 33889";
RL   Unpublished.
XX
RN   [3]
RP   1-2201561
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Kyrpides N., Lykidis A.,
RA   Richardson P.;
RT   ;
RL   Submitted (11-OCT-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2400 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-2201561
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Kyrpides N., Lykidis A.,
RA   Richardson P.;
RT   ;
RL   Submitted (13-NOV-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2400 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 432e2a7fad82391c79df19000e89a3ed.
DR   BioSample; SAMN02598289.
DR   CABRI; DSM 1251.
DR   EnsemblGenomes-Gn; EBG00001018671.
DR   EnsemblGenomes-Gn; EBG00001018672.
DR   EnsemblGenomes-Gn; EBG00001018673.
DR   EnsemblGenomes-Gn; EBG00001018674.
DR   EnsemblGenomes-Gn; EBG00001018675.
DR   EnsemblGenomes-Gn; EBG00001018676.
DR   EnsemblGenomes-Gn; EBG00001018677.
DR   EnsemblGenomes-Gn; EBG00001018678.
DR   EnsemblGenomes-Gn; EBG00001018679.
DR   EnsemblGenomes-Gn; EBG00001018680.
DR   EnsemblGenomes-Gn; EBG00001018681.
DR   EnsemblGenomes-Gn; EBG00001018682.
DR   EnsemblGenomes-Gn; EBG00001018683.
DR   EnsemblGenomes-Gn; EBG00001018684.
DR   EnsemblGenomes-Gn; EBG00001018685.
DR   EnsemblGenomes-Gn; EBG00001018686.
DR   EnsemblGenomes-Gn; EBG00001018687.
DR   EnsemblGenomes-Gn; EBG00001018688.
DR   EnsemblGenomes-Gn; EBG00001018689.
DR   EnsemblGenomes-Gn; EBG00001018690.
DR   EnsemblGenomes-Gn; EBG00001018691.
DR   EnsemblGenomes-Gn; EBG00001018692.
DR   EnsemblGenomes-Gn; EBG00001018693.
DR   EnsemblGenomes-Gn; EBG00001018694.
DR   EnsemblGenomes-Gn; EBG00001018695.
DR   EnsemblGenomes-Gn; EBG00001018696.
DR   EnsemblGenomes-Gn; EBG00001018697.
DR   EnsemblGenomes-Gn; EBG00001018698.
DR   EnsemblGenomes-Gn; EBG00001018699.
DR   EnsemblGenomes-Gn; EBG00001018700.
DR   EnsemblGenomes-Gn; EBG00001018701.
DR   EnsemblGenomes-Gn; EBG00001018702.
DR   EnsemblGenomes-Gn; EBG00001018703.
DR   EnsemblGenomes-Gn; EBG00001018704.
DR   EnsemblGenomes-Gn; EBG00001018705.
DR   EnsemblGenomes-Gn; EBG00001018706.
DR   EnsemblGenomes-Gn; EBG00001018707.
DR   EnsemblGenomes-Gn; EBG00001018708.
DR   EnsemblGenomes-Gn; EBG00001018709.
DR   EnsemblGenomes-Gn; EBG00001018710.
DR   EnsemblGenomes-Gn; EBG00001018711.
DR   EnsemblGenomes-Gn; EBG00001018712.
DR   EnsemblGenomes-Gn; EBG00001018713.
DR   EnsemblGenomes-Gn; EBG00001018714.
DR   EnsemblGenomes-Gn; EBG00001018715.
DR   EnsemblGenomes-Gn; EBG00001018716.
DR   EnsemblGenomes-Gn; EBG00001018717.
DR   EnsemblGenomes-Gn; EBG00001018718.
DR   EnsemblGenomes-Gn; EBG00001018719.
DR   EnsemblGenomes-Gn; EBG00001018720.
DR   EnsemblGenomes-Gn; EBG00001018721.
DR   EnsemblGenomes-Gn; EBG00001018722.
DR   EnsemblGenomes-Gn; EBG00001018723.
DR   EnsemblGenomes-Gn; EBG00001018724.
DR   EnsemblGenomes-Gn; EBG00001018725.
DR   EnsemblGenomes-Gn; EBG00001018726.
DR   EnsemblGenomes-Gn; EBG00001018727.
DR   EnsemblGenomes-Gn; EBG00001018728.
DR   EnsemblGenomes-Gn; EBG00001018729.
DR   EnsemblGenomes-Gn; EBG00001018730.
DR   EnsemblGenomes-Gn; EBG00001018731.
DR   EnsemblGenomes-Gn; EBG00001018732.
DR   EnsemblGenomes-Gn; EBG00001018733.
DR   EnsemblGenomes-Gn; EBG00001018734.
DR   EnsemblGenomes-Gn; EBG00001018735.
DR   EnsemblGenomes-Gn; EBG00001018736.
DR   EnsemblGenomes-Gn; EBG00001018737.
DR   EnsemblGenomes-Gn; EBG00001018738.
DR   EnsemblGenomes-Gn; Suden_R0001.
DR   EnsemblGenomes-Gn; Suden_R0002.
DR   EnsemblGenomes-Gn; Suden_R0003.
DR   EnsemblGenomes-Gn; Suden_R0004.
DR   EnsemblGenomes-Gn; Suden_R0005.
DR   EnsemblGenomes-Gn; Suden_R0007.
DR   EnsemblGenomes-Gn; Suden_R0008.
DR   EnsemblGenomes-Gn; Suden_R0009.
DR   EnsemblGenomes-Gn; Suden_R0010.
DR   EnsemblGenomes-Gn; Suden_R0011.
DR   EnsemblGenomes-Gn; Suden_R0012.
DR   EnsemblGenomes-Gn; Suden_R0013.
DR   EnsemblGenomes-Gn; Suden_R0014.
DR   EnsemblGenomes-Gn; Suden_R0015.
DR   EnsemblGenomes-Gn; Suden_R0016.
DR   EnsemblGenomes-Gn; Suden_R0017.
DR   EnsemblGenomes-Gn; Suden_R0018.
DR   EnsemblGenomes-Gn; Suden_R0019.
DR   EnsemblGenomes-Gn; Suden_R0020.
DR   EnsemblGenomes-Gn; Suden_R0021.
DR   EnsemblGenomes-Gn; Suden_R0022.
DR   EnsemblGenomes-Gn; Suden_R0023.
DR   EnsemblGenomes-Gn; Suden_R0024.
DR   EnsemblGenomes-Gn; Suden_R0025.
DR   EnsemblGenomes-Gn; Suden_R0026.
DR   EnsemblGenomes-Gn; Suden_R0027.
DR   EnsemblGenomes-Gn; Suden_R0028.
DR   EnsemblGenomes-Gn; Suden_R0029.
DR   EnsemblGenomes-Gn; Suden_R0030.
DR   EnsemblGenomes-Gn; Suden_R0031.
DR   EnsemblGenomes-Gn; Suden_R0032.
DR   EnsemblGenomes-Gn; Suden_R0033.
DR   EnsemblGenomes-Gn; Suden_R0034.
DR   EnsemblGenomes-Gn; Suden_R0035.
DR   EnsemblGenomes-Gn; Suden_R0036.
DR   EnsemblGenomes-Gn; Suden_R0037.
DR   EnsemblGenomes-Gn; Suden_R0038.
DR   EnsemblGenomes-Gn; Suden_R0039.
DR   EnsemblGenomes-Gn; Suden_R0040.
DR   EnsemblGenomes-Gn; Suden_R0041.
DR   EnsemblGenomes-Gn; Suden_R0042.
DR   EnsemblGenomes-Gn; Suden_R0044.
DR   EnsemblGenomes-Gn; Suden_R0045.
DR   EnsemblGenomes-Gn; Suden_R0046.
DR   EnsemblGenomes-Gn; Suden_R0047.
DR   EnsemblGenomes-Gn; Suden_R0048.
DR   EnsemblGenomes-Gn; Suden_R0049.
DR   EnsemblGenomes-Gn; Suden_R0050.
DR   EnsemblGenomes-Gn; Suden_R0051.
DR   EnsemblGenomes-Gn; Suden_R0052.
DR   EnsemblGenomes-Gn; Suden_R0053.
DR   EnsemblGenomes-Gn; Suden_R0054.
DR   EnsemblGenomes-Gn; Suden_R0055.
DR   EnsemblGenomes-Gn; Suden_R0056.
DR   EnsemblGenomes-Gn; Suden_R0057.
DR   EnsemblGenomes-Gn; Suden_R0058.
DR   EnsemblGenomes-Gn; Suden_R0059.
DR   EnsemblGenomes-Gn; Suden_R0060.
DR   EnsemblGenomes-Tr; EBT00001622002.
DR   EnsemblGenomes-Tr; EBT00001622003.
DR   EnsemblGenomes-Tr; EBT00001622004.
DR   EnsemblGenomes-Tr; EBT00001622005.
DR   EnsemblGenomes-Tr; EBT00001622006.
DR   EnsemblGenomes-Tr; EBT00001622007.
DR   EnsemblGenomes-Tr; EBT00001622008.
DR   EnsemblGenomes-Tr; EBT00001622009.
DR   EnsemblGenomes-Tr; EBT00001622010.
DR   EnsemblGenomes-Tr; EBT00001622011.
DR   EnsemblGenomes-Tr; EBT00001622012.
DR   EnsemblGenomes-Tr; EBT00001622013.
DR   EnsemblGenomes-Tr; EBT00001622014.
DR   EnsemblGenomes-Tr; EBT00001622015.
DR   EnsemblGenomes-Tr; EBT00001622016.
DR   EnsemblGenomes-Tr; EBT00001622017.
DR   EnsemblGenomes-Tr; EBT00001622018.
DR   EnsemblGenomes-Tr; EBT00001622019.
DR   EnsemblGenomes-Tr; EBT00001622020.
DR   EnsemblGenomes-Tr; EBT00001622021.
DR   EnsemblGenomes-Tr; EBT00001622022.
DR   EnsemblGenomes-Tr; EBT00001622023.
DR   EnsemblGenomes-Tr; EBT00001622024.
DR   EnsemblGenomes-Tr; EBT00001622025.
DR   EnsemblGenomes-Tr; EBT00001622026.
DR   EnsemblGenomes-Tr; EBT00001622027.
DR   EnsemblGenomes-Tr; EBT00001622028.
DR   EnsemblGenomes-Tr; EBT00001622029.
DR   EnsemblGenomes-Tr; EBT00001622030.
DR   EnsemblGenomes-Tr; EBT00001622031.
DR   EnsemblGenomes-Tr; EBT00001622032.
DR   EnsemblGenomes-Tr; EBT00001622033.
DR   EnsemblGenomes-Tr; EBT00001622034.
DR   EnsemblGenomes-Tr; EBT00001622035.
DR   EnsemblGenomes-Tr; EBT00001622036.
DR   EnsemblGenomes-Tr; EBT00001622037.
DR   EnsemblGenomes-Tr; EBT00001622038.
DR   EnsemblGenomes-Tr; EBT00001622039.
DR   EnsemblGenomes-Tr; EBT00001622040.
DR   EnsemblGenomes-Tr; EBT00001622041.
DR   EnsemblGenomes-Tr; EBT00001622042.
DR   EnsemblGenomes-Tr; EBT00001622043.
DR   EnsemblGenomes-Tr; EBT00001622044.
DR   EnsemblGenomes-Tr; EBT00001622045.
DR   EnsemblGenomes-Tr; EBT00001622046.
DR   EnsemblGenomes-Tr; EBT00001622047.
DR   EnsemblGenomes-Tr; EBT00001622048.
DR   EnsemblGenomes-Tr; EBT00001622049.
DR   EnsemblGenomes-Tr; EBT00001622050.
DR   EnsemblGenomes-Tr; EBT00001622051.
DR   EnsemblGenomes-Tr; EBT00001622052.
DR   EnsemblGenomes-Tr; EBT00001622053.
DR   EnsemblGenomes-Tr; EBT00001622054.
DR   EnsemblGenomes-Tr; EBT00001622055.
DR   EnsemblGenomes-Tr; EBT00001622056.
DR   EnsemblGenomes-Tr; EBT00001622057.
DR   EnsemblGenomes-Tr; EBT00001622058.
DR   EnsemblGenomes-Tr; EBT00001622059.
DR   EnsemblGenomes-Tr; EBT00001622060.
DR   EnsemblGenomes-Tr; EBT00001622061.
DR   EnsemblGenomes-Tr; EBT00001622062.
DR   EnsemblGenomes-Tr; EBT00001622063.
DR   EnsemblGenomes-Tr; EBT00001622064.
DR   EnsemblGenomes-Tr; EBT00001622065.
DR   EnsemblGenomes-Tr; EBT00001622066.
DR   EnsemblGenomes-Tr; EBT00001622067.
DR   EnsemblGenomes-Tr; EBT00001622068.
DR   EnsemblGenomes-Tr; EBT00001622069.
DR   EnsemblGenomes-Tr; Suden_R0001-1.
DR   EnsemblGenomes-Tr; Suden_R0002-1.
DR   EnsemblGenomes-Tr; Suden_R0003-1.
DR   EnsemblGenomes-Tr; Suden_R0004-1.
DR   EnsemblGenomes-Tr; Suden_R0005-1.
DR   EnsemblGenomes-Tr; Suden_R0007-1.
DR   EnsemblGenomes-Tr; Suden_R0008-1.
DR   EnsemblGenomes-Tr; Suden_R0009-1.
DR   EnsemblGenomes-Tr; Suden_R0010-1.
DR   EnsemblGenomes-Tr; Suden_R0011-1.
DR   EnsemblGenomes-Tr; Suden_R0012-1.
DR   EnsemblGenomes-Tr; Suden_R0013-1.
DR   EnsemblGenomes-Tr; Suden_R0014-1.
DR   EnsemblGenomes-Tr; Suden_R0015-1.
DR   EnsemblGenomes-Tr; Suden_R0016-1.
DR   EnsemblGenomes-Tr; Suden_R0017-1.
DR   EnsemblGenomes-Tr; Suden_R0018-1.
DR   EnsemblGenomes-Tr; Suden_R0019-1.
DR   EnsemblGenomes-Tr; Suden_R0020-1.
DR   EnsemblGenomes-Tr; Suden_R0021-1.
DR   EnsemblGenomes-Tr; Suden_R0022-1.
DR   EnsemblGenomes-Tr; Suden_R0023-1.
DR   EnsemblGenomes-Tr; Suden_R0024-1.
DR   EnsemblGenomes-Tr; Suden_R0025-1.
DR   EnsemblGenomes-Tr; Suden_R0026-1.
DR   EnsemblGenomes-Tr; Suden_R0027-1.
DR   EnsemblGenomes-Tr; Suden_R0028-1.
DR   EnsemblGenomes-Tr; Suden_R0029-1.
DR   EnsemblGenomes-Tr; Suden_R0030-1.
DR   EnsemblGenomes-Tr; Suden_R0031-1.
DR   EnsemblGenomes-Tr; Suden_R0032-1.
DR   EnsemblGenomes-Tr; Suden_R0033-1.
DR   EnsemblGenomes-Tr; Suden_R0034-1.
DR   EnsemblGenomes-Tr; Suden_R0035-1.
DR   EnsemblGenomes-Tr; Suden_R0036-1.
DR   EnsemblGenomes-Tr; Suden_R0037-1.
DR   EnsemblGenomes-Tr; Suden_R0038-1.
DR   EnsemblGenomes-Tr; Suden_R0039-1.
DR   EnsemblGenomes-Tr; Suden_R0040-1.
DR   EnsemblGenomes-Tr; Suden_R0041-1.
DR   EnsemblGenomes-Tr; Suden_R0042-1.
DR   EnsemblGenomes-Tr; Suden_R0044-1.
DR   EnsemblGenomes-Tr; Suden_R0045-1.
DR   EnsemblGenomes-Tr; Suden_R0046-1.
DR   EnsemblGenomes-Tr; Suden_R0047-1.
DR   EnsemblGenomes-Tr; Suden_R0048-1.
DR   EnsemblGenomes-Tr; Suden_R0049-1.
DR   EnsemblGenomes-Tr; Suden_R0050-1.
DR   EnsemblGenomes-Tr; Suden_R0051-1.
DR   EnsemblGenomes-Tr; Suden_R0052-1.
DR   EnsemblGenomes-Tr; Suden_R0053-1.
DR   EnsemblGenomes-Tr; Suden_R0054-1.
DR   EnsemblGenomes-Tr; Suden_R0055-1.
DR   EnsemblGenomes-Tr; Suden_R0056-1.
DR   EnsemblGenomes-Tr; Suden_R0057-1.
DR   EnsemblGenomes-Tr; Suden_R0058-1.
DR   EnsemblGenomes-Tr; Suden_R0059-1.
DR   EnsemblGenomes-Tr; Suden_R0060-1.
DR   EuropePMC; PMC1941758; 17696605.
DR   EuropePMC; PMC2147049; 18159241.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC5043019; 27746772.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000153.
DR   SILVA-SSU; CP000153.
DR   StrainInfo; 109901; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA available from Kathleen Scott
CC   (kscott@choma1.cas.usf.edu)
CC   Bacteria available from ATCC: ATCC 33889
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2201561
FT                   /organism="Sulfurimonas denitrificans DSM 1251"
FT                   /strain="DSM 1251"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:326298"
FT                   /culture_collection="ATCC:33889"
FT   gene            15..1322
FT                   /locus_tag="Suden_0001"
FT                   /old_locus_tag="Tmden_0001"
FT   CDS_pept        15..1322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0001"
FT                   /old_locus_tag="Tmden_0001"
FT                   /product="chromosomal replication initiator protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43282"
FT                   /db_xref="GOA:Q30UP9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43282.1"
FT                   /translation="MNIGEKILLLLKEEIPEIEYNRYIKHLTYDTKKSTADNAIFYVPN
FT                   SLVLSWIKNRYSSKIKHLFEIQNSIKVDVSILLKNQVESKKAEQKSVQKQQHSLLNPSH
FT                   TFENFMVGGSNQFAYAAVKSVSEKAGVLYNPLFIHGGVGLGKTHLMQAAGNVFQNQGKV
FT                   VIYTTVEQFLNDFIRHVRNKTMERFQEKYRKCDVLLIDDIQFLSNKEGIQEEFFHTFEA
FT                   LKGVGKQIILTADKHPKKIAGLEKRLQSRFEHGLVADIQPPELETKIAIIENKCKINKV
FT                   ILTKDIIHYIATVIESNVREIEGILSKLHAYSQLMHVDIDLQFTKNVLKDQLQENRANL
FT                   TLDIITQNVAKDLNIKPSEIRSKGRSKNLVYARRIAIYLCRELTQNTMPQLAQYFGMQD
FT                   HTAISHTLKKIGELMQNDEDFKVKIEELTNKITSSS"
FT   gene            1490..2557
FT                   /locus_tag="Suden_0002"
FT                   /old_locus_tag="Tmden_0002"
FT   CDS_pept        1490..2557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0002"
FT                   /old_locus_tag="Tmden_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43283"
FT                   /db_xref="GOA:Q30UP8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43283.1"
FT                   /translation="MKITIQKSIIENILIHSQPFLEKKDTSQITSHVFIDASNNKLTLK
FT                   ATDYEIGLIVSTDKLNISQDGNVTANGKKLLDIVRILKDGEINLEVKSDILYISQSHSK
FT                   FKLPTFSYNEFPVFPMSEGKSRILIDSHSLIDSLKKITPSIDINNPKFELNGALIDIKQ
FT                   NNINFASTDTRRLAVVNIENQSSSELSIIVPKKAIVEIQKLFFDNIELYYDENYLIIHS
FT                   KEYTFFTKLINGKFPEYSRIIPKEIKNTLILQKAKMIEAIKQITTISTDVKITFLNDTV
FT                   IFESLSDDNIEAKTEINSITGFTTPFTIAVNSRYLLDFLNTINSSEFNIGLNDSNLPFV
FT                   LNDGNFKTVVMPIVI"
FT   gene            2707..5016
FT                   /locus_tag="Suden_0003"
FT                   /old_locus_tag="Tmden_0003"
FT   CDS_pept        2707..5016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0003"
FT                   /old_locus_tag="Tmden_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43284"
FT                   /db_xref="GOA:Q30UP7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43284.1"
FT                   /translation="MENYGASNIKVLKGLEAVRKRPGMYIGDTGHRGLHHLVYEVIDNS
FT                   IDEAMAGYCNTINVTLTKEGTCRVSDNGRGIPTDMHEGEGMSAATVVLTVLHAGGKFDK
FT                   DTYKVSGGLHGVGVSVVNALSSDLKMTIQRNGEIHEQNFKKGIPQEALNVIGTTKKTGT
FT                   TIEFSPDPSIFTETVIFEYEYLARRFKELAYLNPFITIIFKDERTNVKEEYHFEGGIAQ
FT                   YVTDLNKKQEVAKVFVFSSKIEDIEFDISLMYNDTYDEKVYSFVNNIRTPNGGTHEAGF
FT                   RAGLTRVISNYNTQNGAAKEKDVKISGEDTSEGLIAVVSVRVPEPQFEGQTKGKLGNTY
FT                   VRPLVQKATYELLSKYFEENPIEAKAIVAKSLMAARGREAAKKARELTRRKDSMSVGTL
FT                   PGKLADCQSKDASICELYLVEGDSAGGSAKMGRDRVFQAILPLKGKILNVEKARLDKIL
FT                   KSEEITNMITAMGCGIGEEYNEDKLRYHKLIIMTDADVDGSHIQTLLLTFFFRHFRSVI
FT                   ENGYLYLAQPPLYRYKKGKKEIYFKDDRAMNDFLIENGIESLEGQSVGHNDLLSYFKMV
FT                   DHYRGSLEALKKRYALVELIRHFIENPDLIGLDIDNMYKKIEEFLALGGNNILTKTVSQ
FT                   DSIHIFVQTKGGMEELLINDDLFGAPHFAEASFVYRKIKEWNLDFNEDILVVLDNIIEY
FT                   AKKGSYIQRYKGLGEMNPDQLWETTMTPENRVLLQVTIDDAELASDTFTLFMGDEVEPR
FT                   RNYIETHAKDVKHLDV"
FT   gene            5041..5418
FT                   /locus_tag="Suden_0004"
FT                   /old_locus_tag="Tmden_0004"
FT   CDS_pept        5041..5418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0004"
FT                   /old_locus_tag="Tmden_0004"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43285"
FT                   /db_xref="GOA:Q30UP6"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43285.1"
FT                   /translation="MKYGEKIVSEFDVEKDLEIWPNEHKRDYLIKMTLPEFSCLCPRSG
FT                   YPDYATIYLEYTPNERVVELKAIKLYINSFRDRHISHENSANEIYTVLERKLKPKYMKI
FT                   VADYNPRGNVHTVIEIDSSKL"
FT   gene            complement(5407..6642)
FT                   /locus_tag="Suden_0005"
FT                   /old_locus_tag="Tmden_0005"
FT   CDS_pept        complement(5407..6642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0005"
FT                   /old_locus_tag="Tmden_0005"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43286"
FT                   /db_xref="GOA:Q30UP5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43286.1"
FT                   /translation="MLIYPIALDAIFNKLIMHNITPIIVGGFIRDSLLFLESKDIDIEV
FT                   YGVSSFEILEEILEEFGKINIVGKSFGVCKLMFVGYDLDFSLPRMDNKISSGHRGFNVK
FT                   TYYKLDFKTATSRRDFTINSIGYDVVSKKLLDPFYGIDDLKNKILRAVNLESFAQDPLR
FT                   VLRAAQFCARFNLSIEYNLAITCKEMVSHALLAQLPKERVFEEFKKLLLKSQKPSIGFT
FT                   LLREFGLEIYSNNLYVIDEIAKQLTTSSKRNLVLMLAGLYYKAAKDGLELILNRLTDEK
FT                   ELCRDVIKLVEVYNYISLVSLDMIDEYFIYKLATMINIEELLILSSSIYYANNPQTIYK
FT                   SGELILKKAKKLGVFTNKLTPILQGRDLIKNGVKPSIEFSKILNDAYEEQLHGKFKTYD
FT                   EAIVWLKRYLKL"
FT   gene            6798..8600
FT                   /locus_tag="Suden_0006"
FT                   /old_locus_tag="Tmden_0006"
FT   CDS_pept        6798..8600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0006"
FT                   /old_locus_tag="Tmden_0006"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43287"
FT                   /db_xref="GOA:Q30UP4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43287.1"
FT                   /translation="MQKIRNIAVIAHVDHGKTTLVDGLLEQSGTYGAHEQHDERAMDSN
FT                   ALEKERGITILSKNTAIRYKDYKINIIDTPGHADFGGEVERVLKMVDGVLVLVDAYEGV
FT                   MPQTKFVVKKMLALGKKPIVVINKIDKPSADPERVVDEMFDLFAAMDATEDQLDFPIIY
FT                   AAARDGIAKLDMSHPDGNFECIFETILSQIPEPVGDKENSTQAQVFTLDYDNYVGKIGI
FT                   SRIFNGVIRKGDNIMLAKADGEMVKGKISKLIGFHGLNRMEIQEAEAGDIVAFAGLETV
FT                   DVGDTICDSKNPMPLDPMHIEEPTLTVVFSVNDSPLAGQEGKHVTSNKLKDRLEAEMTT
FT                   NVAMKLEVVGEGKFKVSGRGELQITILAENMRRENFEFGVSRPEVIVKEIEGIKCEPFE
FT                   HLVIDVPEEFSGAVIEKLGKRKAEMKSMIPMGQGFQRIEFEIPARALIGFRGQFLTDTK
FT                   GEGIMNHSFLEFRPYSGSVESRTYGALISMENGETLAYSLFNIQDRGVLFIGPQTKVYE
FT                   GMIVGEHSRSNDLVVNPIKGKAQSNVRSSGADEAIKLIPFRDMSLERALEWIEDDELLE
FT                   ITPKSIRIRKKYLSENERKRYSRK"
FT   gene            8748..10673
FT                   /locus_tag="Suden_0007"
FT                   /old_locus_tag="Tmden_0007"
FT   CDS_pept        8748..10673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0007"
FT                   /old_locus_tag="Tmden_0007"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43288"
FT                   /db_xref="GOA:Q30UP3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43288.1"
FT                   /translation="MKIYILLLSLSILNAIELPSIAIESSKLGDTLKDSSNSINTLDKN
FT                   KLEMSNIKEIKELSSLISNTNISGVGNRTDKTITMRGISNYVTYESNVAMYIDGTPVPF
FT                   SYGFGMVDMNNVENIEVLKGAQGTLFGKGAESGVINIYTKAPTKTFQSRASIDYGSYDT
FT                   QKFYGFVSAPMSNEDITYSLSLTKESSDGFSTNELTHSNFDDKDFKSLSAKLRYNPSTP
FT                   LDVSLNYTKSQSDDGGSAFKINTKSNPFSIDNEPTNDYVKMDTDMLSLILKYKESDYTF
FT                   TSATTYAKNSSTKYNYVAIRGGLDMDFDIEIEEITQEFRLKQNFENSDFLIGLFYSDKL
FT                   KFDYKENQTFLTLYPVPVLSKNSLENPDENIALFSQYRYYIDEKYSVMAGLRYQTTKRS
FT                   FSRTMNNFAAASTSVEGETTWTHVLPTLSFSYYAEDDSHTYLTYAKGYRPGGYNYRTSD
FT                   ALTPFKPETTNSLELGHKRVLNSSTTFSSALFYNLIDNLRINTFDNNLATITLSAEKAY
FT                   SYGAEIEVNYKADNLNIFMTCGVIKTEISESKDSPQYERNNIIDVPNITTSIGAKYMFT
FT                   QNYHIQSDVKYMGERYYNASNSAKESGYATANIGIGYKKDGWSALVYVDNIFDKRYVDF
FT                   MIFHTI"
FT   gene            complement(10712..12604)
FT                   /locus_tag="Suden_0008"
FT                   /old_locus_tag="Tmden_0008"
FT   CDS_pept        complement(10712..12604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0008"
FT                   /old_locus_tag="Tmden_0008"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43289"
FT                   /db_xref="GOA:Q30UP2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43289.1"
FT                   /translation="MKLLFILLFLLTNIFAATTINISQINDGIKTAPFQELSLIDTKLP
FT                   SIDLAFSNELHWIQSKKSFFGWINKIAVVKFTLFNDSNETRTLFLRHARLGTDNIDFWV
FT                   LKEKKVINHWFMGDRLPLAQRPIQSINSAVKITIQPKEELQIVSQITTSGVLDTNYEIF
FT                   FEKTFLTQSKWQVVWWSIFSGVMLMLVLYNIVNFFGLKEKSFLIHSLYVIFVTINNLGI
FT                   YGFLYYLNLTDDYKLVDTMLYTTMPLALIFHILYPIFLFSLKEKTPKLTYILITISIIY
FT                   GLIGSYFIFGYWNQDILKNAKYILVSATAIWIVIFLVSIYIISKNYTGSLFYFLSQIFV
FT                   IFRVIYLVLILNSDSISMGLQAAMLSSFFVIMEALFITIGMSYRINKELKEKEFHQNIA
FT                   KLYERYIYMGSYTSNIIHQWKSPLNHLGTLVTLLKAYNDKNIEINKEEYQSQLKELETI
FT                   TENLTKISAEVYGYLSNTSSTEPLNIKELITNVFRYFEKDIQHVEIQNIDRDVYITANR
FT                   ATLSQILLVLISNSLNIFKQRDIKNPKIEFFITKEVDGSYKFYVKDNGGGVDKKISHKI
FT                   FCPYITTTNGLGSGLFVAKKLVTDKLSGNLILQNDKNELGGATFVICAKDSYSL"
FT   gene            complement(12601..13275)
FT                   /locus_tag="Suden_0009"
FT                   /old_locus_tag="Tmden_0009"
FT   CDS_pept        complement(12601..13275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0009"
FT                   /old_locus_tag="Tmden_0009"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43290"
FT                   /db_xref="GOA:Q30UP1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43290.1"
FT                   /translation="MEILKSYNAIIVDDDKNISSNMFKLLKLYFKEVHSFEDAESAFEF
FT                   IQENSVSIIISDIELPGMNELKFAKKVKEFDESIEILILTSFATLEYLKEAASLHLIDY
FT                   LEKPISLDKLESILQICAQKLKKNLHYNILISKNIIINFYKKELSVKEEVHKLSHRESS
FT                   LLEILLHDKGKVVSKEFLMQELWQDTEGTNAALRNLLLRLRKKLGDKKIIQNHQNYGYY
FT                   IE"
FT   gene            13468..16977
FT                   /locus_tag="Suden_0010"
FT                   /old_locus_tag="Tmden_0010"
FT   CDS_pept        13468..16977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0010"
FT                   /old_locus_tag="Tmden_0010"
FT                   /product="Filamentous haemagglutinin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43291"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43291.1"
FT                   /translation="MKSFMNNLEYSSRFRILKGGKISLVVSALIGSITILSASPTGGVV
FT                   TSGVANISQSGSATNITQSSQKATINWQNFSIGANETVNFAQPNVNAIALNRIVGNERS
FT                   VIEGALNANGQVWILNSNGVLFNKSASINTAGLVATTKNISDADFNAGNYNFTGESTAS
FT                   AINMGTINISDSGYASLLAEKVGNAGTITAYKGKITLTGANEATINLNGNSLVSLTVDK
FT                   GVLDAMVINKGAIIADGGAIYLTTNAVDELLKGVVNNTGIIEANSLEGVTGYVELFAHG
FT                   GTAQVDGTIKAEGGFVETSGKVLDIKPSVIVKADKWLLDPVDIVIYHDDGGEKHDSTFI
FT                   DIKGDDDEGYVGEDDINFWNDSYENPTTPLDEVSNPTDPSNLLTFSDATSYIADSTIEL
FT                   AINAGTSVYITTFNDGKSGNGDITLQSGVSIINSSTGRDWQDYSVGLYLYANRNIIADN
FT                   VTIGGDSADHPLNVYFRANQAEISKINFKVDGGEEEAYYYTSPQHIEESKTAQDSITSD
FT                   QFTGYIKVTNSTFNTFGGGVGFKGANYLYYTRGDATNPGVLLQDSTINTGGEGVEDSGS
FT                   VSLTGGNSALGGIGVKIDNSTIDTSAGYIDISGVATNGDAISISGGSVLKANRIEMEGA
FT                   VFANGTTSSGSVGIRIKNTTITSTAVELQAEDGYNSNDERFPTLTGVDSDYTQNNKAVG
FT                   ISLEGGAVFDELSSGEGISFSIYDYSFYGVSLGDSSNGGATIGSTTGPLNMWYNKSALG
FT                   VATPFQYVGDAPLTLQSNGSGTITLTNNSYDPSNGDSPYPTIVGETTMGSAQGIWFSDT
FT                   DLNKWVKASAFDKVIINDGNSQSSVIVQNYNLASPVASTFFHGETITLKDTATITRSPE
FT                   NMAFVTWASDEANTFNDEGATFTGEGNYYVYVKNSNAVTQTALSLIDGNYHYDYDTNEF
FT                   TNNESGSNPPVGSYVLCSDGTCGELLNGGSGGSGEEESGGSGGSGGSGGSGGSGGSGGS
FT                   GGGGSYTPPAPTPPPPVVVVPPVVTPPVQAQKIADVVTTIVNTNSVKVELPKEVTTQVN
FT                   TNFTSSVAATVVAPKTTITSSPMLATLETKLGITAGEGVSLSSITIEGTPTEIVTLSQL
FT                   QTMSDSQPQANSSDNAASTTVTETRVALSENSIIDLINGGVHLPEGVDQQFYVTKTPKK
FT                   KSN"
FT   gene            16989..18692
FT                   /locus_tag="Suden_0011"
FT                   /old_locus_tag="Tmden_0011"
FT   CDS_pept        16989..18692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0011"
FT                   /old_locus_tag="Tmden_0011"
FT                   /product="Hemolysin activation/secretion protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43292"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:Q30SK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43292.1"
FT                   /translation="MKIMKITNLTAKALTLSFVTSSLLVGASIPSSSDIQREVQPPKDL
FT                   PKKVTPLVEVGGVQKYAPVMQDDKSGKTIFVKSFKITGAIHMSESKLQSLIGSYMDKEL
FT                   TFAQLQEVASIITKEYRANGYFVARAYIPIQSMQDGVVEIAIIEGNYGKFILENNSHVR
FT                   TPIVQAMLDDVKSANIVSTNTLERAMLIINDTPGAKVTAADVKPRQEVGTSDFAITTET
FT                   KPWYDGYILGDNYGSRYTGENRLMVGVNLNSLAGLGDKLSLSGLMSSERDLKNGRIAYS
FT                   VPLMANGLRAEVGYSKTDYSLAQEYKSLDAYGTSNTLDATLSYPIIRTRLETLRVSSTL
FT                   AIKSLNDKQAGVTTSDKDAKSINLALSYTKEQKLFGLDSQINSGVSYTYGDLKFIDAAS
FT                   KIADAAGANTQGNYSKVNGYVGISTLLPQELTLQTNLQAQKALGGKNLDGSEDMSIGGS
FT                   NGVKLFPDSEHSAENALLWSIELTRALPTINNYSHKFGLFYDVGYASMQDDSKDPTFQN
FT                   RTLQDVGVSYYASYKSLFAKAQVATAIGSEEVTSEPKYSTRVLVQGGVSF"
FT   gene            complement(18752..19672)
FT                   /locus_tag="Suden_0012"
FT                   /old_locus_tag="Tmden_0012"
FT   CDS_pept        complement(18752..19672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0012"
FT                   /old_locus_tag="Tmden_0012"
FT                   /product="Methionine sulfoxide reductase A/B"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43293"
FT                   /db_xref="GOA:Q30UN8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43293.1"
FT                   /translation="MKYIFIFILILTTMNALEPLTKKIEQLSEEEKRVILHKGTERPFV
FT                   GKYTDEKSHGIYTCKLCEAPLFDSSAKFDSRSGWPSFDDEIKGAIKRVPDADGRRVEIV
FT                   CANCGAHLGHVFESEGYTPKNTRHCVNSISLNLVKKPQIKDENLSYAYFAGGCFWGVEY
FT                   YLQKLGGVKEVTSGFMGGFVKNPSYYEVVRSNTGHLEAVEVIYDENKISYEEIARTFFE
FT                   IHDPTQANGQGPDIGEQYLSVVFVQNDKEREIIENLISKLESNGYKVTTKIMKKSDFYP
FT                   ADESHQNYYDKKGSKPYCHGYIKRF"
FT   gene            19839..20861
FT                   /locus_tag="Suden_0013"
FT                   /old_locus_tag="Tmden_0013"
FT   CDS_pept        19839..20861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0013"
FT                   /old_locus_tag="Tmden_0013"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43294"
FT                   /db_xref="GOA:Q30UN7"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43294.1"
FT                   /translation="MNRKKIYNPESNENVNDRRIFGGNPTGIFELNDIKYQWAYNLWEM
FT                   MLNNTWFPKEVDMTRDVSDYKQITDVEKASYDKALAQLIFMDSLQTNNIMDNINPYVTS
FT                   PEINLILVRQAYEEALHSQSYAVMVDTISTNSKEIYELWRRDMMLKGKNDAIARVYEEL
FT                   SKNPTEHNFVKACFANQILEGIYFYSGFAYIYTLARSGKMLGSAQMIRFIQRDEVTHLV
FT                   LFQNLINSLRKERPDLFNEKLKEEVIEMFKEAVALEVAWGKYITGGQILGLTDAIIEQY
FT                   IQYLADDRLTSVGFAKLYNVTNPIKWVDDFSKFNDQKTNFFEGTVANYSKGSLTFDDDF
FT                   "
FT   gene            20848..21591
FT                   /locus_tag="Suden_0014"
FT                   /old_locus_tag="Tmden_0014"
FT   CDS_pept        20848..21591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0014"
FT                   /old_locus_tag="Tmden_0014"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43295"
FT                   /db_xref="GOA:Q30UN6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43295.1"
FT                   /translation="MMTSNNSEYKLSSLLFDTIEGDYHSNLQTLLTLINQAKPKSLIVA
FT                   PEVCLSGFDYKNYEEAIAFSDIADEALKQASHDKIIILTMLQREDGEVFNFAKIFFNGK
FT                   IVYKRAKAKLFRFGDEHKYMSEGCVDEVEMVEVDGIKIGILICFELRFKELWKKLEGCD
FT                   VIVVPSWWGVLRTEHFKVLTRALAIINQCYVVASDSLNVECTKMSGIITPHGGDERNEH
FT                   RAYFELPYDKKEIQMMRRYMDVGIG"
FT   gene            21575..22222
FT                   /locus_tag="Suden_0015"
FT                   /old_locus_tag="Tmden_0015"
FT   CDS_pept        21575..22222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0015"
FT                   /old_locus_tag="Tmden_0015"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43296"
FT                   /db_xref="GOA:Q30UN5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43296.1"
FT                   /translation="MLALDRITATKTAKLAQDCHKIFSLSQNVRDAIANTSREEFVPAG
FT                   FKHNAYKLDALPMGSSQWISSPLTVAKMTHYLEAKKDDRVLEIGCGSGYQAAVLSHIFR
FT                   GVFTIERIEPLILEAKQRFRKLGISNIHTKLDDGQNGWAQYAPYDRILFSATAKEIPSK
FT                   IFEQLCDGGILVAPMQVGLKQVITRFKKVGNSLQKEELEACDFVPILNGIQK"
FT   gene            22219..23298
FT                   /locus_tag="Suden_0016"
FT                   /old_locus_tag="Tmden_0016"
FT   CDS_pept        22219..23298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0016"
FT                   /old_locus_tag="Tmden_0016"
FT                   /product="Phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43297"
FT                   /db_xref="GOA:Q30UN4"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43297.1"
FT                   /translation="MILRLLVITLLALSLKASVTFDEANLLYARDEYKKAFEAFSLLAK
FT                   DDADAAYMLAKMYEQGEGCEKSEEKAQEWYKASAHIYYEQAKHSPLRNVQKHQKEIFKT
FT                   LDRVDNNQTQETLRQFVQSLYNFKAHNANYFLPFSYRYDDNYDEVNGHEAGKVETEFQV
FT                   SLKYDFAANFFKLREIYSVAYTQKSFWQSYKESAFIRESNYSPEFFVTFPTSSQDDGGF
FT                   LKGIRVGVAHQSNGRGAEYERSWNYVNASLFFQYDILLCELKLWARLPDATDYNPELID
FT                   TIGHGYFRIAVPYKKHLFDMKIMNNFNSKGSIEFNYTHPVSSRDDLFFYMKFFNGYGES
FT                   LIDYDNHIKKVGIGFSISR"
FT   gene            23358..24191
FT                   /locus_tag="Suden_0017"
FT                   /old_locus_tag="Tmden_0017"
FT   CDS_pept        23358..24191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0017"
FT                   /old_locus_tag="Tmden_0017"
FT                   /product="Thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43298"
FT                   /db_xref="GOA:Q30UN3"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43298.1"
FT                   /translation="MQSIYGIKYTKPEVVLIQETGIGVAEAAARTCYDSFENSENRAIQ
FT                   YIEKNMPDSSTCREINGIEESNLLNDLAWTYFHHSILEHANLSFLVRGTSRGVLQEHAR
FT                   HRMQAISVRSTRYTMSSVINAFVASMSSNDRDFFIDKVLSFDMFVTCDKEYNKIEIGAM
FT                   YDKLFYQSKKVEDFNEIAVATSSLDLLEKFKGTPEALFDALESGKKKRNVGDAFKHIIS
FT                   DNVKVDMVVTFNLRSLKNYFTLRDSGAAYFQIRWLAQEMMRKTPSKYLDLIIKKR"
FT   gene            24196..24411
FT                   /locus_tag="Suden_0018"
FT                   /old_locus_tag="Tmden_0018"
FT   CDS_pept        24196..24411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0018"
FT                   /old_locus_tag="Tmden_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43299"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43299.1"
FT                   /translation="MWKYIAISSLLFSGCSYFEVNFSMCENVGPNSDPSMIEKCRNYNE
FT                   EEAQKAFDGTKHKSTTLPEDAIEFKK"
FT   gene            24423..24977
FT                   /locus_tag="Suden_0019"
FT                   /old_locus_tag="Tmden_0019"
FT   CDS_pept        24423..24977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0019"
FT                   /old_locus_tag="Tmden_0019"
FT                   /product="PhnA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43300"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43300.1"
FT                   /translation="MSIEEELKTRSGSKCELCQSSQNLSVFEVAPSDESSEQSIYICAT
FT                   CKEQIENPSMMDETHFNCLNESMWSEVPAVVVISYRLLKLLGREDLVDMIYMEDDVKAW
FT                   ADAGVNSSSNVVVKDSNGVTLNAGDSVVIIKDLEVKGAGFTAKRGTMVKNISIPQDVEG
FT                   HIEGRVNGTKIYLKTEFLKKA"
FT   gene            24996..26159
FT                   /locus_tag="Suden_0020"
FT                   /old_locus_tag="Tmden_0020"
FT   CDS_pept        24996..26159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0020"
FT                   /old_locus_tag="Tmden_0020"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43301"
FT                   /db_xref="GOA:Q30UN0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43301.1"
FT                   /translation="MNSLKSISINISIPLFISLALGSLVFYEQKIPKVLFSIVPYLFYA
FT                   ITVAILWVSWHFNRNRFIFIILPLLLIYVGFIYLGGKRATDLFLYVSMLYPLHLLLFLS
FT                   LKERGLFSIWGVLKIAFFVVEIAVVLYFVFYPNNDIIALLKTKIFTTSFYPIEDITVVI
FT                   AAFVITVMAMLLIFNRSVLYNSSFLIILLTFYIGFYFIRTPHVKELLLLSIGIIIFILL
FT                   IRESYRLAFYDELTALPGRRALIEDMAKLGMKYSFAMIDIDHFKKFNDTYGHDTGDEVL
FT                   KMVASKLAEVGGGGKAYRYGGEEFVVLFPSRELDESYKSTDILREIISKSPFVVRNKQS
FT                   SKTIYINISSGVVQKTSQDKDPFAVMKRADNALYKAKKAGRNQVVKA"
FT   gene            26170..27267
FT                   /locus_tag="Suden_0021"
FT                   /old_locus_tag="Tmden_0021"
FT   CDS_pept        26170..27267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0021"
FT                   /old_locus_tag="Tmden_0021"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43302"
FT                   /db_xref="GOA:Q30UM9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43302.1"
FT                   /translation="MQAHDRFYKIDKDFRNPYARDRDRIIHSSSFRKLEYKTQVFLNQE
FT                   GDFFRTRLTHSIEVSQIARSITSHLGLNESLAEAIALAHDLGHTPFGHIGGDTLDECLK
FT                   DDGFKNGFDHNFQSFRVVSSLERRYKNFDGLNLTFATLEGILKHSYPYKKSFLPPFIDE
FT                   NFNLETHPSIEAMVVDRADEIAYITHDIDDGLNSGLIRFEDLKESPLIEDILQKVKDEG
FT                   IGEDEDEMFRYRFVSHLINHLVYSLIYFSKDKIDNSKIYSASLSSKSELPIGFEPTLES
FT                   EIKKLKKLLFKKLYQHKDIMIKMYAGKQAIKGLYIGLHEEPKMMPKFYLEQLQSRSKHR
FT                   VIADYIASMSDRHALSFYNEMYGRL"
FT   gene            complement(27313..27525)
FT                   /locus_tag="Suden_0022"
FT                   /old_locus_tag="Tmden_0022"
FT   CDS_pept        complement(27313..27525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0022"
FT                   /old_locus_tag="Tmden_0022"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43303"
FT                   /db_xref="GOA:Q30UM8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43303.1"
FT                   /translation="MPGIVLRSDDNFDASYRRFKKQTDRNLIVTEARARRFHETKTEKR
FT                   KKFLIASRKKMLKRLYMMRRYESRL"
FT   gene            27963..29615
FT                   /locus_tag="Suden_0023"
FT                   /old_locus_tag="Tmden_0023"
FT   CDS_pept        27963..29615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0023"
FT                   /old_locus_tag="Tmden_0023"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43304"
FT                   /db_xref="GOA:Q30UM7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR031988"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43304.1"
FT                   /translation="MITQDSIEALKARLDIVDVVGSHVELKKTGANYKAPCPFHDEKSA
FT                   SFVVSPSKQIYHCFGCGAGGDSIKFVMEFEKLNYPEALEKLASTYNFSLSYSDNKSTKS
FT                   SSGIMQKIDSWYHYLFTKNPQAISYIKERGIYESSIEKFGIGYAPDSNATISFIKSQLL
FT                   SMNEAIEMGIVGNDGSRAYARFIERITFPIHSANGTIVGFGGRTITGHQAKYVNSPETP
FT                   YFNKSRLLYAYHHAKQTIHKTKEIVITEGYLDVIMLHQAGFTNAVATLGTALTSEHLPI
FT                   LRKGEPKVIMAYDGDKAGRAAALKASKILSAGGFNGGVVIFSDGLDPADMVKNGAVEEL
FT                   SNMFRAPQPFIEFVLDEILSLYNLRDPKARELCMQDAIGYLKTLSAMLQEEYKSYLASR
FT                   LGLSPSYIKITNKSNINQNLPFIDKNRHRDMWELTLIKTVLEHPEFIDQILDVLDPSLL
FT                   KFHSSELSLALRGEFSHPQLMAIAVDEQIKALNSEDALRAELVSFLMKHYEREYKKVNV
FT                   LSDITFEEKAFYIRKFKGKIELLKRGELVAFKS"
FT   gene            complement(29605..30627)
FT                   /locus_tag="Suden_0024"
FT                   /old_locus_tag="Tmden_0024"
FT   CDS_pept        complement(29605..30627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0024"
FT                   /old_locus_tag="Tmden_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43305"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43305.1"
FT                   /translation="MSNYEITIKHNKHRIHPCPNDKKLSLLALLLEQNSTLNILVASSQ
FT                   DRELIKEVAGAKNVTVALDDELTKAADLMCDLLISYDLPSAEIYMSRLRRAKEGAIILL
FT                   DISEQKNLYPIETILKRVIRQDTVLGYEYAPQEKMKIAQKSLQKEKGVYAFDPDAPQKP
FT                   LYSKKQTEYKKTFDKPKYDKSNWDKPKRDNEGSERKPFEKPKYDKPKTDGQRAERKPFD
FT                   KPKWDKPKFDKTKNDTQGPEHKPFDKPKWDKPTRDGEKSERKPFDKPKYDGEKKYDKSG
FT                   KKSNKFLGKDDSGKSKFSGKSGERNHKYDGKPKESIEAPKNVGRKISIKERKPKDAPSS
FT                   "
FT   gene            30766..31962
FT                   /locus_tag="Suden_0025"
FT                   /old_locus_tag="Tmden_0025"
FT   CDS_pept        30766..31962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0025"
FT                   /old_locus_tag="Tmden_0025"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43306"
FT                   /db_xref="GOA:Q30UM5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43306.1"
FT                   /translation="MSFTTLGLSAPILKAIKDQGYTKPTPIQKQAIPIILSKKDILAGA
FT                   QTGTGKTAGFTLPLLELLSRDKSSTKKRIRALILTPTRELAAQVGESVSIYGKYLSFTS
FT                   TIIYGGVSINPQLSALRKGVDIVIATPGRLLDHLSQKSIDLKDVEFLVLDEADRMLDMG
FT                   FINDIKKVLAVLPKNKQTLLFSATYSDEIKKLSDRLLNSPVLIEVERPNKTAQSIKQIV
FT                   YPVDKERKRELLVHLIKEGKWQQVLVFTRTKHGANKLSAQLEKDGISSSAIHGNKSQNA
FT                   RMKALQEFKDGDIRVLVATDIAARGIDIDQLPHVINYELPNVPEDYVHRIGRTGRAGSS
FT                   GDAISLVCIDEHEYLSSIEKLIKTDIQKVWLKDFKPDPSIKAEPINQGGQRGSHKKRR"
FT   gene            32011..32991
FT                   /locus_tag="Suden_0026"
FT                   /old_locus_tag="Tmden_0026"
FT   CDS_pept        32011..32991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0026"
FT                   /old_locus_tag="Tmden_0026"
FT                   /product="Thiamine biosynthesis protein:ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43307"
FT                   /db_xref="GOA:Q30UM4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43307.1"
FT                   /translation="MKAIALFSGGLDSTLALKLIIDQGIEVLAVNINTGFGSTKDRLEH
FT                   MQNMCAQVGAELKIIDIESEFLQDVLFDPKHGYGKNFNPCIDCHAKMFAVAKRVMESEG
FT                   ASFLISGEVLGQRPMSQNREAMQTVLNESNCDGLLLRPLSAKALSPTIAEINGWVDREK
FT                   LEGIVGRSRDRQLELVAEIGLEDFESPGGGCLLTDENFAKKMFDFIKYDKFEVKDIPVM
FT                   KFGRHLRLPDGAKLVVGRNKDENLHLQNIESEKYHHVKTVALPGPHSLLSKSATKEDKE
FT                   LASRIILTYCKTKEDNMYTLLYDETEEMYATPFDSRDELKPYTIM"
FT   gene            33039..33455
FT                   /locus_tag="Suden_0027"
FT                   /old_locus_tag="Tmden_0027"
FT   CDS_pept        33039..33455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0027"
FT                   /old_locus_tag="Tmden_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43308"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43308.1"
FT                   /translation="MAGVHFGFNNFKQLLDLTIGLVQRIDENRAESFTILYCDFSALDH
FT                   SIVKSSLEHILRNSDAIVNDKADYFFVLPYTDKYGAEIVKKMFIEFFAADLKTYMVSYP
FT                   IDGENSEDLVFRIRDYATLYHKNDLNCLDSFNRY"
FT   gene            complement(33442..33681)
FT                   /locus_tag="Suden_0028"
FT                   /old_locus_tag="Tmden_0028"
FT   CDS_pept        complement(33442..33681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0028"
FT                   /old_locus_tag="Tmden_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43309"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43309.1"
FT                   /translation="MKYLLLFLPLLLIAGSPFETLNVKDMDLSVYETKKSEQNLQASKN
FT                   IKVTCRLVCDKKVYQEQKISDAIEFYKKINSNSD"
FT   gene            33761..35395
FT                   /locus_tag="Suden_0029"
FT                   /old_locus_tag="Tmden_0029"
FT   CDS_pept        33761..35395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0029"
FT                   /old_locus_tag="Tmden_0029"
FT                   /product="Flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43310"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43310.1"
FT                   /translation="MVLLDMKNANGSSSSSPLSLATLKEKPTISFSELLRGASETKDKK
FT                   IVQNGSLVLALVNEEKSIKMPKTSSKTSTLTSLLQTQDKVVEKKEKEPLELNPKLVATL
FT                   SSAEMKTLMSDAKNYLKSKILESEGFKKSEIKELPTTLKGLVEVAKKFGVDISKITLEE
FT                   VKEHGLDSSKTIKQDTKELHVDILKDKREVKAEAPEGALSEKKDSKTPESSKELLQDKK
FT                   EPKTEVPKEIVQTPKESFADKKAQLQETQKHPQTLQNSEAVSKIISNELRADEKQSEIL
FT                   KEIKSTPLFKAQNTLEHATTEQIVQAKVNSTSLKSEQKSPKDRADETLKLLLNGEKSSK
FT                   DAPSLTADFSVKSATVIAPSLSVESTKSLEKLLQGESFVSEQPSQAQKTDSLGASKADS
FT                   FEVKINEAKQMIRYLSDDIRNAINDYKSPFTRVKVQLNPQHLGEVDLTVVQRGKNLHVS
FT                   ISSNNTAINALSMNVNELKTQLVNSGINSATFNFNSSSQNGDNSSGAFQQQRQNEQKAH
FT                   AEYSHFESEEAHEEILSSLEIIVPRYI"
FT   gene            35500..36165
FT                   /locus_tag="Suden_0030"
FT                   /old_locus_tag="Tmden_0030"
FT   CDS_pept        35500..36165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0030"
FT                   /old_locus_tag="Tmden_0030"
FT                   /product="Flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43311"
FT                   /db_xref="GOA:Q30UM0"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43311.1"
FT                   /translation="MAITSTGLNAATHAESAAANAAKDKTALGKDDFMKLLLVELQHQD
FT                   PTEPMDSEKILSQTSQLATLEASENTNKALSELAASMSASQQFSTVSAIGKTADLGSNA
FT                   ITLDKGTNTKFEMYFPDAISNGTVQILDVNGNTIKTLDVGTNPKGVYGFTWDGTNANGG
FT                   AVDSGIYYATASYTNPDGAALKTRVGAYPIESVRFDKGETFLKLGSNYVPLANVKEVY"
FT   gene            36177..37469
FT                   /locus_tag="Suden_0031"
FT                   /old_locus_tag="Tmden_0031"
FT   CDS_pept        36177..37469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0031"
FT                   /old_locus_tag="Tmden_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43312"
FT                   /db_xref="GOA:Q30UL9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43312.1"
FT                   /translation="MMIQAFYTGINGIKSHQTSIDVIADNLANTSTLGFRGYTAEFSSL
FT                   FEKSLSTTADINAGIGLGSRVNAITMNDSVGTLQLSERSTDMAIMGDGWFGIQGEGSPL
FT                   YTRDGSFTFDRERDLVTADGYYVLGTMGKNINNGVLSEQLAEIPLANVSEQQKLRFPDK
FT                   LTYPVEPTSEAKFFGNLGVTDNIRVISAKAIDSQSNTNSIRLEFKKSNPQTSPGVQWDV
FT                   TATAQSSGVKTEYNEQTSETTYLPDEIYDTQKGVVSFDNSGIIISNTLSTVNNNGTPVK
FT                   IDLGSGFNGLISMDNPFSGSSTSNGTQSGELQGYDINKNAQIVATFSNGMQSAIGSVAV
FT                   YHFQNDKALERAGGSRFSESTNSGKPIFFKDANGKNIVGTDLSNFKLEGSNVRMEVALT
FT                   EIIVMQRSYDANSKCITTADQMLQKALSMHR"
FT   gene            37633..39789
FT                   /locus_tag="Suden_0032"
FT                   /old_locus_tag="Tmden_0032"
FT   CDS_pept        37633..39789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0032"
FT                   /old_locus_tag="Tmden_0032"
FT                   /product="Flagellar hook FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43313"
FT                   /db_xref="GOA:Q30UL8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR012835"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43313.1"
FT                   /translation="MLKSLFAGVSGLQSHQVAMDVESNNIANVNTVGYKYSRANFSDLL
FT                   AQTRAIATAPQGELGGKNPVQVGLGATVSSMTRIFSQGSVQNSDKNTDVAIQGDGFFII
FT                   SPDGGNTYKYTRAGDFKFDAGGNFVDNNGFIVQGWLRDRATGFVDATAPITNINIPPGL
FT                   TTPASPTQHVVIKANLNSGPLVKTYSPAYEVKSYPTGTPLPNPEAIDENGNPIDSGNMG
FT                   VLFNDSGEAFNLQTGQGIWASFTPTKTAATAGVAAGAVELDITLELDDGTLKQITTNGG
FT                   LAGNTAADNAARYVSAINAQTSVTGIIATYSGGFINLANSNSDINASHNIRINAVGNAN
FT                   SGLVVGDSATTAYRYQYDPTGAVTVAGGDKKFTTIADLREALENQARAVGNLDADATPD
FT                   ENNIEIKINAQGKFELSNPGGSQDGDYDINLSITGMNANSITGGGITENTKFTRNMEAL
FT                   NATLPAGSTGKAFSQSFNAATHSASIDIFDSLGSKHTLRTEFRKVAVDASTGSSWNMKI
FT                   SVPEPATIDSVAPYNEKTGFVRFNSDGSLATFNPPNVSFTANNGSAANQQVAIKLGTSN
FT                   SFDGMTSFDSKSATSGISQDGFTGGDLVGIRIDQSGTLIGSFSNGRSFGLAQIGMAKFT
FT                   NNEGLSTEGGNVYVQTANSGDPIIGTAATAGRGFMQAAALEASNVDLSLALTQLIIIQR
FT                   GYQANGKTITTSDQLLQTLIGLKQ"
FT   gene            39919..41082
FT                   /locus_tag="Suden_0033"
FT                   /old_locus_tag="Tmden_0033"
FT   CDS_pept        39919..41082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0033"
FT                   /old_locus_tag="Tmden_0033"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43314"
FT                   /db_xref="GOA:Q30UL7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43314.1"
FT                   /translation="MLFSAPLKSNSKKIMLLGSGELGREVAIEAQRLGLEVIAVDRYQN
FT                   APAHSVAHRSYVVNMQDKDALLEIIYREKPDYILPEIEAISIDALFEAEDKGYNVIPNA
FT                   NAVSKTMNRKNIRTFAAEVLELKTGAYEFVTTKEMLVSAAGRLGFPCVIKPVMSSSGHG
FT                   QSVARSASDIDASWEIAKEARGDASELIVEAFVDFDYEITMLTARNGKETVFCEPIGHE
FT                   QRDGDYVFSWQPMQMSEIAKQRAEDMAKKITDGLGGRGLFGVELFIKGDEVYFSEVSPR
FT                   PHDTGMVTLITQSQSEFALHLRAVLGLPLEFTFYGEGASAAFKSEVHNFSPVIHVDESL
FT                   FSKNSFVRIFGKPEAHKGRRLAVALVFDKAEQALQRARELITKVKDS"
FT   gene            41083..42018
FT                   /locus_tag="Suden_0034"
FT                   /old_locus_tag="Tmden_0034"
FT   CDS_pept        41083..42018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0034"
FT                   /old_locus_tag="Tmden_0034"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43315"
FT                   /db_xref="GOA:Q30UL6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43315.1"
FT                   /translation="MKIVILDALTFGDSDLSTFYSLGDTQIFQTTLSSQLQERIKDADV
FT                   IVTNKVVITDEHMQNTPSLKLICVAATGMNNVDLEGAKKRAIEVKNVSGYSSDSVIQHT
FT                   FSMLFYLIGHSKYYDNYVKNGSYAKSEIFTDVSRPFFEIKGKKWGIIGLGEIGRGVANI
FT                   AKTFGAEILYYSTSKKNQNNQYTSVSLDELLKSCDIISIHAPLNENTLNLLDYKELQMC
FT                   KDGAVILNLGRGGIINEEAVSRIVDERDILFGLDVLSREPIESNNPLLHVKNRDNLYIT
FT                   PHIAWTSIEARKTLIDGVTSNIKSFYEKNK"
FT   gene            42048..42419
FT                   /locus_tag="Suden_0035"
FT                   /old_locus_tag="Tmden_0035"
FT   CDS_pept        42048..42419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0035"
FT                   /old_locus_tag="Tmden_0035"
FT                   /product="cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43316"
FT                   /db_xref="GOA:Q30UL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43316.1"
FT                   /translation="MAATILPFSSEISFVAALESGMSVKNAMFFASSGNILAIILNYSL
FT                   GYLLYEKTKTKLLSSKIGRVSYKYGHSYGYVALLFSWLPIIGDPLTLVAGVLRLNFIYF
FT                   ILISASLRVLRYYFLTLML"
FT   gene            42449..45019
FT                   /locus_tag="Suden_0036"
FT                   /old_locus_tag="Tmden_0036"
FT   CDS_pept        42449..45019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0036"
FT                   /old_locus_tag="Tmden_0036"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43317"
FT                   /db_xref="GOA:Q30UL4"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43317.1"
FT                   /translation="MRYVAALLFCISLYASQKPLDKVSIQLQWLDQFQFAGYYMAQEKG
FT                   FYKEAGLDVEIKKYGVDIDIVEEVLSRKTTYGIGRSSLVWYNSKGKKITLLSATFQSSP
FT                   MVLLALKSSNIKSIKDFTDKKIMMTIDALESAPIYAMIRSAQVDDKRVNFVNHSLNFED
FT                   LIQKKVDLYAGYSSNEPFMLKEREIDFEVFSPLESGFDFYSDILFTSQEEAEKNPERTK
FT                   NFKDASIRGWEYAFKNIDETVSIIYEKYNPLKKSKDALKFEALELKKLAYINEIPLGTI
FT                   EKDKIRRILDVYRIMGLVGSNIDIDEFIFNQDEIFYTQKEREFLKEKKELRVCAISRLL
FT                   PFSDIKEDKFIGICSDVLNLTKEHVKIPYKIIYASSWEENLKNLKNNRCDILPMGTQRL
FT                   KKESLLVVSPYYNEQLAVVTKKSQNYIVDIKHIFDKKFVAIKGNPFIEELKIKYPMLNI
FT                   SYVKSLQEGFESVEQGDYYGYIDTLISAAYAFKNISNGNLKISGSFDEKIGVGFGFRED
FT                   DKELHTIFQKVSKEIKSSDVDNIINKWISVNYIKSIKFEYLQEILSALFLITLLFFYRQ
FT                   HLSNKKNKELEALKNELQLKVKEAIADIQKKDIYMLHKSRLAQMGEMISMVAHQWKQPL
FT                   SSISALQISLLMTIELEEYDLSDEKQREDFLLYFQERLKKIGKQTQALSMIISDFSDFY
FT                   KPNKQQELIALNNLVLKAYKLLEDNLQAEEIDLCLELGSKNSVLAYKNEFIQVLLNVIN
FT                   NAREQLSQRNRADAQILIKSYDRDDICILEISDNGGGVDESIKDKIFDPYFSTKFDKNG
FT                   TGLGLHMSKSIIEQHHGGKIYLQNIENGAKFIIELQASEDKDEK"
FT   gene            45009..46610
FT                   /locus_tag="Suden_0037"
FT                   /old_locus_tag="Tmden_0037"
FT   CDS_pept        45009..46610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0037"
FT                   /old_locus_tag="Tmden_0037"
FT                   /product="Succinate dehydrogenase/fumarate reductase
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43318"
FT                   /db_xref="GOA:Q30UL3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43318.1"
FT                   /translation="MKNRVIIGAGGAGLVAALSAHESGAKVTIITKEYPTRSQTCMAQG
FT                   GINAALSNVDEDSAELHVQNTLKSAHFLADYEAVNFLCKSAPEAIAWLDSIGVPFSRTK
FT                   DGKIAQRKLGGASASRACYAQDYTGLKILHTLYDRCVAGGIEFLNERYLLDFITYDNHN
FT                   KKSVCGVSVLNKRSGEVELIQSCSVIVATGGYSRVFHNYSTNSVASCGDGIAAALRAGA
FT                   RASDLEFIQFHPTALKGSSILMSESARGAGGYLLNSKGERFINELAPRDEVSRAIYDEM
FT                   SKGESIFLDIRHLGSEFIEKELPQEAKLSKLYENIDPALELIPIKPAAHYTMGGIDVNN
FT                   RSLTNIEGLFAAGECANHRVHGANRLGGNSLLEIVVFGKVAGESAAKFAKESDFDTDIK
FT                   EYKEPHVESLELVKSYTNEINFYEKYSELAKLFYLHVGIKRDKESLHKVLKSVKEIKQS
FT                   IHKMGVSDKSKKYNTNLIEFLEFKNMLFLSELILLSAIQRDESRGAHFRVDSQMSKKAF
FT                   DVHTIIDKDGVISYEN"
FT   gene            46600..47304
FT                   /locus_tag="Suden_0038"
FT                   /old_locus_tag="Tmden_0038"
FT   CDS_pept        46600..47304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0038"
FT                   /old_locus_tag="Tmden_0038"
FT                   /product="Succinate dehydrogenase/fumarate reductase Fe-S
FT                   protein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43319"
FT                   /db_xref="GOA:Q30UL2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43319.1"
FT                   /translation="MKINIKRESLHVEYDVSLQGVTLLEVLNEIKYKLDATLTFNSGCR
FT                   SSVCGSCALRVNGREVLACSYKAEDGDVVEPLLNSPIERDLVVNMDKAYSFNAKAKAWQ
FT                   SSFAQHVKLTDEDEMRNALQSDCILCGSCYSACPVYEVNKEFLGPFSLTRVWRYVSDKR
FT                   EENPKGKIDNIQINGVWDCTLCNACTLVCPQGISSKADIEKLRARSVMFGYSDSSFANF
FT                   GGGFSFDGTPSF"
FT   gene            47477..47974
FT                   /locus_tag="Suden_0039"
FT                   /old_locus_tag="Tmden_0039"
FT   CDS_pept        47477..47974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0039"
FT                   /old_locus_tag="Tmden_0039"
FT                   /product="Protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43320"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43320.1"
FT                   /translation="MAKEYSFDISAKIDMQSFKNAINLVDKEVANRYDFKGTTYEVDYK
FT                   EKDKLLVMVASSDNKLDALKDIVITKLLKQNLSSKVLEEQKTENSSGNNRKVTFKIVDY
FT                   IESKEAKKIAAEIKNLKLKVTAQIEGDSIRVKGAKLDDLQKVIATIRSMEWEAPLVFEN
FT                   MR"
FT   gene            47986..48654
FT                   /locus_tag="Suden_0040"
FT                   /old_locus_tag="Tmden_0040"
FT   CDS_pept        47986..48654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0040"
FT                   /old_locus_tag="Tmden_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43321"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43321.1"
FT                   /translation="MSKLTISDAAEFLGVSKEAIHNRIRRGTLECIVENDVKLVLINQE
FT                   DNTNNMPKKPLNQKSVAKSDEKYYRFLEEQNTKLQHRVDTLEGETRSLRDQKEQMLIDE
FT                   RIKIENIYKEKDEQLKNIINAISSKLLLSTPQKIQDTIEGEIDEAQDIEDEHDEDVEIG
FT                   KSRLTSLNKYLKSQDFSKKKISKIKEKFKERAKDDSRVVIIGKKYYIDFKKYDYSDFSI
FT                   "
FT   gene            48708..48796
FT                   /gene="tRNA-Ser1"
FT                   /locus_tag="Suden_R0001"
FT                   /old_locus_tag="Tmden_R0001"
FT   tRNA            48708..48796
FT                   /gene="tRNA-Ser1"
FT                   /locus_tag="Suden_R0001"
FT                   /old_locus_tag="Tmden_R0001"
FT                   /product="tRNA-Ser"
FT   gene            48904..49356
FT                   /locus_tag="Suden_0041"
FT                   /old_locus_tag="Tmden_0041"
FT   CDS_pept        48904..49356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0041"
FT                   /old_locus_tag="Tmden_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43322"
FT                   /db_xref="GOA:Q30UK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43322.1"
FT                   /translation="METELIVKSIMGLIALLSLLVFFLFLEPNKDKKKPNSNSKVVVDR
FT                   DEVESEETNLDALVAIIKNKKSDSKKLSFALDMILKHHGTFHKKMGVRAHKDFDIYMDV
FT                   LFTLCRHPNTNKDLIINFDKELARLNPDYKQEINNAISKGLNSRGI"
FT   gene            complement(49359..50867)
FT                   /locus_tag="Suden_0042"
FT                   /old_locus_tag="Tmden_0042"
FT   CDS_pept        complement(49359..50867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0042"
FT                   /old_locus_tag="Tmden_0042"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43323"
FT                   /db_xref="GOA:Q30UK8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43323.1"
FT                   /translation="MKKIILTTLNSRFTHTSIALRYLFANLAQLQSDALIQEFTINDAV
FT                   QSIAQKLLFHNPQIIGIGVYIWNVKEVYELIHIIKKVSPATKIILGGPEVSHEPFRVNL
FT                   DLADFIIQGEGDIAFYELCKNILSSNEPREKVIKMSMPSLKNITLPYRYYSDDDIKNRY
FT                   IYVEASRGCPFECEFCLSSMDEKVRAFDIDKLLEEFELLWQRGARNFKFIDRTFNLNIK
FT                   TATILLDFFLNKDLNEPYFAHFEVVPDHFPQSLKSKIASFKDGALQLEIGIQTLNPQIA
FT                   KNISRVLNLEKIKENILFLENETHAHIHLDLIVGLPGESLESFGKNLDELVSLSGCEIQ
FT                   IGILKKLSGTYINRHDIEHKMIYSDIPPYDVLQTSELSFTQIGIMKRFSRFWDLTYNSG
FT                   NFKQSVKLIWQDGKIFESFYDFSLWIYEQTDSTWQISLQRLGELLFKYLCEVKKLSPEF
FT                   VANIMIDDMMRLQGRVVPPYLKQYTSNISPSAKKGTSGFNKRQH"
FT   gene            complement(51033..52298)
FT                   /locus_tag="Suden_0043"
FT                   /old_locus_tag="Tmden_0043"
FT   CDS_pept        complement(51033..52298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0043"
FT                   /old_locus_tag="Tmden_0043"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43324"
FT                   /db_xref="GOA:Q30UK7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43324.1"
FT                   /translation="MHDEIIKALKDAAAGKLSARITRIPNDNSKESAFAWSINDALDQF
FT                   EAFMRDVQTSIESAANGKTHRSTDPHGLHGIFRTTSQKLQLAISSISLGHETKIKSKLS
FT                   NDFSVLGGGVSGGLEIIQHDIAIAQNGSDEISKVSEKTALLSERSLENVKDISQKLATL
FT                   VDSISSSHDVIINLGQRTRDISNVVGLIKDIADQTNLLALNAAIEAARAGEHGRGFAVV
FT                   ADEVRKLAERTQKATQEIEINISTLQQESNEMISSSENISEIATESNNVISEFEKTFEE
FT                   LNSYANKSSEISTAINNQLFTSLVKVDHIIFKSNAYSTLLSSNTVNTFIGHKDCRMGKW
FT                   YTGLGADKFGHTKTFKEIDSVHANVHDYAIKNYEFVKAKTVLKGENPNIIIKNFTEMEK
FT                   SSDLLFKKLDEMVQEYTKSGAK"
FT   gene            complement(52327..52815)
FT                   /locus_tag="Suden_0044"
FT                   /old_locus_tag="Tmden_0044"
FT   CDS_pept        complement(52327..52815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0044"
FT                   /old_locus_tag="Tmden_0044"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43325"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43325.1"
FT                   /translation="MIREMKEDDFIVSKTDLKGRITYCNQIFMEMAEYSEEELLGKPHS
FT                   IIRHPDMPKAVFRYLWETIPKKEEVFAYVINKTKNNNAYWVYANITATLDESGNIVDYY
FT                   SVRRKPNPKALEIIIPLYKKMVEVEKSGGVDASFKILTDILADKGMVYDELIISLQNQ"
FT   gene            52872..54053
FT                   /locus_tag="Suden_0045"
FT                   /old_locus_tag="Tmden_0045"
FT   CDS_pept        52872..54053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0045"
FT                   /old_locus_tag="Tmden_0045"
FT                   /product="putative MFS metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43326"
FT                   /db_xref="GOA:Q30UK5"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43326.1"
FT                   /translation="MVLSWNDYIKKISILIVQLQMSIILAIFYFFYFSIIGVYVIFLPK
FT                   VLSMAGYGASDIGIIFAAAPLVRFVVPFAFIKGLKINIASFNIALLIMSLSSISFYFSL
FT                   DSFYKLLFSNITLGIGLSIVLPYIEVISLQYLKKERYGKVRLFGSVGFILVALVLVKFL
FT                   DDPRVALLYLLILTFITAFIGHIIAKKAATILEKQVEHLNDINILKDWKLWLGLTLMQV
FT                   SFGSFYNFFTIYTTDHGVTLDVTIYLWTFGVIVEIFMLYSQGSLLRKNLLLILQLSTLA
FT                   TALRWFLLFLFPSSIGFLFFSQSLHALSFALFHSAAISYLFYLYKHKSLAQQFFSGITY
FT                   GFGAFLGALIAGYVYEFYPSYLFLSATLIALMAAWFLYLWGSSQKGVNNQQLD"
FT   gene            complement(54031..54837)
FT                   /locus_tag="Suden_0046"
FT                   /old_locus_tag="Tmden_0046"
FT   CDS_pept        complement(54031..54837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0046"
FT                   /old_locus_tag="Tmden_0046"
FT                   /product="Putative salt-induced outer membrane protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43327"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43327.1"
FT                   /translation="MYKKIVALSLITSCLIAANTEDVKDEIKETKAKIAKLKANLKELQ
FT                   STLPKEDYIFKARAEIGYVSNSGNTNTEAFNADTKLTNRWDLHSLEASMLMQYGTENNK
FT                   ESKNRFLGELLYDYKLSKVLSLNYLVGYKDDKFSGYDYQFYTGPGAKYVLIETDYHDLN
FT                   LDGNFLYVKDKIYGEPINSYLGYRIKGVYNMQMLENLKFHQTLSFRSEFSDVQNYFLYS
FT                   KTAFTTKLSDIFSAGIAYHIDYTNHPPFSGKTSTDKMFTFNLIADY"
FT   gene            complement(54842..55654)
FT                   /locus_tag="Suden_0047"
FT                   /old_locus_tag="Tmden_0047"
FT   CDS_pept        complement(54842..55654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0047"
FT                   /old_locus_tag="Tmden_0047"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43328"
FT                   /db_xref="GOA:Q30UK3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43328.1"
FT                   /translation="MDISKYSDLTILYISEYGLKALAAIVIFFIGKFIIKKITSVIKKI
FT                   MISAKVDLTLVEFLSKVIYFALFIVVILTSLNTLGINTTSFLAIFGAASLAIGLALKDS
FT                   LSNIGAAVLIIIFRPFRVGDVIDAADTSGKVEEINLFSTILATPDNKTVMVPNSSIINS
FT                   TITNYSNKPTRRVTLSIGVGYNDDLKFVKETLQQIIKEDERVLKEPEPLVAVSELAQSS
FT                   VNFTFRVWVSNEDFWSVNFDMLEKIKTTFDEKGISIPFPQMDIHTKKD"
FT   gene            complement(55698..56027)
FT                   /locus_tag="Suden_0048"
FT                   /old_locus_tag="Tmden_0048"
FT   CDS_pept        complement(55698..56027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0048"
FT                   /old_locus_tag="Tmden_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43329"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43329.1"
FT                   /translation="MSEHKKQLDSFIENLKNKNFYDAHEDIELLWFKRRFEDSDEIKLL
FT                   KGFINASVSFELYKKGKVEASKKVWQTYLKYRELIHKIDSPHLYMYNLIIEEIQSIKEA
FT                   QDKIG"
FT   gene            complement(56020..56331)
FT                   /locus_tag="Suden_0049"
FT                   /old_locus_tag="Tmden_0049"
FT   CDS_pept        complement(56020..56331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0049"
FT                   /old_locus_tag="Tmden_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43330"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43330.1"
FT                   /translation="MNFPDEWTQKEFLQNKKELESQGIRVLLIDTILSGIEKADTTLYN
FT                   PHELKNEPQGSVFVFYCDSGKATLNRLKEYKEKFPKHHCISLKGGRGYWRVNMMIFDE"
FT   gene            complement(56333..57082)
FT                   /locus_tag="Suden_0050"
FT                   /old_locus_tag="Tmden_0050"
FT   CDS_pept        complement(56333..57082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0050"
FT                   /old_locus_tag="Tmden_0050"
FT                   /product="putative manganese transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43331"
FT                   /db_xref="GOA:Q30UK0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43331.1"
FT                   /translation="MIDILLVPIVLVIILVMLHSYFGMEILKRGIIFTDLAIAQFAALG
FT                   SSISLGYFHEEHFYLLTLSFALFSAFLIAFASTRKLHLEAFIGILYVLGASGIMMVLSH
FT                   SAEGMEHFKSLLASDILFTPPMEVAKSAVIYAFIAIALYFIYPKLSGFLKELLFFSLLA
FT                   ITVTSSVSLAGVFVVFVLLIAPPFVALSLNFKKPLLGSFIFGWFFSISAITISYFYDLP
FT                   TGYSVVFLGAFLTALVVLAASKKALEN"
FT   gene            complement(57079..57957)
FT                   /locus_tag="Suden_0051"
FT                   /old_locus_tag="Tmden_0051"
FT   CDS_pept        complement(57079..57957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0051"
FT                   /old_locus_tag="Tmden_0051"
FT                   /product="Periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43332"
FT                   /db_xref="GOA:Q30UJ9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43332.1"
FT                   /translation="MNKLLTLLTLLPLTLLAHLNIAVSYPYIGALTKTIGKEHITTTVL
FT                   AQGNWDPHFIIPRPSLIAKMRNADALIMNGAQLEIGWLPPLINRAGNPKTSPNTPTFLN
FT                   LSHHVELIDKPSNVDRKDGDIHPDGNPHFHLDPKNILSLANTIKEFLISIDTEHKNVYE
FT                   KNYADFSKTWNEKLSEWSQKMSDKKGLKVIQFHDNLAYFNKAYGIINIGTIEPLAGIPP
FT                   SSKHTIDTIELIKNASPCCILHDVYHSTKTADFISEKTGIKVILMPHDIEALESIDNLS
FT                   ALFDYLTSAIR"
FT   gene            complement(58078..59361)
FT                   /locus_tag="Suden_0052"
FT                   /old_locus_tag="Tmden_0052"
FT   CDS_pept        complement(58078..59361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0052"
FT                   /old_locus_tag="Tmden_0052"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43333"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43333.1"
FT                   /translation="MKKILLSSALCTALVYGAEILPVEKRTFDQSKFIPDISLIMDASY
FT                   VDRNVKDTHVGHLEVPGIAHGLIGSHSHGDDNHATYNANNGFNLNYAELVLSSSVDPFF
FT                   TMDGVFHFSENGVEIEELFFTSNALGYGTKVKGGKFNSNFGYLNEQHHHAWDFADMPLV
FT                   YEAFLGMHGINEVGAQIQWTAPTPFYLMAGFEILQGENEQMFGKETVDLTVINPAANPD
FT                   TVEGNDGASLYVGYIKASHDIGSTTLLGGISYAQGESRIDHSQDEEGPHVFSGDAKLYG
FT                   ADFVLLHALDSYSSIKWQSEYLQRELDGTQYANNTLGNFVSPLIVKKQGGLYSQLIYTH
FT                   DKNWKIGVRYDTILKNDVTKAGLDVEQPDNLDKYTAMIEYHTSEFARFRLQYSQDYAMF
FT                   NEDGEREKINTIILQANISIGAHAAHSF"
FT   gene            complement(59422..59688)
FT                   /locus_tag="Suden_0053"
FT                   /old_locus_tag="Tmden_0053"
FT   CDS_pept        complement(59422..59688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0053"
FT                   /old_locus_tag="Tmden_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43334"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43334.1"
FT                   /translation="MKLNILLSILFAIVTSFAAIHEVEHIVHNDSASCLVCTINHNLVS
FT                   DDAVISLSDVELFHFEAIAHNAPISYFYIQTNSNQNRAPPKLS"
FT   gene            59899..60195
FT                   /locus_tag="Suden_0054"
FT                   /old_locus_tag="Tmden_0054"
FT   CDS_pept        59899..60195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0054"
FT                   /old_locus_tag="Tmden_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43335"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43335.1"
FT                   /translation="MRRVVLLSVLVLSLFLSGCSSKDELKPKKKSYFYFSGKADNVEIR
FT                   IDEGTKFDIVASKKSLYSIDEGAHVIEIFRKNQMILKYNFVFEADRVKEIELR"
FT   gene            60204..62282
FT                   /locus_tag="Suden_0055"
FT                   /old_locus_tag="Tmden_0055"
FT   CDS_pept        60204..62282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0055"
FT                   /old_locus_tag="Tmden_0055"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43336"
FT                   /db_xref="GOA:Q30UJ5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43336.1"
FT                   /translation="MNVQSLYILALEKNVGSLFITMGIMEILKRNINKVAFFRPIITDK
FT                   NVVDKDIEFISQRYNLEMSYEECYGFDLSEVDAIIASSGVDELIMRVVEKFKKLQERYE
FT                   FILCEGIARSLFTSNSNHNLNALLAQNFGSSIITIFSAKEHSPLEVYESIAIEKQNLLS
FT                   LDIPCFNMFVSRVDEQSYLDLKRVLKDYSSNISFLKELPELDVLTLEDVVETLDVKKIV
FT                   FSQNDNARAVRGFFVASLGVDEFLDEIKDDDLVIVDAKRSDIILALIASFYSKEYPKIS
FT                   AALFVGDSELTQSLKKLILGLHEYKIPFLSIKSNTFESVKKLLHVYPRLRVKSERKIAL
FT                   ALGLFSASVDITAFEQKIKVQNSDVMTPIMFQYKLFEMARKKKKNIVLPESSDERILRA
FT                   AEIVLRRDVADITLLGKEEEIREHCQKLGLDISKATIIDHKKSKRLEEFSNLFYEMRKA
FT                   KGITLKAARDAMMHRNYFATMMVHVGLADGMVSGAIHSTADTLRPALQIIKTTSDVEIV
FT                   SSIFFMCLKTKILIYGDCALNQNPNAKELAQIAISSAKTAELFDITPKVAMLSYSTGES
FT                   GSGADVDKVREATMIVKALRSDLEIDGPLQYDAAVDKSVASMKLPNSKVAGEANVFIFP
FT                   DLNTGNNTYKAVERSSGALAIGPILQGLKKPVNDLSRGCSEADVLNTILITAIQANM"
FT   gene            62279..63448
FT                   /locus_tag="Suden_0056"
FT                   /old_locus_tag="Tmden_0056"
FT   CDS_pept        62279..63448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0056"
FT                   /old_locus_tag="Tmden_0056"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43337"
FT                   /db_xref="GOA:Q30UJ4"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43337.1"
FT                   /translation="MKIAVINSGSSSIKFKLYLMPQSIVLAHVHVEKIGETSSKITFRH
FT                   TDKKEVFSNKIDTHHEGLRVINDILKEYQIIEHFSSLDAIAHRVVHGGDFFKSATLINE
FT                   DVIYKIRELIPLSPLHNRANLEGILVSLKKAPSVPQIAVFDTSFHASLPKEAYLYALPY
FT                   ELYKEHKIRRFGFHGISHAYVLKKVAQEMQKNLHGLNMITLHLGNGSSACAIRNGKSVD
FT                   TSMGFTPLEGLVMGSRSGDIDPQIVIYLQKELGYGLDEVEELLNRHSGLIGVCGEIDLR
FT                   EIIKRDDELSHVALDMMTRRVKKYIGAYMALLGRVDAIAFCAGIGENSSEVREKILKNL
FT                   ELFGIELDTKANEKNLTKISKQTSKIEVFVINTDEELEIALEAEALLRA"
FT   gene            complement(63445..63768)
FT                   /locus_tag="Suden_0057"
FT                   /old_locus_tag="Tmden_0057"
FT   CDS_pept        complement(63445..63768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0057"
FT                   /old_locus_tag="Tmden_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43338"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43338.1"
FT                   /translation="MKPSQKKQIKTNQSNTTKKFPKDKPLESAPKNEVKEMFLQWFKKR
FT                   NSVGQIMSKQDVVSNVIAKLDAKQNDALKKAMDELINNGFMEVQSDGLTLVLTQRGSDF
FT                   IRD"
FT   gene            complement(63938..64621)
FT                   /locus_tag="Suden_0058"
FT                   /old_locus_tag="Tmden_0058"
FT   CDS_pept        complement(63938..64621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0058"
FT                   /old_locus_tag="Tmden_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43339"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43339.1"
FT                   /translation="MEQKICFYCNGRLYQLKNRMVKCSLCAKKYSLLKLQRDFDVIDAF
FT                   VESTTARACAIKLNLSYQVVFNRYEQIRKLLIRHSHDYYEYKRDKLDEFEEYMYICQSK
FT                   KKDYTNIIESQNFITFAYEEKVYNFLLPSLKRFQTKPSGNNSEVAHQNEFKKFMLTNRI
FT                   SKLKTLENTIIKFWRFFEVFITPYKGVKSEYFLSYLKEAEFKFNYNKKEQKEILTYLWS
FT                   LEHSS"
FT   gene            64683..65339
FT                   /locus_tag="Suden_0059"
FT                   /old_locus_tag="Tmden_0059"
FT   CDS_pept        64683..65339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0059"
FT                   /old_locus_tag="Tmden_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43340"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43340.1"
FT                   /translation="MIKEIIITQALICSLFAHDMWIDDTLILHYGHMQMIDSHGEEKEI
FT                   KKESIDKVYCSTNSDVFEVENKELRANCDTLFMVLNEVYYTKTPYGTKEQSKDKTKMAI
FT                   SSFKSIESVKRINNDSSAQIFNKGLELSLTNKLSNIKVGDKARLLVTYDGVPKDGVSVA
FT                   YANSFKGVSDKDGAINIRIQEAGLQNIKASLTFKGDGIKSDEIIHSSTLNIKVLK"
FT   gene            65336..65761
FT                   /locus_tag="Suden_0060"
FT                   /old_locus_tag="Tmden_0060"
FT   CDS_pept        65336..65761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0060"
FT                   /old_locus_tag="Tmden_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43341"
FT                   /db_xref="GOA:Q30UJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43341.1"
FT                   /translation="MKKLFLLVMFATLLFSHNLSHVVSKELSVVVSFSFSQKDDFSFQS
FT                   YEVYAPHSEIPFAVGRTDAHSRVSFLPNTSGKWKVKAFSEDGHGKIIEIEVDEEMLPDM
FT                   SAKSSNTFEKTLIGIMILLGFFGLIYIKKKDKKNEKI"
FT   gene            65748..66719
FT                   /locus_tag="Suden_0061"
FT                   /old_locus_tag="Tmden_0061"
FT   CDS_pept        65748..66719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0061"
FT                   /old_locus_tag="Tmden_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43342"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43342.1"
FT                   /translation="MKKYSMLLALCTCLFAHHGVPSISLAGVEGPGAPIETTSSATLPE
FT                   GSLLGYMKVDHAKYKTYTSAKDAEAESSEYFMYGLGYGFNSYFSAYVFVPYYVKSQDNA
FT                   FRTSGFHDVSFQFILGMKYDDGLMLTPNSESLDDMQDWHFTTSFSFTLPTGKSNATMPD
FT                   GSLIDAGMQTGFGEPSFMLGVSATKWFGNDWTLVGDVSYNTFLENSYSDGSKMRFGDEV
FT                   RVNAALAYMLYSKPASKLRLDFNMEANYLHLGRDEENGIKVEATGGEMIYLTPGARLSY
FT                   KTTSVAVGVKLPTWTNLNEEDLQQGAEGKEDYRLLFTFSTLF"
FT   gene            66729..67370
FT                   /locus_tag="Suden_0062"
FT                   /old_locus_tag="Tmden_0062"
FT   CDS_pept        66729..67370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0062"
FT                   /old_locus_tag="Tmden_0062"
FT                   /product="Cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43343"
FT                   /db_xref="GOA:Q30UI8"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43343.1"
FT                   /translation="MHIPDGFISPQTYIPAIAISASLLALAYKKIELDAEKIPLVAGVS
FT                   AISFVMMLIAIPFPGGTTMHLSGVAIISLLFGPWIAFGSISLVLLIQALLFGEGGITSY
FT                   PINIIAMAFVGSFSSFWFYRFFSSRSKNIAIFMAGWSSIFFPAIIIAVVLGIQPLVASV
FT                   DETPLYFPFGLSVTIPSVVIPHIFIAIIEGLVTLSSVKFLRTQFRSVFGE"
FT   gene            67363..67908
FT                   /locus_tag="Suden_0063"
FT                   /old_locus_tag="Tmden_0063"
FT   CDS_pept        67363..67908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0063"
FT                   /old_locus_tag="Tmden_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43344"
FT                   /db_xref="GOA:Q30UI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43344.1"
FT                   /translation="MSDRAWLFVYLGAVVILGFVHNEWIMFTCIIITVALGGGARFKIF
FT                   TKALFVIALFNISISLSYIIYSFFVDVDIFALVLINLRAFAITLLTFTLVRRINLHKAL
FT                   EFNKILAILYGFTYAQIMLLKNMLYNYYDGLKSRGTTLKTSITKKQLQPLLTTLFGTML
FT                   HKSSEQSMGLCSRGLIDD"
FT   gene            67901..68683
FT                   /locus_tag="Suden_0064"
FT                   /old_locus_tag="Tmden_0064"
FT   CDS_pept        67901..68683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0064"
FT                   /old_locus_tag="Tmden_0064"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43345"
FT                   /db_xref="GOA:Q30UI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43345.1"
FT                   /translation="MIECKNLSYNYQDFQLNTIEVLKDISFKIDKGEKVLLLGINGSGK
FT                   STLLKLLNGLLYAKSGEYYFKNELVNKKYLKANSKDFRKSVSLQMQDPSSMLFNPTVYD
FT                   EIAFGLKHFGFESVDERVYHYAKVFEIENILKSSPLSLSGGQKQKVLLASLLCVEPEVL
FT                   LLDEPTAHLDPPTTGWLVEFLDSLDVTALISTHNISLGKELAGRAIVIGINHEIVYDGE
FT                   VQALLEDMPTLIKAQLVHKHKHAHEGVEHKHYHLHSWT"
FT   gene            complement(68810..68898)
FT                   /gene="tRNA-Ser3"
FT                   /locus_tag="Suden_R0002"
FT                   /old_locus_tag="Tmden_R0002"
FT   tRNA            complement(68810..68898)
FT                   /gene="tRNA-Ser3"
FT                   /locus_tag="Suden_R0002"
FT                   /old_locus_tag="Tmden_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(68928..69001)
FT                   /gene="tRNA-Cys1"
FT                   /locus_tag="Suden_R0003"
FT                   /old_locus_tag="Tmden_R0003"
FT   tRNA            complement(68928..69001)
FT                   /gene="tRNA-Cys1"
FT                   /locus_tag="Suden_R0003"
FT                   /old_locus_tag="Tmden_R0003"
FT                   /product="tRNA-Cys"
FT   gene            complement(69027..69113)
FT                   /gene="tRNA-Leu4"
FT                   /locus_tag="Suden_R0004"
FT                   /old_locus_tag="Tmden_R0004"
FT   tRNA            complement(69027..69113)
FT                   /gene="tRNA-Leu4"
FT                   /locus_tag="Suden_R0004"
FT                   /old_locus_tag="Tmden_R0004"
FT                   /product="tRNA-Leu"
FT   gene            complement(69162..69236)
FT                   /gene="tRNA-Gly2"
FT                   /locus_tag="Suden_R0005"
FT                   /old_locus_tag="Tmden_R0005"
FT   tRNA            complement(69162..69236)
FT                   /gene="tRNA-Gly2"
FT                   /locus_tag="Suden_R0005"
FT                   /old_locus_tag="Tmden_R0005"
FT                   /product="tRNA-Gly"
FT   gene            69380..71065
FT                   /locus_tag="Suden_0065"
FT                   /old_locus_tag="Tmden_0065"
FT   CDS_pept        69380..71065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0065"
FT                   /old_locus_tag="Tmden_0065"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43346"
FT                   /db_xref="GOA:Q30UI5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43346.1"
FT                   /translation="MRSDTIKKGFDKAPHRSLLRATGLRDEDFDKPFIGIANSYIDIIP
FT                   GHFFLHEYGEIVKAAIREAGGVPFVFNTIGVDDGIAMGHDGMLYSLPSREIIADSIETV
FT                   MNAHKLDALICIPNCDKIVPGMIMGALRVNVPTVFVSGGPMAAGHKKDGTPIDLATAFE
FT                   AVGEHAEGKITDEELYDIECNACPSGGSCSGMFTANSMNTLCEAMGIALPGNGTVLAMT
FT                   PRRIEMVKAAAKRIVEMAKADDSKYNLKNVLNEKAVHNAFVVDMAMGGSSNTVLHMLAI
FT                   AREAGVDFPIEKINEIADNVAHIAKISPSLTTVHMDDIDKAGGVNAVMKEISRRGGLLY
FT                   LENPTVTGETLGERIADAKILNEEIIHRNENAYSQVGGLSILFGNLATEGAVVKTAGIE
FT                   LNMRQFKGTAICFNSQPEAITGIMKHKVKPGNVVVIRYEGPKGGPGMQEMLAPTALIQG
FT                   MGLGDSVALITDGRFSGATKGASIGHVSPEAAEGGLIAFIEDGDEIELDTDKHLLRLNV
FT                   SDDVIAARKANYKPYKNEVKSKWLKRYQLLVSNASNGAVLKTEL"
FT   gene            71086..72894
FT                   /locus_tag="Suden_0066"
FT                   /old_locus_tag="Tmden_0066"
FT   CDS_pept        71086..72894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0066"
FT                   /old_locus_tag="Tmden_0066"
FT                   /product="Ser-tRNA(Thr) hydrolase / threonyl-tRNA
FT                   synthetase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43347"
FT                   /db_xref="GOA:Q30UI4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43347.1"
FT                   /translation="MNAIAIKHNGEIIDMQTAKECGFEGEQILLDNSEESLNVLRHSTA
FT                   HLMAQAIKSLYPDAKFFVGPNVKEGFYYDFKTSSEIGEGDLKNIEKEMLSLAKKKYEIE
FT                   KYEISMDEAKEKFKDDHLKLFVMQRIPGDRVSIYKQGEFEDLCRGPHLPNIGLIRYFKL
FT                   TKIAGAYLGGDSKNEMLTRIYGIAFADKEALKSYLDMMAEAEKRDHRKLGAEMKMFTFR
FT                   EEVGAGFPIWLPAGGRLRARLESLLFKAHRKRGYEPVRGPEMLRSDLWKTSGHYQNYGE
FT                   NMYFTNIDEIEFGVKPMNCVGHIKIYEEDLHSYRDLPLKYFEYGVVHRHEMTGALHGLF
FT                   RVREFTQDDAHIFCRADQIEEQIIEVVDFVDKIMSTFEFNYKMMLSTKPAKAVGDDSVW
FT                   EVSTQALKNAMDKNGLVYEIDEGGGAFYGPKIDIKITDAIGREWQCGTIQLDFNLPSRF
FT                   ELEYNGENNDKIQPVMIHRAILGSFERFIGILTEHYAGEFPMFIAPTQVAIVPIAPTHN
FT                   DYAKELSDKLMDLGADSEIYSKNDSLNKRVRTAEKTRVPMLVVIGDEEVASRTVAIRDR
FT                   RTREQYNLSESEFLSLIQTKINEVNF"
FT   gene            72891..73409
FT                   /locus_tag="Suden_0067"
FT                   /old_locus_tag="Tmden_0067"
FT   CDS_pept        72891..73409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0067"
FT                   /old_locus_tag="Tmden_0067"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43348"
FT                   /db_xref="GOA:Q30UI3"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43348.1"
FT                   /translation="MSKKTDRVIMNDDIRVPEVRCNVDGAESLGIVSTDEAMERANELG
FT                   LDLVLIAPDAKPPVAKIMDYGKYRYQEERKLKEQKKNQVKIDVKEIKLSVKIAENDINY
FT                   KVKHAREFLAEGKHVKFRVFLKGREMANPESAKDVLLRVWAMIEDVGVMDKEPKFEGRY
FT                   YNMYVLPQK"
FT   gene            73591..75507
FT                   /locus_tag="Suden_0068"
FT                   /old_locus_tag="Tmden_0068"
FT   CDS_pept        73591..75507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0068"
FT                   /old_locus_tag="Tmden_0068"
FT                   /product="Exo-beta-1 3-glucanase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43349"
FT                   /db_xref="GOA:Q30UI2"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43349.1"
FT                   /translation="MKKISTLILSILTILFFWLLIGSFFTLKESNDSSSKLQCVSYAPF
FT                   SKDESPLTFSDGVVISEELVRSDLALLAKYTTCIRTYSTLGLEIVPKIARENGLKMYMG
FT                   AWVSSDKIITKKEINKLISLAKENEDVVKAVIVGNEVLLRGDTSENQLVSYIKQVKEAL
FT                   PNTKVTYADVWEFWVKHPKIKEVTDFVTIHILPYWEDDPMNIEKSIGHLADVRGEVEAI
FT                   LGDKNILIGETGWPSEGRMREDALPSKINQAIFIREFVKLADANGWSYNIIEAFDQPWK
FT                   RVSEGAVGGFWGLFDKDRGDKGVLSAEVSNFSNYKVLMFGSIALVLLFSLLLKNREISR
FT                   KNLMLFYIFNTLFAILFTLSLEQYSVSVRDIWEFSWAALVLCVHIFIYYLTLAYISEDR
FT                   AAYVVGVRDILSQKTRGVDASLMLLFYTSFILVAIVNLSLAFDGRYRNFEVYIFAISII
FT                   SFLFLYRKAYTKLLFGKFEKAVFAIILLSSITIFINETYLNIFSNVWVLISLGYAYMLY
FT                   IGSKKISYSELKKVAFYTVLFLGLFWALKYEFLRNSTLILECANSSSSSLCHIRDALGL
FT                   YIYLGYFGFTALIFTLVGYFTNDKMVLFIALMVSIGAIVLGNTPLGAIASLAALYMLIE
FT                   VDS"
FT   gene            complement(75488..77257)
FT                   /locus_tag="Suden_0069"
FT                   /old_locus_tag="Tmden_0069"
FT   CDS_pept        complement(75488..77257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0069"
FT                   /old_locus_tag="Tmden_0069"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43350"
FT                   /db_xref="GOA:Q30UI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43350.1"
FT                   /translation="MKTEQITLKRLFALILKKRPALVYGQLLTLLGILVSIPIPLMLPV
FT                   MVDEILLNKPAFFVNNIDSIFGGTTPFYYIAIVTFGVVFLRFIYYILGVITTKIFTKIS
FT                   KHVTFMIRAELLNHLKTTSMNEYETIGSGAITANLVTDVNTLDTFIMSSVSRFVASVLT
FT                   LVAVGVVMIAIDPILGFLILIIQPLIMLLSKNMSKKVGALKKEENQKIETFQNNTAETL
FT                   ELFGQIKASNKESYFFSNAIKDAKEIQNASNEYGYKSVAYERLSYTLFLVIFELLRASG
FT                   LLLVAYSDLSIGMMFAMFGYIWFIMTPVQDIISMQYSYASASGAIKRLNKILSLEQELS
FT                   GEKKIDSSEVDISLKNLSFSYIKGKDILKDISLDIKAGSKIALIGASGSGKTTLAQIIS
FT                   GFYEKSGGSLKYNGEDSETLEKSSVREKIFLVLQMPILFNSTLRFNISMGDESITDEQL
FT                   LKALEIAELKEMMDGMPNALDTIVGHHGIRLSGGQRQRLSIARMIIANPSVVVFDESTS
FT                   ALDVHTEAKLHVSLQPLLKSKTVITIAHRLSTVKNADTIYVLDAGTIVQRGTHAELEDE
FT                   EGHYLEFIKNQLL"
FT   gene            complement(77263..78579)
FT                   /locus_tag="Suden_0070"
FT                   /old_locus_tag="Tmden_0070"
FT   CDS_pept        complement(77263..78579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0070"
FT                   /old_locus_tag="Tmden_0070"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43351"
FT                   /db_xref="GOA:Q30UI0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43351.1"
FT                   /translation="MFKKVFPLSAILSLRFLGLFLVLPVISIYALELKGSTPFLVGIVV
FT                   GGYALTQAIFQVPFGSMSDKIGRKPTLLVGLLIFLVGSVLCAYSTDIYTLMIGRFLQGA
FT                   GAIGSVITAMISDLVQEEIRGKAMAIMGASIALSFALAMGLGPVLGAKYGVEFLFILTA
FT                   LFAVLAIILLFTKVPTPPKIKHTYHATAKTSDILKDSNLLNMIVINAMQKGLMTIAFVL
FT                   IPIILTSADFAWQKSDLYMAYLPAMLFGLAAMGPAAVFGEKHNKPKEIFLLSIALFIVS
FT                   FLIMGLTTSSSVFVVGVVLFFIAFNMMEPLVQSMITKFAKVHQKGAALGISNSIAYFAT
FT                   FIGGTSAGLLLGISDRETIGISVGVVALLWFLWTLKLQNPTKYSHLYLPQDDVDTTKLQ
FT                   NLESAHIAEWYINDSEKLIIVKYATGAIQKDDLISKISK"
FT   gene            78689..79288
FT                   /locus_tag="Suden_0071"
FT                   /old_locus_tag="Tmden_0071"
FT   CDS_pept        78689..79288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0071"
FT                   /old_locus_tag="Tmden_0071"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43352"
FT                   /db_xref="GOA:Q30UH9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43352.1"
FT                   /translation="MRLILATSNRGKVKEIKALCKDFKVIPYSELIEEFEIIEDASTFK
FT                   GNALIKARAVFKVLSQKDEYKDMVVLADDSGISVDVLGGAPGIYSARYASKGASDKENL
FT                   YKLIEDVKKSGAKGSPAHYTAAIAIVTKNYEYSVHGWMYGDVIAEVRGDGGFGYDPMFI
FT                   PLGYDKTLGELDDDTKKNISHRAKALSLAKIILQTL"
FT   gene            complement(79420..80190)
FT                   /locus_tag="Suden_0072"
FT                   /old_locus_tag="Tmden_0072"
FT   CDS_pept        complement(79420..80190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0072"
FT                   /old_locus_tag="Tmden_0072"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43353"
FT                   /db_xref="GOA:Q30UH8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43353.1"
FT                   /translation="MTILDSIILGAIEGFTEFLPISSTGHLIVASEFLGLEQNAINKAY
FT                   EVIIQFSAILAVIFNYKDKFSIKKIDLWMKVFIAFLPLAIIGFIFSTQIKELFSLHVVA
FT                   VMFIVGGVVFLIVEKFFINEDEKTIYEVEAISLKQSLIIGFAQIFALIPGTSRAGSTII
FT                   GALLVGLSRKASAEFSFLLAFPVMGAVTAYDLLKHYKDFSEANLIILGVGFVTSFVVAY
FT                   LSIKLFLKFLEKFTFFFFGVYRIVFGVILLLFFN"
FT   gene            80317..81429
FT                   /locus_tag="Suden_0073"
FT                   /old_locus_tag="Tmden_0073"
FT   CDS_pept        80317..81429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0073"
FT                   /old_locus_tag="Tmden_0073"
FT                   /product="Aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43354"
FT                   /db_xref="GOA:Q30UH7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43354.1"
FT                   /translation="MLLFTPGPTPVPQNVRNAMSDETMHHRTPEFEAIFFKTREYLFKL
FT                   FGSDEVVMLSSSGTGAMEAAVVNLCHNTLLNVNSGKFGERFGKIALAHGLGNVEIKNEW
FT                   DTPVSVEEVIKAIKENSNIDAIAVQISESAGGLRHPVEAIAKAVKELNPNIMIIADGIT
FT                   ALGVEKIDIAYIDCLIAGSQKALMLPPGLAILGLSNAAIEKIGKGRGYYFNLATEIKSQ
FT                   RKNTTAWTAATTLTIGLLEILETIERNGGLDKLYADTASRAKAVMASLVAIGLHVYPKT
FT                   PALSMTTIDDEDASKIRKILKTDFDVNVAGGQDHLDGKIFRINQMGIIAPYEISWVVNS
FT                   IELALDKLGRRAYNGEANRVFNENYFKVGK"
FT   gene            81430..82278
FT                   /locus_tag="Suden_0074"
FT                   /old_locus_tag="Tmden_0074"
FT   CDS_pept        81430..82278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0074"
FT                   /old_locus_tag="Tmden_0074"
FT                   /product="tRNA synthetase, class II (G, H, P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43355"
FT                   /db_xref="GOA:Q30UH6"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43355.1"
FT                   /translation="MILEHEIPSGSKLYFGNSAKIKREIEKVASDILYSRGFEEIVTPI
FT                   FSYHQHKSIANEKELIKVNDEKNNSISLRADSTIDVVRIIEKRLGRNTEHKKWFYIQPV
FT                   FRYPTDEQFQIGVEFMGESKLSSVLNIAIEIFNTLEVYPLIQISNMMIPKLLVEMFDDL
FT                   TLDDFRHVNIEKFLAQRVDWLEKLVYLQHPEQVDKLLEIVPQKIKIELEKMKSLCEAIG
FT                   CPNSVLAPMYYAKMLYYDELFFRIIDKNEVYARGGRYKNLELSSVGFAIYTDVLIETKA
FT                   K"
FT   gene            82325..83584
FT                   /locus_tag="Suden_0075"
FT                   /old_locus_tag="Tmden_0075"
FT   CDS_pept        82325..83584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0075"
FT                   /old_locus_tag="Tmden_0075"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43356"
FT                   /db_xref="GOA:Q30UH5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43356.1"
FT                   /translation="MPSRKADLIVGIQWGDEGKGKIVDRLAKEYDMVCRSQGGHNAGHT
FT                   IWVDGVRYALHLIPSGILNPKAVNVIGNGVVLSPESIIKEMLQFENLEGRLFISDKAHL
FT                   NLSYHSLIDQAREKLKGDKAIGTTGKGIGPAYSDKINRVGMRVGELLNPEKLCERIVEH
FT                   FEQNRDIFAILNINMPNKNELLEELKGYSEKLSPFITDTTQLIWRALDKENKRVLLEGA
FT                   QGTMLDIDHGTYPYVTSSSTISAGACTGLGINAKDIGKVIGIVKAYCTRVGNGPFPSED
FT                   LGKDGKLLGERGHEFGTTTGRARRCGWFDAVACRYASRLNGCDELALMKLDVLDGFDEV
FT                   KVCVAYELNGAQIDYLPANLDDVKPIYKSFKGWDKTEGARRFEDLPKEAQDYIKIIEEI
FT                   TKTKVGIISTSPEREDTIIL"
FT   gene            83666..84040
FT                   /locus_tag="Suden_0076"
FT                   /old_locus_tag="Tmden_0076"
FT   CDS_pept        83666..84040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0076"
FT                   /old_locus_tag="Tmden_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43357"
FT                   /db_xref="GOA:Q30UH4"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43357.1"
FT                   /translation="MQSSERFLQRANNNLNSAISALELSYNSLKDLGSPQKGAMREMLA
FT                   TRALLDSQREIINHNKEWIAFAKNQVTQAKEQLKIDMIEYEKFKYLELQEIKAELKKMN
FT                   AKEAKDLDEIALMTYIGKAR"
FT   gene            84037..84549
FT                   /locus_tag="Suden_0077"
FT                   /old_locus_tag="Tmden_0077"
FT   CDS_pept        84037..84549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0077"
FT                   /old_locus_tag="Tmden_0077"
FT                   /product="PDP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43358"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43358.1"
FT                   /translation="MMKIFFIILLFMLPLIALETSDKLFECTEIFKARKSELLIELERI
FT                   DEQKQALSALKVATEELLKKREAKVSQEEESVSKSLSEITSKEESIKKMLQENEEVLKE
FT                   IKEVKMLKMSETFAKMKAANAANVLSEMDALEAAAILSSLKPKTIGTILSKMDAQKASE
FT                   LTLLLAK"
FT   gene            84610..86481
FT                   /locus_tag="Suden_0078"
FT                   /old_locus_tag="Tmden_0078"
FT   CDS_pept        84610..86481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0078"
FT                   /old_locus_tag="Tmden_0078"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43359"
FT                   /db_xref="GOA:Q30UH2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43359.1"
FT                   /translation="MLNNISFYNFMHKQILVLIALFVSTATSYVFIGIAYSSYIIEPLW
FT                   YMFVLTLSYFGYKLYVEYSDSNLTIQEKEIWLKKLRYFIFSYFSSWTIMFVVYAMRDNI
FT                   ELHYLAIFTQLGVSVVATTLLVSEKKLATFILASSMLPITIYLLLIGEFYSYIIAILTI
FT                   VLAWVLYYGLRNTYGYLQKNQYQANHDYLTNLGNRRYFVELLKDAIKKQKSNNKYMFLF
FT                   LIDLDHFKTINDTLGHDIGDKLLSEVAKRMGLLAKLNRSTISRIGGDEFCLLSDTYEDK
FT                   VTCLKRAQSFAQELLETIKHTYIVDEHNLYISSSIGVSIIDNPNITANTLIKEADIAMY
FT                   EAKLKGRDGVILFNNELSVRVERKLEVERFLRFAIKKEEITLNYQPQVDKKGKVVGCEV
FT                   LVRWHNEQLGSVGPDEFIPISEQTGFIIELGHYILEESFKTLSEWDKKGLKLEQFSINI
FT                   SMRQMFCNTFIDDMLLLCAKYLNDSLSSKLIFEITESSAAEDIPKLINTMNRAKACGIR
FT                   FSMDDFGTGYSSLSYLRQIPIYELKIDKAFINELGNPKKDANMVKTILNIAKNLGLSVV
FT                   AEGVETQMQEKFLIDEKCDILQGYYFSKPLSKDKFEEFYLKGKISSL"
FT   gene            86546..87097
FT                   /locus_tag="Suden_0079"
FT                   /old_locus_tag="Tmden_0079"
FT   CDS_pept        86546..87097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0079"
FT                   /old_locus_tag="Tmden_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43360"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43360.1"
FT                   /translation="MKISLKTIPHIANKIAIDLNKSDVVKMTKGLEPIAKEAEKILSHD
FT                   AKQEMALEEKTHQICEANEEEIEFNLVDERQLFFMIKKKLAPEFGVILNYEERYSDISH
FT                   KILDELYEEDLIHFDVTENRIKNIIYNSITSFITEASELDNIIMDKIKTYKKRYIPGTD
FT                   EFDILYEKIYREELTRRGME"
FT   gene            87099..88244
FT                   /locus_tag="Suden_0080"
FT                   /old_locus_tag="Tmden_0080"
FT   CDS_pept        87099..88244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0080"
FT                   /old_locus_tag="Tmden_0080"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43361"
FT                   /db_xref="GOA:Q30UH0"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43361.1"
FT                   /translation="MSMELLKKRAWIYLENGIFLEANSFGAESTVVGEIVFNVSMSGYQ
FT                   EIMSDPSYAGQFVTFTMPEIGNVGVNAQDMESKSAHAKGMIVRKYQDRYSSFRAEDSLS
FT                   NFLKKQNVMGICDIDTRYLTKMLREEGSMMMIASTEISNKDELKKILQNSSRIEHVNYI
FT                   EQVSTKVAYKHTQSTYNDREFKFDEAPASEANIVVLDFGVKTNILNELVSAKIGVEVIP
FT                   NNFSGDELIKRYNNKEIDGVFLSNGPGDPLVLKHEQREIKKLIDAKVPMFGICLGHQLL
FT                   SIAHGYDTFKLKFGHHGGNQPVKNMRTGLVEITAQNHNYNVPDNIVEVAEVTHTNLFDN
FT                   TIEGLKYNDSPIFSVQHHPESSPGPKESRYIFNEFLSLIKR"
FT   gene            88469..89962
FT                   /locus_tag="Suden_0081"
FT                   /old_locus_tag="Tmden_0081"
FT   CDS_pept        88469..89962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0081"
FT                   /old_locus_tag="Tmden_0081"
FT                   /product="FixN; Cbb3-type cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43362"
FT                   /db_xref="GOA:Q30UG9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43362.1"
FT                   /translation="MENRPLEYDYTIAKMFMLTTIVLGIVGMLIGVILAFQLAYPGLNL
FT                   ILGDNLAEYTNFSRLRPLHTDAVIFGFTLSGVFATWYYVGQRVLKVSMAESKLLMALGK
FT                   LHFWLYLAVVAAVVVSLFAGVTTSKEYAEFEWPIDIGVVVVWVLFGMSIFGLIGIRREK
FT                   SLYISVWYYIATFLGIAMLYLFNNMEIPTMFATSPAGESGIGAWYHSVSMYAGTNDALV
FT                   QWWYGHNAVAFGFTVPIVAMIYYFLPKESGQAIYSYKLSLLSFWGLMFVYLWAGGHHLL
FT                   YSTVPDWMQTMGSIFSVILILPSWGSAINMLLTMKGEWQQVAASPLIKFMILASTFYMF
FT                   STLEGPIQAIKSVNAIAHFTDWIVGHVHDGVLGWVGFMIMAALYHMAPRVFKREIYSKA
FT                   IMTAQFWIQTLGVVLYFTSMWIAGITQGMMWRAHDEFGNLAYSFIDTVTVLHPYYTIRG
FT                   IGGLLYLVGFLMFAYNIYKTMSSRPVEERELQNASPMGA"
FT   gene            89978..90670
FT                   /locus_tag="Suden_0082"
FT                   /old_locus_tag="Tmden_0082"
FT   CDS_pept        89978..90670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0082"
FT                   /old_locus_tag="Tmden_0082"
FT                   /product="FixO; Cbb3-type cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43363"
FT                   /db_xref="GOA:Q30UG8"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43363.1"
FT                   /translation="MFHWLEKHPFFFAVGVFIAIAFAGLIEILPNFAQASRPVIGTAPY
FT                   STLELAGRHVYIKNSCNACHSQLVRPFKSETDRYGHYSLSGEYAYDRPFLWGSKRTGPD
FT                   LMRVGNYRTTDWHENHMKDPQSVVPGSIMPAYNWMFTNKADIDTAYAEQLTVAEHFSVP
FT                   YNQDVPMRDGSVKNVKMAQSLKGAHDIALEEAKIVAVDMKDQDVKDAVARGEIPEIVAL
FT                   IAYLNSLK"
FT   gene            90680..90883
FT                   /locus_tag="Suden_0083"
FT                   /old_locus_tag="Tmden_0083"
FT   CDS_pept        90680..90883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0083"
FT                   /old_locus_tag="Tmden_0083"
FT                   /product="FixQ; Cbb3-type cytochrome c oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43364"
FT                   /db_xref="GOA:Q30UG7"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="InterPro:IPR014107"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43364.1"
FT                   /translation="MNIAEIQAYGYFILTFALVLVLYGYIYHLYTKKRDADGVDYESYS
FT                   NMALKDDIDDAPVSAVSEEKEK"
FT   gene            90893..91816
FT                   /locus_tag="Suden_0084"
FT                   /old_locus_tag="Tmden_0084"
FT   CDS_pept        90893..91816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0084"
FT                   /old_locus_tag="Tmden_0084"
FT                   /product="FixP; Cbb3-type cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43365"
FT                   /db_xref="GOA:Q30UG6"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43365.1"
FT                   /translation="MNKLYLGGAIFTVLMLILTYLSVGTSKGGFNGDIVNMLAIAGAIA
FT                   LVIITVFVVIKYVRQMQVDSATGELADENWDGIGEYKNSLPTGWAVMFLLTMIWGMWYF
FT                   TIGYPVNSYSQIGEYNEDTAVHNAKFEAKYKDITGDRLVEMGESVFLAECKVCHGINAD
FT                   GIDGKAANLNKRIDAASVKHVIENGSNYQLLGSEMPMPDRNGLFNNNTGALITDAEIEV
FT                   VSKYVANGMSGDGADIFVGACSACHGEDGKGMEAVAPNLVAFSPVLVTNVLTHGKKGMI
FT                   GVMPKFDRLNDKQKEAVGAYITNISK"
FT   gene            91827..92036
FT                   /locus_tag="Suden_0085"
FT                   /old_locus_tag="Tmden_0085"
FT   CDS_pept        91827..92036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0085"
FT                   /old_locus_tag="Tmden_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43366"
FT                   /db_xref="GOA:Q30UG5"
FT                   /db_xref="InterPro:IPR025065"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43366.1"
FT                   /translation="MNENRSVFSIDGITGMLVATVLLLSILVGLTLWAINVQHASAANY
FT                   YDIKDEASIKMFGSNVADHVVDVK"
FT   gene            92144..92848
FT                   /locus_tag="Suden_0086"
FT                   /old_locus_tag="Tmden_0086"
FT   CDS_pept        92144..92848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0086"
FT                   /old_locus_tag="Tmden_0086"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43367"
FT                   /db_xref="GOA:Q30UG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43367.1"
FT                   /translation="MKFSRGLYALLLTLFFNSSLVAQYLYKDELIFNPAFNVEIEKLGS
FT                   ELYEKTGISLRLVMLKKLPDSKNIVEYEEQLLAEFDKPTILLTFSQMDTKVDILANETS
FT                   LYNYFDKKQILSPVASVVQAFTIALFYSDSFAMFKEIISDYGGTIIPLLAQKSKDNELL
FT                   GKYSGSMFNGYADIADQIASSKGVVLENSVGSANQQSIFVVKVLFYGFVLYGIYMYIKR
FT                   KLYLRKQKNETK"
FT   gene            92835..93341
FT                   /locus_tag="Suden_0087"
FT                   /old_locus_tag="Tmden_0087"
FT   CDS_pept        92835..93341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0087"
FT                   /old_locus_tag="Tmden_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43368"
FT                   /db_xref="GOA:Q30UG3"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43368.1"
FT                   /translation="MKLNNGRIWPYAISASIIFIFGACIATIVVTSSLPVQESDTYMMS
FT                   YHDADAKANELIKAKIDFDKKYNIEYVTQTFTKDKSVIAYKISDKESNPVNNATIKVVL
FT                   TRPSTLKNDQELNNPSVENGVYTFEPTTLSADGRWDIMAQVSVGETSRFYNIKTDTRGM
FT                   NIVEY"
FT   gene            93356..95701
FT                   /locus_tag="Suden_0088"
FT                   /old_locus_tag="Tmden_0088"
FT   CDS_pept        93356..95701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0088"
FT                   /old_locus_tag="Tmden_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43369"
FT                   /db_xref="GOA:Q30UG2"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43369.1"
FT                   /translation="MNNQTIVLPSARSIRNEQLKLEGENLFLAHFITMSDFISRLCIVK
FT                   DFKILDEDSRVLLLLEASDFSDFKNLQIERNFFTFTKNSSYIFKFFQELSAELYDIKEL
FT                   ENSDIYAEFAEHIAILQELHKRYEKLCSERKFLDKIFLPKLYTFNEEYAKSHEALELHV
FT                   DGHLTNFEFELLHKCCEFCSVELIFSTSRFNSKMRVKFAELGIELEVGYRYKISLNEKK
FT                   IVETKKIIHNKNIVADSFSEPILQAAFVKKKIYDFIKKGYKAENIALILPDEKFATVLG
FT                   VFDEKSNFNFAMGEPFTNTQIYKKLNATCKYIEQDSKENYARLRREGDEFLIKLSAIYM
FT                   GKSKDVDVLEFLKEYKESSSSKKEIKIFDEELYKFKNILPFMREMSVKSVINLFMQRLS
FT                   KRTLDDVRGGKITVMGVLETRSVTFEAIIIVDFDDSNVPKKSDKDMFLNTQVREMANLP
FT                   TMSDRENLQKHYYEMLINGSKEVAISFVKSKESAGSRFLKQLNIKENNQHNEQEYASLL
FT                   FSRAGVNKQQEREISFDYSFRGKTLSATKLKTFLTCKRKYYYRYIMQLKNHEIPKDMPK
FT                   EHEIGSDVHKALKELYTKKSSYESLEELRKDLHKEMSCASGESELEGYLMAVQERRMSV
FT                   FVQNEIKRFAEGYVVLECEKSLSVEFGGMVLNGQIDRIDIKENELYVLDYKTGSYPIYT
FT                   QKNFTEATDFQLEFYYLLASTLGQVKECGYYDLKESKIVTEPLLSEKLSILGSHVKDLL
FT                   NIEHLNFSKCEDIKNCQFCEFKIICQRE"
FT   gene            95702..95935
FT                   /locus_tag="Suden_0089"
FT                   /old_locus_tag="Tmden_0089"
FT   CDS_pept        95702..95935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0089"
FT                   /old_locus_tag="Tmden_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43370"
FT                   /db_xref="GOA:Q30UG1"
FT                   /db_xref="InterPro:IPR018668"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43370.1"
FT                   /translation="MKEEEKNKNNPLHGVTLQHILEVLIERYGFKELGAKVDIRCFLIN
FT                   PTISSCLKFLRKTPWARAKVEELYIKSMGKQS"
FT   gene            95937..98648
FT                   /locus_tag="Suden_0090"
FT                   /old_locus_tag="Tmden_0090"
FT   CDS_pept        95937..98648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0090"
FT                   /old_locus_tag="Tmden_0090"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43371"
FT                   /db_xref="GOA:Q30UG0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43371.1"
FT                   /translation="MVINNLAYEASAGSGKTFMLVVRYLSLLFMGAKASRILALTFTNK
FT                   AASEMQERIIATLEELEHRGELDEILRVTGLSIEYLLENRQRVLDEFLNSHTKIMTIDS
FT                   FFTKILRKFSLYASLMPDFSTFSSQHELKLLSRFLKEVSITNQKERLISLWLSSNKRLS
FT                   DIFELLDEFYVKFAELKHIEFKKQNIEVFEEEALSYMSELKTIVTSCPSASSTAIKSVE
FT                   AKDFEELCSKSWLERESLDYRTFAKCYTPAMDELLHKIKDAIKNQNRGREQNFFFSLKG
FT                   LVDTYIKSKKALYMDDNELSFSDVTYLVYQILKLLGDDSEFLYFRLDAQIEHILLDEFQ
FT                   DTSILQYEILKPLIDEITSGEGIFKNGSFFFVGDVKQSIYRFRGGVSALFESVARENST
FT                   HVEKLLTNYRSQREIVSFVNSVFIDKIKNYTPQLYREAANYGYVEVVQNDEVLEEVVAQ
FT                   VKSLLALGADIDEIALLCATNRDGSSVKEALEAENIEVVTETTTKLINQNSVKALLEYL
FT                   KFHYFGEAIYAHNFFALISQEFRPMCRIDFNRVELLQVVKGAIREFSLFSDSFNLLRFL
FT                   DAISRYNDIEALLFEYERMDVSAAASELRGVRVLTVHKSKGLEYEHVIVMDRLTKTPPS
FT                   REAVIYEYDGLTLENIYLRIKGRESVDEKYALALLKEKALQVEDSLNAHYVAFTRAREN
FT                   LIVVLKSKESIFDILDLRVQKNGVLKCTSKEKNIKKEFIPLEYQELFYGTQSDILELEK
FT                   EQEGDFVSINFGIAMHYMLEMLGEFKTKNIANAKDSMINKYGALLQESEIKDIQKRVEM
FT                   LLENSEFISIVDGVCYREKALRYKNSLRYIDLLVRSKEGYNILDYKSSNLYMYEHVKQV
FT                   RSYVKAVEEITKKSALGYIIYLLEDEIKIVKV"
FT   gene            98700..99212
FT                   /locus_tag="Suden_0091"
FT                   /old_locus_tag="Tmden_0091"
FT   CDS_pept        98700..99212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0091"
FT                   /old_locus_tag="Tmden_0091"
FT                   /product="NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43372"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43372.1"
FT                   /translation="MFKNFFIITFFFLCTALLANTQSDEDYGFPHISEDISEQERVIEP
FT                   LTTRLLSKAEEFLGTPYRFGNKGEKKTDCSGFTQQVFGEFGILLPRSATEQSKYGKKIE
FT                   LKDLKVGDLLFYRTYKKAPSHVGIYAGDGKIIHASYRNKKVQYDAIDKGYYKKRFLYAK
FT                   RIVSKDD"
FT   gene            99332..99754
FT                   /locus_tag="Suden_0092"
FT                   /old_locus_tag="Tmden_0092"
FT   CDS_pept        99332..99754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0092"
FT                   /old_locus_tag="Tmden_0092"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43373"
FT                   /db_xref="GOA:Q30UF8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43373.1"
FT                   /translation="MKFTKIATPEQIDQKWVLIDAEGKTFGRIITEVATLLRGKNKPCF
FT                   TPNIDCGDYVVVVNASKAKFNGLGKIANKEYFSYSGYFGSVKSTKMTELLEKNPEKLYK
FT                   LATRGMLPKTKLGAKMIKKLKIYASAEHPHSAQLAK"
FT   gene            99765..100154
FT                   /locus_tag="Suden_0093"
FT                   /old_locus_tag="Tmden_0093"
FT   CDS_pept        99765..100154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0093"
FT                   /old_locus_tag="Tmden_0093"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43374"
FT                   /db_xref="GOA:Q30UF7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43374.1"
FT                   /translation="MKKVYATGRRKASIAKVWLTPGAGTMTINGLSLDAWLGGLEAKKL
FT                   RVKQPLALTKQDTSVNIVATVLGGGFGGQADALRHGISRALVRFNPELKAILKPEGMMT
FT                   RDSRVVERKKPGKRKARRSRQFSKR"
FT   gene            100269..101765
FT                   /locus_tag="Suden_0094"
FT                   /old_locus_tag="Tmden_0094"
FT   CDS_pept        100269..101765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0094"
FT                   /old_locus_tag="Tmden_0094"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43375"
FT                   /db_xref="GOA:Q30UF6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43375.1"
FT                   /translation="MRYLLPLILSFHLFASTLHLATSTNPARLNPILATDSSSSEISGF
FT                   IFNGLVKYDKDLSTIVGDLAESFYFEDEKTLLFKLRSNVKWHDGEKFSANDVLFTYNTL
FT                   ISPKISSPYSSNFRFVESVEVVDELTLRVRYKEPYFKALETWMMGILPLHVLRDEQNLM
FT                   SSSFNTNPIGTGAYKLHQLEYSKNIVLRAFDEYFEGRSKIDTISFHVIADPTTRFLMLK
FT                   SGALDIGSIEPMQYERQLDKSFFDKFDIYENISQSYTYLGFNLRVEKFQNPKVREALSL
FT                   AINREELVKILFFDHAKVCRGPFLPATNAFNEDVKAPKQDIKRAKELLREAGYDESNPF
FT                   TFEITTSNSSDIRPYAAQILQHQLKESGVVVTLRVMEWQAFLNMVVFPNKFESVLLGWG
FT                   LSPTPDPYMFWHSESDKSGGFNLVGYHNEEMNEMIEKSQSMIDAKELSFIWQKMFKMIT
FT                   DENPYLFLFIPNSITTVNKKIKNIEPSPSGIWHNYIKWEK"
FT   gene            101767..102405
FT                   /locus_tag="Suden_0095"
FT                   /old_locus_tag="Tmden_0095"
FT   CDS_pept        101767..102405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0095"
FT                   /old_locus_tag="Tmden_0095"
FT                   /product="HAD-superfamily hydrolase subfamily IA"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43376"
FT                   /db_xref="GOA:Q30UF5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43376.1"
FT                   /translation="MIILFDLDGTLIDSTDAILESFHHSFSKHKHDKRKDEEIKALIGY
FT                   PLDIMFENLGIDEEEVWDMVATYKEHYREISTQKTELLKNAREAVLLAKEFATLGIVTT
FT                   KTARYSKELMEYFDLMKHFEVLIGREDVQNPKPHAEPILKALEKMDVKNREIWMIGDTK
FT                   LDIIAAKNANVNSIGVLSGYEDLKSLKEFTNVIFNDVLEATIYLQSRKK"
FT   gene            102533..103090
FT                   /locus_tag="Suden_0096"
FT                   /old_locus_tag="Tmden_0096"
FT   CDS_pept        102533..103090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0096"
FT                   /old_locus_tag="Tmden_0096"
FT                   /product="Pyruvate:acceptor oxidoreductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43377"
FT                   /db_xref="GOA:Q30UF4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43377.1"
FT                   /translation="MLEIRWHSRAGQGAVTGAKGLADVISTTGKHVQAFAFYGSAKRGA
FT                   AMTAYNRVDDKVIMNHEKYMKPDYVFVIDPALVFTSDVTINHKDSTKYIITTHLTTEEL
FT                   IKAQPKLEGKEVYTVDCITIANETIGRPIPNTPMLGAFMKVSKMYDIEFFKESMQRILG
FT                   KLPQKIIDANMFAIQRAYDEVK"
FT   gene            103101..103496
FT                   /locus_tag="Suden_0097"
FT                   /old_locus_tag="Tmden_0097"
FT   CDS_pept        103101..103496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0097"
FT                   /old_locus_tag="Tmden_0097"
FT                   /product="Pyruvate:acceptor oxidoreductase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43378"
FT                   /db_xref="GOA:Q30UF3"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43378.1"
FT                   /translation="MAKKGWDEFEIGAMLRTFDGKIDDIAGTQQEDRAYSQSSSYTASV
FT                   ADWRLIKPIFNKDYCIDCQFCWVYCPDVSIISRDKKLIGVDMDHCKGCGICVEVCPTNP
FT                   KSLLMFPEQADEETEIASWPKKDEEEA"
FT   gene            103496..104719
FT                   /locus_tag="Suden_0098"
FT                   /old_locus_tag="Tmden_0098"
FT   CDS_pept        103496..104719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0098"
FT                   /old_locus_tag="Tmden_0098"
FT                   /product="Pyruvate:acceptor oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43379"
FT                   /db_xref="GOA:Q30UF2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43379.1"
FT                   /translation="MAFDKMELRDIEVWDGNFAAAQAMRQSQIDVVAAYPITPSTPIVE
FT                   GYAQFLADGYIEGEFVMVESEHAAMSGCIGAAAAGGRVATATSSQGLALMSETLYQASG
FT                   MRLPIVLNLVNRALASPLNVNGDHSDMYMVRDSGWIQFDAFCPQEAYDLNLIAFRVAED
FT                   HDVRLPAIVNQDGFMTSHTAQGVHTLTDDVAYGFVGEFKPMNDMLDFEHPVTHGVQTEE
FT                   DWHFEHKARQHNDLMTKVMPKIKEVFADFEKLTGRKYSPVEKYDMDDADVCVVCLGTSV
FT                   ETAREVAKEMRTQGIKAGVIGLRVIRPFPFFEIAEALKNVKAIAALDRSSPNGAAGMLF
FT                   NEIAGSLYNTQNRALLSGYIYGLGGRDLTKAHLVSLFKELQANVDAGKVTTQLQQFIGV
FT                   RGPKLAYL"
FT   gene            104730..105686
FT                   /locus_tag="Suden_0099"
FT                   /old_locus_tag="Tmden_0099"
FT   CDS_pept        104730..105686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0099"
FT                   /old_locus_tag="Tmden_0099"
FT                   /product="Pyruvate:acceptor oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43380"
FT                   /db_xref="GOA:Q30UF1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43380.1"
FT                   /translation="MSEMKNIKNLKEFSTSADRFEGANLLCPGCAHSIIVREVLNATND
FT                   DLVLSASTGCLEVCTAVYPYTSWDASWIHIGFENSSTAVAGAETMYKALKKKGRLKQPE
FT                   RNPKFVSFAGDGASYDIGFQWISGCMERGHNMMHVVLDNEVYANTGGQRSSSTPIGSSA
FT                   TTSPAGRVSYGEKRNKKDMMSIMAAHGIPYAAQVAPNKWKDMVKKIQHGLSVEGPVFIN
FT                   AVSPCTTEWKFDPKDTMHITDLATDSLVFPLYEIIDGTELNITYRPKNVVPVEEYLAAQ
FT                   GRFKHLFKDEYKYLIKEWQERVDAKWAYLQRREESRV"
FT   gene            106659..106982
FT                   /locus_tag="Suden_0100"
FT                   /old_locus_tag="Tmden_0100"
FT   CDS_pept        106659..106982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0100"
FT                   /old_locus_tag="Tmden_0100"
FT                   /product="nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43381"
FT                   /db_xref="GOA:Q30UF0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43381.1"
FT                   /translation="MAICGFIISESQKAMLLSIPVLAGAILRMVLGFGIDKFGVKITAL
FT                   ASQLVVIIVLFYAYFRGASLSYDELLFVAIGLGFAGTSFAVALPQAGQSYPLKLQGTVL
FT                   GIA"
FT   gene            107076..107408
FT                   /locus_tag="Suden_0101"
FT                   /old_locus_tag="Tmden_0101"
FT   CDS_pept        107076..107408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0101"
FT                   /old_locus_tag="Tmden_0101"
FT                   /product="nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43382"
FT                   /db_xref="GOA:Q30UE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43382.1"
FT                   /translation="MSSIIFVTYIFIAKDALLEVYTPQPKKLRDYAKLLQYKDTWWFNL
FT                   FYAVSFRGFVGFAGYMKVYFINSYQADMSAFGVDILNEPNVKVVAGYFGVLCLFLELLL
FT                   KDFSSL"
FT   gene            complement(107403..107579)
FT                   /locus_tag="Suden_0102"
FT                   /old_locus_tag="Tmden_0102"
FT   CDS_pept        complement(107403..107579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0102"
FT                   /old_locus_tag="Tmden_0102"
FT                   /product="Molybdopterin oxidoreductase Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43383"
FT                   /db_xref="GOA:Q30UE8"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43383.1"
FT                   /translation="MIKSVCGYCGVGCGVVYDDSKLLGDVSYPINNGNLCLKGASRLLS
FT                   INPQTSWAKYRRL"
FT   gene            107741..108334
FT                   /locus_tag="Suden_0103"
FT                   /old_locus_tag="Tmden_0103"
FT   CDS_pept        107741..108334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0103"
FT                   /old_locus_tag="Tmden_0103"
FT                   /product="NorG; Nonelectrogenic quinone-oxidizing nitric
FT                   oxide reductase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43384"
FT                   /db_xref="GOA:Q30UE7"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43384.1"
FT                   /translation="MTDSVDVLNMLKIVYTLYTLAVISLICWFGLGVVNPKGKPRIVKA
FT                   STFYVYVGVLITVGVAIHIVTFNKIPWVEIDFKRDSLKASQVVNITIEDHKFILPSPII
FT                   ELKCNEYVMFDVISKDLTYGFGIFRQNNSMVTQMQVVPGNKNDLMWKFGKNGVYHLRST
FT                   EYSGPKGAHMYIKDVFEVTGCIEDDKYSQKRGSL"
FT   gene            108331..109968
FT                   /locus_tag="Suden_0104"
FT                   /old_locus_tag="Tmden_0104"
FT   CDS_pept        108331..109968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0104"
FT                   /old_locus_tag="Tmden_0104"
FT                   /product="NorH; Nonelectrogenic quinone-oxidizing nitric
FT                   oxide reductase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43385"
FT                   /db_xref="GOA:Q30UE6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43385.1"
FT                   /translation="MSFLHTLIYGNEGGLKTDGLTPTQKVTLRAVIIGVLYYGLSALEG
FT                   MMMRVHAITPLPMLNDTHYFSVMTVHPIVGIFGSTYLIVFGAFTFLVPYLMKKPLYSIK
FT                   LANATWMLIALGALLAWLGGFLFHYAPLYTLYWPLPVDFKQFDAVGGLVFISGIALIMI
FT                   GTLGFIYNIFATVFYTEEGHEKRAFKPLLLSALGIDGILNIWYKMTGREPYSKEPAVSL
FT                   PVVAIFRGTIDTFLDALVILTCGVLILVYIIGDLSGAPMDYTAVNALLYKNFFWWGLDL
FT                   IADGLVLIYIAGSWYLLAMLITGKKLFMQNIARAALLLELIVSWAVWSHHLLADQGQYN
FT                   MMKLVSGEMVTAFELVTQGIAIFITLVTLWSARPLKMTNELKFLLGGILGFMLAVPAGI
FT                   IQADMGLNRILHNSQWVAGPHFHVAILVGLTMTLYSAIYILWPTLTNGVKLYSQKMAMY
FT                   HFWAHLIGGIGMGAFMGMAAMDGMLRRTLYLEGEYQTYMILAGICGLLLLSAWIVFLLN
FT                   VVLSIGIKGLIGIFTKSKLQTKDLVPEV"
FT   gene            109984..110580
FT                   /locus_tag="Suden_0105"
FT                   /old_locus_tag="Tmden_0105"
FT   CDS_pept        109984..110580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0105"
FT                   /old_locus_tag="Tmden_0105"
FT                   /product="NorJ; Nonelectrogenic quinone-oxidizing nitric
FT                   oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43386"
FT                   /db_xref="GOA:Q30UE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43386.1"
FT                   /translation="MVNIQKVSNQILNDALYNTLLFEIKEKLSLQDITPVMVENLLREE
FT                   PSLLTEYKEINRQSELSSIQVKELVINKNDTYKIIKIKKEINQNIQILKNLENFETDSK
FT                   NSAYPIWIGSVGVMVIFMAHNVIALFSELYSTHSLLVYGSFALILFFTYFGYIKIKKNH
FT                   DSQHQLFKKIYVTTQRMIKDGLKASNFTHDEVYEK"
FT   gene            complement(110736..113744)
FT                   /locus_tag="Suden_0106"
FT                   /old_locus_tag="Tmden_0106"
FT   CDS_pept        complement(110736..113744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0106"
FT                   /old_locus_tag="Tmden_0106"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43387"
FT                   /db_xref="GOA:Q30UE4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43387.1"
FT                   /translation="MGFYIKLDLKLKLLIILVIPLLFVIGLSITILYGMLVDKNNLEFT
FT                   KHHILEAEAISKAVHSLQIERGVTTELLANDGIDENTQQLLIAKENSNIAINEAKRVML
FT                   SCQTCIDSTSLKLLDILALRENANLLNIPLSEARCFYTKNIASLLNLIKTIPSLIEDKD
FT                   NRNCIQSYSYLSSAKEELGQIRSILVQALLSRDVSDDIFILFKEHLKVYNLETQNFKTA
FT                   SNKDIINFYNDVFTGEDVDEMFKIINDIVKNKNKFSLTTDYSQWFQRATKSMNLLRNVE
FT                   ERLFNTINTLVNQKLDSIHYKLAMLLSFLGLSAIIVTILLLLIARKILFSASSLESKYD
FT                   NSLLLLEQYKSTIDRGFIVSKNDKNGIISYVNDEFCKISGYTKEELIGKTYDLVIHPHS
FT                   DKKFFDQMWYEVRELKKPWINEIKNITKSGATYWIKAILSPIIDKNGNILEYIAMCSDI
FT                   TQEKEIARYFEDQLKISATNFDYSMHISKEYEKAIDSSAILLRTDVNGIITYANDKFLE
FT                   ISKYSLQELVGKNHNFFNSQDEALENHQTLWQGVIKSKTKYGVDFWTKTTIVPIKNLHG
FT                   EIIEYLEIRFDITEIIRHKEEFEIAAKTDSLTGCGNRLRLHYDMQENEKLSVAIFNLDN
FT                   FRQINDFYGHNFGDLVIQTIASKINMYIQHDKNFKFYRLQGDEFVTLAINAPKDELLEK
FT                   TKGILKLIKKKFYIGNEELLISCSAGISFEEKEHLLSTANMALKITKKSSTDFLIYSSE
FT                   ISLEDQYKNNLNWAKKLSSAIKENNLVTFYQPIINNSIDNRENPTKYECLIRIVDNGKI
FT                   ISPFFFLEVAKQTRQYSEITKTVVKQSFELFKDKHAHFSINLSVLDILEPRTTTYIFEM
FT                   LKQYGIGERVIFEIVESESIDNFESIVAFIDKVKSYGCKIAIDDFGTGYSNFEYLIKLR
FT                   ADYLKIDGSLIKNLDKDKNALLVVSTIVEFSKKLGMKTVAEFVENREIFDIVRELGVDY
FT                   SQGYYFSEPVAQI"
FT   gene            complement(113806..114816)
FT                   /locus_tag="Suden_0107"
FT                   /old_locus_tag="Tmden_0107"
FT   CDS_pept        complement(113806..114816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0107"
FT                   /old_locus_tag="Tmden_0107"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43388"
FT                   /db_xref="GOA:Q30UE3"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43388.1"
FT                   /translation="MGRADFLLAACVTLTCEIEGITQAGIAGLIPLTPTLDAEFITNSK
FT                   VFSLDEIAETPSGVPTPAIITRAVHNLTPFSSIEILDLGLTKLPQNSTYHTFGIAPSDS
FT                   IATGANIDAKTIFEKGMRAGRSYELKGSYLILAESTPSGTTTAAATALALGYDCKDDFS
FT                   SSFLHVPKNIKQETIKSALSLINDDMTNFEKLSYVSDNMLLFCAGFLLEASRRFHVVLA
FT                   GGTQMASVLLIADKLREDVLMRIKSDNVTLATTSWIANDKNSDIAHILSLLSYKPHALY
FT                   TTFSFKETSIPLLKKYDDGEAKEGVGAGAALGYAHANGIENEKLLREIESILYNS"
FT   gene            complement(114848..115723)
FT                   /locus_tag="Suden_0108"
FT                   /old_locus_tag="Tmden_0108"
FT   CDS_pept        complement(114848..115723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0108"
FT                   /old_locus_tag="Tmden_0108"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43389"
FT                   /db_xref="GOA:Q30UE2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43389.1"
FT                   /translation="MKPMIFLLLLFFTSFSYGTEEESVNFIEIISISKILWTIFFFIIS
FT                   YVFITLFAKTVEFFAEKSSKLRITIKGFIPIVRIIFWSVFVAITIKVIYNPPVEMLMTA
FT                   LASVAIAIGFATQDLLKNIFGGIMLLFDRPFKVGDKIQVGENYGEVLTIGLRATRIVTP
FT                   DDSTVIIPNMTLMNAYISNSNSGELYCQVIAKIMLPLDINTQIVRKIAIEAAQVSKYIY
FT                   LNKPIVVLFSNKMNEQKAYIEMSLKAYVMDIRYEFAFKSDMSEIVLKELLAKEIFKKDE
FT                   TTRRIEDKNL"
FT   gene            complement(115738..116967)
FT                   /locus_tag="Suden_0109"
FT                   /old_locus_tag="Tmden_0109"
FT   CDS_pept        complement(115738..116967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0109"
FT                   /old_locus_tag="Tmden_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43390"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43390.1"
FT                   /translation="MSSDKSQITQSVNFLSYIKSRIDELKKLVGIVDQKEPISFKISEF
FT                   MQEVNSSLMKLPKEYKNLYELKVAEGDFFINREAEIQKLHLSYENWFKDRFVTCAIIGE
FT                   KGCGVTSALNSFLKKIPQIETIKADLSQKIYTDEEYFAFFNSLLKTEDIKNNKGLIDFL
FT                   NNTQEHKIIIIENLHHMFLKKVGGFESMEMLFELLSYTTKKVLWIGVFTPQTWNYLDKT
FT                   IAISNYFTSEIVMEQLGYETIKEIILKRIDCESTRLEFIPNEQTIESKTFQNLSQSEKQ
FT                   SYLQEKFFKLLHKLSNGNISLAQLYWIRSISATNDNGLGVEEIDDFDYSFIKNLSSEAL
FT                   FTLQALILHDGLSIKDFSTVMHESLSQSRKILMPMLERGLLIQPNKKYNINPAIYKPVY
FT                   DYLSSKNFIH"
FT   gene            complement(117004..117540)
FT                   /locus_tag="Suden_0110"
FT                   /old_locus_tag="Tmden_0110"
FT   CDS_pept        complement(117004..117540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0110"
FT                   /old_locus_tag="Tmden_0110"
FT                   /product="Phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43391"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43391.1"
FT                   /translation="MKLTLVRHCEVDKRYKNCYNGHNDIGLSKNGEFQAKELAQKIDSL
FT                   EFDAVFCSDLRRAKESLKHSLHVKSAIYSDKLREKSWGEHEGMSYDEIVLREKIAYISF
FT                   LQWIKILDGEPYLDYIKRVKEFFLDYLPSLKKENILVITHAGVIRVLLSIIHNISLEEA
FT                   FSIKVEYNSITLLEI"
FT   gene            complement(117537..118259)
FT                   /locus_tag="Suden_0111"
FT                   /old_locus_tag="Tmden_0111"
FT   CDS_pept        complement(117537..118259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0111"
FT                   /old_locus_tag="Tmden_0111"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43392"
FT                   /db_xref="GOA:Q30UD9"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43392.1"
FT                   /translation="MRDIFKGFALAVSMLTTVPFFKVHDFFKGINGYAVMFYPLVGFLL
FT                   GSALWGVQSLLSPFAPSFHLGIIIFVLWVLLTGALHLDGLSDTVDGLYVAKEKALKVMK
FT                   DSHVGGMGMIISATFLIAKASSLAHFEAFYLLPIILMLSRLNIVLAIYLYPYVTPNGMN
FT                   TLAKEELTKKQMFIALFYSLILVAFFNMWLALATALLVLFVIKSFFIKCYGGFTGDIYG
FT                   FSIEVTELILLNVLLFSL"
FT   gene            complement(118256..118753)
FT                   /locus_tag="Suden_0112"
FT                   /old_locus_tag="Tmden_0112"
FT   CDS_pept        complement(118256..118753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0112"
FT                   /old_locus_tag="Tmden_0112"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43393"
FT                   /db_xref="GOA:Q30UD8"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43393.1"
FT                   /translation="MKKTLFIGGIKSGKSLNAQNYILASSLQKPIYLATTEFIDKELQE
FT                   RINAHKQSRMDSFETIEEPLKLYNKILECKSAILVECVSMWINNMLYHGFTFADMKEEL
FT                   EKILELDKTVVFVLNDIGSGVIPDNALAREFVDISGKLSQLIASKCDEVYHTIAGISTR
FT                   IK"
FT   gene            complement(118825..119253)
FT                   /locus_tag="Suden_0113"
FT                   /old_locus_tag="Tmden_0113"
FT   CDS_pept        complement(118825..119253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0113"
FT                   /old_locus_tag="Tmden_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43394"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43394.1"
FT                   /translation="MMSYEEWFWQHKEKHKKIVDKLVTKGYNEDKIIEYFDFENMLQEE
FT                   KEFCPLYKDNKKCHDIKKLNCFLCACPHFRFSDKGIEKKESKTLYSFCAIDAKNSKEIT
FT                   YENSIHQDCSDCKIPHSKTFVKKCFDLEWKNIMRECRV"
FT   gene            complement(119250..120860)
FT                   /locus_tag="Suden_0114"
FT                   /old_locus_tag="Tmden_0114"
FT   CDS_pept        complement(119250..120860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0114"
FT                   /old_locus_tag="Tmden_0114"
FT                   /product="Protein of unknown function DUF181"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43395"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43395.1"
FT                   /translation="MNILSKEAPLEVSIKKMKNVLKSVGCETIVSKEHHPLQNCYSLNL
FT                   SSTEAPSHIYSNGKGSLEDSALASALGEYIERLQTNMFFSDFYLPRRKHYPDEVEFELD
FT                   GDFLSEELFDIYDPDGELLGDAFVDFNSDSKKIISLPFKKLSTNETIHFPVNILHNLYV
FT                   SNGLSAGNTPKEAQVQALSEIYERYAKFEIIKNGYALPKFPQSVIESFSKLNEDISALR
FT                   NLGYIVEVLDASLGGAFPVTAISLINPKNSTLFVSFGAHPILEVSLERTMTELMQGRSL
FT                   DTLNDFETPTFDMSIVSDSFNLESHFVDSNAKLGFAFLSSKKSFEFSAWKYDTKMDELE
FT                   FLTNIASDMGKEIYTREYDYLGFYSCQMLIPSISEVYPIDDLAYNNKNSAKAIRDMVLN
FT                   FSDYDAEDILDTIVSLDDSLGMEKYIGVIFKNNFTMAEFKVHLHLQVGAKEDALEFLEY
FT                   SSKSEAKVISELIHMELQEQDYQEYEEALFNIFSKPNVEKALKILNKEEYFIDITLHND
FT                   YHNMLAMYERLTQSKAAMI"
FT   gene            complement(120857..121819)
FT                   /locus_tag="Suden_0115"
FT                   /old_locus_tag="Tmden_0115"
FT   CDS_pept        complement(120857..121819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0115"
FT                   /old_locus_tag="Tmden_0115"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43396"
FT                   /db_xref="GOA:Q30UD5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43396.1"
FT                   /translation="MSRFFVWFTLTVFLFLSPFIGAVTLHVADIFNFSSLHSQIFFELR
FT                   LPRVMFALFAGAILSISGLLFQTLFRNALMTPYTLGISSGAVLGAGIAIKLGLGTLIFG
FT                   ISAINIFGFLGAILTLFLLLYLNLFIKNAKSESFLLLGIALSLFYTSALMIIFYLGSAI
FT                   QNDMLIRFTMGSLSIIGWQNPLFIGLITSVLVIVVYLYRFELQLLATSDESAKLKGLHS
FT                   KKVTYLLLLISSFAVGGVVSISGPIGFVGLITPHIISMLYPSSISSRVLKTALFGALFL
FT                   VFCDTIARLLSSQNDLPIGIVTALIGGPFFIYLIIRKKE"
FT   gene            complement(121812..122537)
FT                   /locus_tag="Suden_0116"
FT                   /old_locus_tag="Tmden_0116"
FT   CDS_pept        complement(121812..122537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0116"
FT                   /old_locus_tag="Tmden_0116"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43397"
FT                   /db_xref="GOA:Q30UD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43397.1"
FT                   /translation="MIELKNLTCSYGKTTILKDVNLKITSHLSILGANGSGKSTLARAL
FT                   CALIDYDGEIIIDSVDLKSLSNKTRAKTISYVPPKLELYDSFITLREFVLLGRFPYKKS
FT                   FFDYSAKDKKIAEKYISLLGLEHLSECSILSLSSGQQQLSLMASALCMESKIMIYDEPT
FT                   ANLDPYNSKIVANYIKNLKNTHQIILITHDLHLASFIGSDIAFIKEQHVAFYGDTFFND
FT                   KILEELYGVSFNSLVLEYE"
FT   gene            complement(122534..123346)
FT                   /locus_tag="Suden_0117"
FT                   /old_locus_tag="Tmden_0117"
FT   CDS_pept        complement(122534..123346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0117"
FT                   /old_locus_tag="Tmden_0117"
FT                   /product="Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43398"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43398.1"
FT                   /translation="MNIKLLFLALFFVFTLEANERIISLSPSVTEIIYALKKGDSLVAT
FT                   SEFSLYPPEAKELKLIGGYSNPNLEKIISLCPTLVIGQDFNQATLEKLERFGIKTLMVK
FT                   LQQINDIKNSILKIAYELHVDSKPIVDEIQSAINSVAKGKESHKVMIVFGLYEDLSRGI
FT                   YIAGGGIFYDDIIKLCGKTNAYASSDTNQPSLSYENVIALNPDQIIILHSNASNSGVNR
FT                   QRALSAWHSLPTNASKNRRITVIDESYIHIPSNRVALIIKRICEEINR"
FT   gene            complement(123356..125257)
FT                   /locus_tag="Suden_0118"
FT                   /old_locus_tag="Tmden_0118"
FT   CDS_pept        complement(123356..125257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0118"
FT                   /old_locus_tag="Tmden_0118"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43399"
FT                   /db_xref="GOA:Q30UD2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43399.1"
FT                   /translation="MKKKILLSIFISSILVAQSIELKPLSITSTAITTDELKSTDAVEI
FT                   YTAEDIQKAHVQNIYEFLNQQSSATATPSFGNSFMQKLDFRGYGIGDGYQNILITINGK
FT                   KINNIDMTPQLLSAISPASIQRLEIIKSSGIVKGGDGANAGAINIITKKDSAKEITVYS
FT                   GTQGTADGSFYLGHSEERFSISSSGEAQRGDGSRYINSAQDKDESSLKTASLNISYNPI
FT                   DTLELRAGASFARTDITYGSFLTLDEYNDDTKQAGGTNWGAANQKYDTDALNLGFSYNL
FT                   SDKISLNIDGAKEKKKSVYNSISQTDYEYDSLNSSLNYIDTLFSFTLGYDIFDGNLVNT
FT                   KSDLRKISNALYFINEIYLGSSTIKMGARYEDISFKSKSGEDQDDTLYGVELGYNYTFD
FT                   REKSLFANYSHAYQSSSLDRLFDWSSGAFTGYVKPSESDNFTVGFNYLTPMNRLKISLY
FT                   YISLEDEIYYYADPTYQSSRNTNIDKSYKYGLDIYDKWLIDEALSVVLNYNYVQAVIDK
FT                   ESENGDDYSGNKLPGVSNHNIKATLAYSLNKNTSLALTQTYRSKTYAINDFNNNFAQKQ
FT                   DAYKSSDISISYTKERLELFAKISNLFNQKNGLWVEDNAIYPMNFTTTAIAGFKLKI"
FT   gene            complement(125282..125623)
FT                   /locus_tag="Suden_0119"
FT                   /old_locus_tag="Tmden_0119"
FT   CDS_pept        complement(125282..125623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0119"
FT                   /old_locus_tag="Tmden_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43400"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43400.1"
FT                   /translation="MRLPKGFGKNYFTLRAITATTNQVTLHARASCVESFHMSNFNGDE
FT                   QEVEIEDDDLAAALPLELSSKPCHCNCYYFCRTRKTLLLCKFQKLISNYFENLNNNLSP
FT                   PPLTTNKTD"
FT   gene            125970..126179
FT                   /locus_tag="Suden_0120"
FT                   /old_locus_tag="Tmden_0120"
FT   CDS_pept        125970..126179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0120"
FT                   /old_locus_tag="Tmden_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43401"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43401.1"
FT                   /translation="MEFEKFLERLKEAGLSKDDFTELTGLSGNTLIGWATERQGKKTQP
FT                   WVKSWLDLYINNREKDIIIKALRN"
FT   gene            126182..127369
FT                   /locus_tag="Suden_0121"
FT                   /old_locus_tag="Tmden_0121"
FT   CDS_pept        126182..127369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0121"
FT                   /old_locus_tag="Tmden_0121"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43402"
FT                   /db_xref="GOA:Q30UC9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43402.1"
FT                   /translation="MRNIKVASFFSGCGGLDIGFEGDFETNSTSIRNKSWIQNTNEKKC
FT                   KVKKTTFETVFACDIKKSAKIAWESYFKKENVFHLESIVDLIKKAHNNEFIFPHADIVT
FT                   GGFPCQDFSIAGKRNGFNSHKTHSNTYVTDEPSIESRGMLYYWLREAISIIKPKIFIAE
FT                   NVKGLVTMGDIKNIIADDFRNINGGYIVLEPRVLNAADYGVPQSRERVFFIGIRRDLIN
FT                   DLTINMLINNELSLYPPQTHDYKNDFVSTSDILSDLPEPEDSSDISHQKYSKAKWYGKH
FT                   CQGQTEINPAGLSPTIRAEHHGNIEYRRLSKEHGGKIINEFDLLERRLSVRECARLQTF
FT                   PDNYNFVSDKISASEAYKLIGNAVPPLLGYHIAQHIQSIWDILFLNKSKTEKKVA"
FT   gene            127369..128406
FT                   /locus_tag="Suden_0122"
FT                   /old_locus_tag="Tmden_0122"
FT   CDS_pept        127369..128406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0122"
FT                   /old_locus_tag="Tmden_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43403"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43403.1"
FT                   /translation="MARDQTIFSEICIALSIIDARDTDFSFIENVTKKDEEIYLKELEK
FT                   RSLLKNGALSIEALKQSGLIIRNYLVGCGFTPKKIIWTGKDNIAGVVSVAKDLEILNFR
FT                   ISVKENADVFINGSPLTVFEDLPKGLFGQKKRGEDWFIKTAKDEIERYYALCRKHLSVH
FT                   DDFSAIDKFYGNRDKAYKKEFSKKVALLHSEKNNEILESYQIMCNKVSQISSEIFNQNL
FT                   LKFKTAYTSSVSLQPIFHYFFKINGIKYIIAGTEKNKPFASLLENSTSWTKQYSFLDII
FT                   ASPKEAGQPEVLLRFIFKDKKTNEQFEIPLKIEIRWSHGKFCGNPEAKVYKQWSYMELP
FT                   WSENL"
FT   gene            128614..129939
FT                   /locus_tag="Suden_0123"
FT                   /old_locus_tag="Tmden_0123"
FT   CDS_pept        128614..129939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0123"
FT                   /old_locus_tag="Tmden_0123"
FT                   /product="Protein of unknown function DUF814"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43404"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43404.1"
FT                   /translation="MKLSHLKQILEYLQKFTKISSIYRVSDTIIKVSFDRDDELYFEMA
FT                   RSNSKIFKCLSYARSKVYNAPFDVLLAKRFNRANILHVELFGGDKIVRLKTSVASAYKE
FT                   EITYLQFEFTGKYTNVIILDESEIVLEALRHVDLFSSFREVRVGQKLLDIPAAPFEAKE
FT                   YILDDVESFLYDEYEQEQREKLASLKKQKISLLSKKLKKLEKLYTTLDDEDELEAEAQK
FT                   YNHFGNLLLSNMHTIRPYQRVVELDDYNGVKQRVELHKEFSTPAMMANSLFARSKKAKQ
FT                   RASHLHIERASLISKIEHIKLFIHTVTEAKDMAKIQLLFPKILQSKKIKTDDSIETFWI
FT                   EGYKVTLGKNEKGNITLLQNARAKDIWIHLKERPSAHVIITTDKQNVPMSVIEGAARLC
FT                   VDFTMFEKDRYLVDYTPRREVTIQSGANVLYNKYKTIEIDTR"
FT   gene            130000..130308
FT                   /locus_tag="Suden_0124"
FT                   /old_locus_tag="Tmden_0124"
FT   CDS_pept        130000..130308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0124"
FT                   /old_locus_tag="Tmden_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43405"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43405.1"
FT                   /translation="MAVGLVANTIYVNQQTASATSLQNAHNNRVEFQNMAALAALQEKE
FT                   EEVAQIRPTEETHSIDAEREHQKNEADQESARNKKGKKKPQEEEEPTEPLHILDIKV"
FT   gene            130346..131101
FT                   /locus_tag="Suden_0125"
FT                   /old_locus_tag="Tmden_0125"
FT   CDS_pept        130346..131101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0125"
FT                   /old_locus_tag="Tmden_0125"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43406"
FT                   /db_xref="GOA:Q30UC5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43406.1"
FT                   /translation="MSIFSASNERVKTGLVLVAGVLLIGVIDNFFLMWAFLGVVYMLAF
FT                   KEALALFDIKKSDLLYYAAGLWLVAAIYPYSDDLFVLAGVAYASAVAFNKNLSWKNFFP
FT                   FMYPTAGMLFVLSMYQEYGVLALLWLLVVVALTDVGAYAVGKSIGKTPFSATSPKKTME
FT                   GVVGGIIVATIGGMFVGLGIVDLGISFIISFMVSVSSIFGDLYESSLKRAAGVKDSGDI
FT                   LPGHGGILDRIDGYLFGAVVMLILLRGLV"
FT   gene            131105..132166
FT                   /locus_tag="Suden_0126"
FT                   /old_locus_tag="Tmden_0126"
FT   CDS_pept        131105..132166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0126"
FT                   /old_locus_tag="Tmden_0126"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43407"
FT                   /db_xref="GOA:Q30UC4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43407.1"
FT                   /translation="MILLGSTGSIGVNTLEIAKKFSIHVEALVAGNNIALLNKQIKEHN
FT                   PKVVVIADKADISKVNHSNVLYGQEAVLKVIEDSSSELVVNALVGFLGLRPTLKALTCN
FT                   KRVALANKESLVACGAFIETSKIQPIDSEHFGLWYLMQNRPVEKMIITASGGAFRDWNI
FT                   AKLQNATLADTQKHPNWSMGQKITIDSATMVNKMFELLEARWLFGEGKYDALIETKSLI
FT                   HALIDFKDGSTTAHFANASMQLPIAFALNTKMDENILPHVDLLKVGSLEFREITCERYP
FT                   VWEIKDELLKNPARGVVVNAANEAAIKKFIARKIGFMDIAKTIIKAYEKFDISPKNVDD
FT                   VFALDEEVRNFIK"
FT   gene            132163..132357
FT                   /locus_tag="Suden_0127"
FT                   /old_locus_tag="Tmden_0127"
FT   CDS_pept        132163..132357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0127"
FT                   /old_locus_tag="Tmden_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43408"
FT                   /db_xref="GOA:Q30UC3"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43408.1"
FT                   /translation="MNYIGSKYKLSVFLEDEIRAAVEGSLSNKLFCDMFAGIAVVGCEF
FT                   KQYVKIAVDGYKVFLEIDV"
FT   gene            132509..133609
FT                   /locus_tag="Suden_0128"
FT                   /old_locus_tag="Tmden_0128"
FT   CDS_pept        132509..133609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0128"
FT                   /old_locus_tag="Tmden_0128"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43409"
FT                   /db_xref="GOA:Q30UC2"
FT                   /db_xref="InterPro:IPR019054"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43409.1"
FT                   /translation="MTYYENIREMTKIVPVQLVNFEEPRDKARTPTQASSNFITNKEQG
FT                   DWAENLIARAINETSNNFVAVKYGKSDNLVAGEDGFDAFYQDFQNELDTIGKRPDLLIF
FT                   NKVDFDNSLGFDISQEPHEEITDYVKKAIAGIEVRSSAFLIDRYEEAMQARTEKFVQIA
FT                   LETKDKILTDFSDVLEHPARQSYIELLNSITASTLNVADFRVPSWSSSDRLIQVKNLFK
FT                   QLKNAIKEIQKRDYLSITPKVEDLKVVYKWIETFNVPHFYFQVFFDKVYGISFEQILKI
FT                   ISDSDNDGVIFSVETDTKNQNKTTIKINSKFGVPIALKVDEPLHESVRKEMDRGRLLFY
FT                   VTFKGGTAYLDIENLRAILNLEESIF"
FT   gene            133609..135210
FT                   /locus_tag="Suden_0129"
FT                   /old_locus_tag="Tmden_0129"
FT   CDS_pept        133609..135210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0129"
FT                   /old_locus_tag="Tmden_0129"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43410"
FT                   /db_xref="GOA:Q30UC1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43410.1"
FT                   /translation="MMKINKLLVDNLLENEYVKAISSKHRKQFAQFFTPFSIANLMSKW
FT                   ILGNQNLKTVLEPAFGLGIFSRVLLSCKEDIEIKGFEVDKIIFQKAKQYFSETKNCNII
FT                   LQDYMYNDWKNKYDGIICNPPYFKFHDYDNKNILKEIETNLKCKLNGFTNLYTLFLLKS
FT                   IHQLSVNGRCAYVIPSEFLNSDYGKLVKTYLIKSKTLRHVIVINFEENLFDDALTTASI
FT                   IFCSNDNLTEKVQFTNIKSLEDLSKIEEIISKYPNFSKTEQTYHYLDLNPEIKWKAYYQ
FT                   KQNGAKFKNLIPFSTYAKVVRGIATGSNNYFVFNLSKAKEFGISEQYLLPCICSAKDAK
FT                   TSFFTTKDFEILKNNDKSIFLFNAKDLNNKKVQEYIKKGETEGVDKKFLTSSRTPWYSI
FT                   ENRQPAPIWVSVFNRNGLRFIRNEANVSNLTSFHCVYPKQNNLFSELDINLLFAYLLTN
FT                   TAKQIFTDNSREYGNGLQKFEPNDLNKAMMLNLSLLDNDTVNKILYFYDLYRQGLDCIS
FT                   EIDKILIENFSLEEIL"
FT   gene            135212..136222
FT                   /locus_tag="Suden_0130"
FT                   /old_locus_tag="Tmden_0130"
FT   CDS_pept        135212..136222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0130"
FT                   /old_locus_tag="Tmden_0130"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43411"
FT                   /db_xref="GOA:Q30UC0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43411.1"
FT                   /translation="MNYIGSKYKLSAFLEDEIRAAVGGSLSDKVFCDMFAGTGVVGRIF
FT                   KQHVKSVISNDIEDYSYVLNKNYIQNYAQLQDNESYIKELNELLLREDGFIYNHYCLGS
FT                   GSGRQYFSDENGKKIDTIRLKIEELKRSKKIDDNMYYFLLASLIESADKVANTASMYAA
FT                   FLKTLKKPAQRKLVLEPAYFEQSHNGHVVYQEDSNSLIKKIKGDILYLDPPYNHRQYGA
FT                   NYHILNTIALYDEFVPKGKTGIRVYNRSMYCKKNRAIKSFEELIRDANFKYIFLSYNNE
FT                   GIMSRDEVKSIMSKYGKYDLKIKEHKRFKASNALSKKHKTDSTDEYLHILQKDGF"
FT   gene            136219..137196
FT                   /locus_tag="Suden_0131"
FT                   /old_locus_tag="Tmden_0131"
FT   CDS_pept        136219..137196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0131"
FT                   /old_locus_tag="Tmden_0131"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43412"
FT                   /db_xref="GOA:Q30UB9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43412.1"
FT                   /translation="MILSIESSCDDSAIAITEIATNRLLFHKKISQELEHSVYGGVVPE
FT                   LAARLHAEALPRILEECNPYFKDLKAVAVTTTPGLSVTLVEGVTMAKAISIALNIPIIG
FT                   VNHLVGHIYSLFIEKESYFPLTVLLVSGGHTQVMEVKSFTEIKTVAKSMDDSFGESFDK
FT                   VAKMMNLGYPGGPVIEALAKGGDRKRYNFTVPLFQSPLIAFSYSGLKNSVRLAVEAANE
FT                   EDFKDIAASFEHIATAHIIQKLKKYFKEVPPKTFAIVGGASANLYLRSSIEELLKPHGA
FT                   DLLLSELKYCSDNAAMIGRVAVEMYKESLFSDLSSLEVCPKSVI"
FT   gene            137315..137818
FT                   /locus_tag="Suden_0132"
FT                   /old_locus_tag="Tmden_0132"
FT   CDS_pept        137315..137818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0132"
FT                   /old_locus_tag="Tmden_0132"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43413"
FT                   /db_xref="GOA:Q30UB8"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43413.1"
FT                   /translation="MATTKFKGTDVQLLGNQVNVGDKAPQITVVNSDGLGDVVVGGAQG
FT                   HKQLIIVVPSLDTGVCATETRNFNAKASSLNGVKPVIVSLDLPFAAGRFCSTEGITNLT
FT                   VTSDFRNKEFANAYGVLLGGSVLAGVTCRAIFAVNEEGIVTYKEIVPEITEEPNYDAAL
FT                   AAVK"
FT   gene            137994..138746
FT                   /locus_tag="Suden_0133"
FT                   /old_locus_tag="Tmden_0133"
FT   CDS_pept        137994..138746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0133"
FT                   /old_locus_tag="Tmden_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43414"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43414.1"
FT                   /translation="MKKIIYSLTCISLLTSCAMADIARAEMGAGVWMQSSKGNVNYSDG
FT                   GANGTYVSREKDNSELYVWALVKHPVPMLPNLRLEYASIKDDGLATGKFKDFDIGAATT
FT                   TLSYDMKQYDIIGYYNILDNTAWTTFDLGLDIKIVDASYVAAPSAPFTGYSDSVTFAVP
FT                   LLYARVRVEIPSSELGIEADIKYITTGNSTVYDARIKADYTLDFSPVIQPALEVGYRVQ
FT                   KLDIDESSVDARVDIDFSGIYAGLMFRF"
FT   gene            complement(138753..139304)
FT                   /locus_tag="Suden_0134"
FT                   /old_locus_tag="Tmden_0134"
FT   CDS_pept        complement(138753..139304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0134"
FT                   /old_locus_tag="Tmden_0134"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43415"
FT                   /db_xref="GOA:Q30UB6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43415.1"
FT                   /translation="MNTTLYFLRSSEQKIATDMLRYAYRLDEINKGVEDFSELEVFSKF
FT                   YGLSSKDLGLYALSGHNIAGAAWIRLLKESDNAIGFINDKTAVLSIAVKPEFRNKGIGK
FT                   AMLEQLLLEAGALFEEISVSVLNNEKALSYFKNFGFVEVENSLKKSGVDRSEVITMLKK
FT                   IPNERVVRPCDGYDPRKWMD"
FT   gene            complement(139311..141284)
FT                   /locus_tag="Suden_0135"
FT                   /old_locus_tag="Tmden_0135"
FT   CDS_pept        complement(139311..141284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0135"
FT                   /old_locus_tag="Tmden_0135"
FT                   /product="Competence protein ComEA helix-hairpin-helix
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43416"
FT                   /db_xref="GOA:Q30UB5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43416.1"
FT                   /translation="MTGGADDEVLREFETIYIAAKKLLERKEEIKRLISERATLTQELS
FT                   KSIEDADTMRVLEDIYRPYKEKKNSRAATAIKNGLTPLANILESAKLSADEFKTKAKEF
FT                   VKGELSSVEAAIDGAKDILAERYADMPREREAIRNMMLRSGVLEIKRTKTFDENGLFKN
FT                   FDGKSERVAYMPSHRYLAVMRGVNEKELSAKITIDVQKIEANIKEYKIPRNASSSKEFL
FT                   FEAYKDGLKRLLLPSLEREVNSELKERADISAISVFGKNLNQLLMTPPVTKRVILGVDP
FT                   AFRTGCKLAVVDENGNYLESSVIYPTEPQNDYENSKKKVLAFKDKYNITGVAIGNGTGS
FT                   RETQEFFARLNKDEGANLNYTVVSEAGASVYSASKVASLEYPNLDVTIRGAISIAHRLQ
FT                   DPMASLVKIDPKSLGIGQYQHDVDQKLLEKKLTDVTQDLVNRIGVDINSASLSLLSYVA
FT                   GVGTKVAQNIITYREENGAFKTKEQLLSVKGLGKKAYEQAVGFIRIKNSKNIFDNSGIH
FT                   PESYEVAKKLTGLDLTNIDVQAKAKELCVGEETLRDIIKELCKPGYDPREELPPIPFKD
FT                   GITDIKMLHVGSFVSGVVRNITDFGAFVDIGLKNDGMIHISKMAPTKVSHPLEVLSLNQ
FT                   YLPQIEVISIDEEKGKVGLSLA"
FT   gene            complement(141403..142317)
FT                   /locus_tag="Suden_0136"
FT                   /old_locus_tag="Tmden_0136"
FT   CDS_pept        complement(141403..142317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0136"
FT                   /old_locus_tag="Tmden_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43417"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43417.1"
FT                   /translation="MAKRPSLLEQFRSFYFQNSPADLESAIEYFAVFGGMSWSVDMSKS
FT                   LEELIQSKVLKNYTYIHSDITKITKSDKTAHAILSAIAVGDGRVHSALKRARVSRMDGE
FT                   ASIKELCAKNLLIAEFSLESPIDSDEKIDERLNFNTPFMRFWFAFVSPYFKSIKEGDFK
FT                   EAKESFANRKIELYEQTFKKLSIEIIKNSFKDDPILEIGSYWDRESEIEILAKTKSGKI
FT                   IAGTSRYSNQKTKKTALTKLHEQCDIAELSPDTLVIVSKSGFSNELKALKSENLKLITL
FT                   KNFKSLVEDLGPKDFIECEGKRY"
FT   gene            142395..143744
FT                   /locus_tag="Suden_0137"
FT                   /old_locus_tag="Tmden_0137"
FT   CDS_pept        142395..143744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0137"
FT                   /old_locus_tag="Tmden_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43418"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43418.1"
FT                   /translation="MINLSLDKHLGIMTPVTNKALAAVLREASPKEMEMLSKDKDLKSV
FT                   ITSLLKESSQNADSNKTLLTLVKNNPTLKDLGNVSSSIKDLLSLIKNDKEPLKIETVLK
FT                   KFILDTKEELSPPVLKQKLQNSGVFLESKLKNVQNPQVELKNTLLTLEKSIEKSNLPVA
FT                   KLVVQNIRELLATPTLRDATNLALLESPKDEKSALKNIAKEVAEIVSKLNGAQKAPDIA
FT                   KEISEVISKLNEAQKSPNVEKSKVHIAEPIYSKETLSLTSKLTLFSDAQKLLPHEDVRD
FT                   ILSKDLKAILLKTSDEAAKSSHPNQSEITKHVDKLLLQIDYFQLLSHLSSSSILYVPFS
FT                   WDALQEGSIDIKKDKNSVFYCDIDLKLKEYGELKLKLALYEENQINVHIYSDNKDFKEI
FT                   VKENISSLRSALIEAQIIPKEIRIFDATKKNPSPYGQEQREINMGFEIKA"
FT   gene            143741..143992
FT                   /locus_tag="Suden_0138"
FT                   /old_locus_tag="Tmden_0138"
FT   CDS_pept        143741..143992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0138"
FT                   /old_locus_tag="Tmden_0138"
FT                   /product="FlhB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43419"
FT                   /db_xref="GOA:Q30UB2"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43419.1"
FT                   /translation="MKKAAALRYDVEKEGAPRVVAKGQGRSAENIIKIAQLHNLPIRKD
FT                   EDLIELLSKVELDKEVPSALYKAVAEVFSFIYKISKKE"
FT   gene            complement(143998..144222)
FT                   /locus_tag="Suden_0139"
FT                   /old_locus_tag="Tmden_0139"
FT   CDS_pept        complement(143998..144222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0139"
FT                   /old_locus_tag="Tmden_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43420.1"
FT                   /translation="MQEEEILGDTVEYLDEELQKAIAAVENIAARVYEGTLDAYEGFVQ
FT                   TEEYNKKIVDIGNKLKEKGIDITKIAEYQ"
FT   gene            complement(144244..145467)
FT                   /locus_tag="Suden_0140"
FT                   /old_locus_tag="Tmden_0140"
FT   CDS_pept        complement(144244..145467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0140"
FT                   /old_locus_tag="Tmden_0140"
FT                   /product="Protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43421"
FT                   /db_xref="GOA:Q30UB0"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43421.1"
FT                   /translation="MFEALYVGVGLFFGVIGIWLAVIKNLKNELSFEKEKSASLLNQNA
FT                   VLTERINGINEKNQEKFILLEQNKEQMRLEFKELAQSILENNSQKFSLQNQENLSKMIT
FT                   PMREQFNEFKKQIDDVYIKEAKDRSMLQAEIKSIKEINHQMSKDAQNLTKALKGESKKQ
FT                   GVWGEMVLESVLEHSGLRVGVEYEREVTLEHEHNQSRYRPDVIVHLPDGRDIIVDAKTS
FT                   LVAYEQYSSVEDDEHKERFLNEHIISIKKHIKELSEKDYANLKGIKTLDFVFMFVPIES
FT                   ALLMAMEHDKTLFDHAFKKSVILVGPTTLMVSLRAVENSWRYEKQQKNAQEIAKRAGML
FT                   FDKFSGFVESIEKLGKQITTVQKTYDETFSKLHTGSGSITSQFQKLESLGAQSSKVLPK
FT                   SLTDASED"
FT   gene            145563..146936
FT                   /locus_tag="Suden_0141"
FT                   /old_locus_tag="Tmden_0141"
FT   CDS_pept        145563..146936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0141"
FT                   /old_locus_tag="Tmden_0141"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43422"
FT                   /db_xref="GOA:Q30UA9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43422.1"
FT                   /translation="MNNAKEFSNLNLTKEMLHNLNEIGYTKMSDIQEQSLPFILDGKDV
FT                   IAQAKTGSGKTAAFGIGLLHKLQVKKFRVQALILCPTRELSDQVARELRVLARFSHNIK
FT                   ILTLCGGVAFGPQLGSLRHGAHIIVGTPGRILKHLKKDTLSLEDVDTLVLDEADRMLDM
FT                   GFSEEINEVLEFVPKNRQTLLFSATYTDEILDISKSIQNGAIHVKTTSTEIANKIEERF
FT                   YEVNNADKIKTVIDILSNFRPQNVIIFANTKVEVDEIAKRLQESKVDALAIHGDLEQYD
FT                   RNDVLVQFANKSCPVLVATDVAARGLDIKELSMVINYDLPHSLETYTHRIGRTARAGAE
FT                   GLAFTLYSAYEEEKVDEYKNDNRIFESSKTLKTVSGFVMKPQNITLVIEGGKKDKVRAG
FT                   DILGALTGEAGLSGSSIGKIDIYDRQSYVAIEASKIDEAHDKLKSGKIKGKKFSVWIL"
FT   gene            146975..147436
FT                   /locus_tag="Suden_0142"
FT                   /old_locus_tag="Tmden_0142"
FT   CDS_pept        146975..147436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0142"
FT                   /old_locus_tag="Tmden_0142"
FT                   /product="putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43423"
FT                   /db_xref="GOA:Q30UA8"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43423.1"
FT                   /translation="MLELIKEDKLALHLKRKYSLSHTIKTDKALFSYVNELKQTHMKNA
FT                   PTLSKALYDGKISVIHNALGTHHIISRVQGAKLKSKNEIRIASMFKSVPEEFLEMIVVH
FT                   ELAHFKQKEHNKAFYSLCLYMQPSYHQVEFDVRLYMTQMEIFGKIEEWS"
FT   gene            complement(147440..149275)
FT                   /locus_tag="Suden_0143"
FT                   /old_locus_tag="Tmden_0143"
FT   CDS_pept        complement(147440..149275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0143"
FT                   /old_locus_tag="Tmden_0143"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43424"
FT                   /db_xref="GOA:Q30UA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43424.1"
FT                   /translation="MIQLINITKNFGKQDLFNGLSFKLNAGNKMGLVGRNGSGKSTLFK
FT                   MILGEETPDSGEVIIPKGYKIGTLKQYLVFTESTLREEAALALEEDMKYDVYRVERILF
FT                   GLGFTQDDLEKNPLSFSGGYQIRINLAKLLVTEPNLLLLDEPTNYLDILSLRWLKSFLK
FT                   AFQGEVILITHDRDFMDAITTHTMGIVRRNLRVIAGDTHKYYEQLKSSDELHEKQKISQ
FT                   DKKVKELEDFIAKNKARASTAALAQSKVKQLEKMDLLEDLGYDSTLSFAFNYKDTPAKV
FT                   LLDVKNLSFGYTEDNILFKNISFVLEKGQRLGIIGKNGKGKSTLLNTIAGELKALSGEV
FT                   HMHPSTAYAHFGQTNIARLHPNSNVMDEIHSANTKLSAQTIRAICGSMMFSGDSAEKKV
FT                   SLLSGGEKSRVMLGQILARDVNLLFLDEPTNHLDMDSIEALTVAIENFEGSLIIVTHSE
FT                   ELLRRTCDRLIVFTRNGAELFDGGYDLFLEKMGWEEEEDEGGAKQKPKNSFKDNKKTKA
FT                   DLIKTKSKLTTPIHKKIQKLEENIIKAEDTLASHQKKLLEASSSGDSFKIIEYSKLSSM
FT                   EQKEVEKMFELLEILQNEFDEITKDFDEKIAELGD"
FT   gene            complement(149292..149822)
FT                   /locus_tag="Suden_0144"
FT                   /old_locus_tag="Tmden_0144"
FT   CDS_pept        complement(149292..149822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0144"
FT                   /old_locus_tag="Tmden_0144"
FT                   /product="Protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43425"
FT                   /db_xref="GOA:Q30UA6"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43425.1"
FT                   /translation="MRRVLILHGWGGSDFPHWQSWLSSEIAKDYGCVSFLKFSDMDFPK
FT                   KDVWLEELELEMQRFHPDTVLCHSLANILWFHLCNKQKMQEVEKLFLVAPPSLSCKIEE
FT                   LESFFPCEVPKKLYAKKTLLITSTDDPYLRQDEAQELQIALHVDMKVLQNAGHINTNSG
FT                   YGEWPWLLEEIKK"
FT   gene            complement(149819..151207)
FT                   /locus_tag="Suden_0145"
FT                   /old_locus_tag="Tmden_0145"
FT   CDS_pept        complement(149819..151207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0145"
FT                   /old_locus_tag="Tmden_0145"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43426"
FT                   /db_xref="GOA:Q30UA5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30UA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43426.1"
FT                   /translation="MIVTRFAPSPTGYLHIGGLRTALFSYLWARKNGGKFLLRIEDTDK
FT                   ARNSQEAAEAIVKAFNWLGLEHDGEITYQSQRDDIYAIYVKQLLDEGKAYRCYMSREEL
FT                   DALRETQMANKERTKYDGKYRDFDGTPPDGVDSVIRIKAPLSGEIIVRDGVKGDVVFKA
FT                   EDILDDFVIARADGSPTYNFVVAIDDHLMGVTEVIRGDDHLSNTPKQIVIYEALGFDVP
FT                   KFYHVPMIHNSEGKKLSKRDGATDVMAYKEMGYTPAALLNFLVRLGWSNGDQEIFSMDE
FT                   MRELFDPKNINRSASIYNTEKLDWLNSHYIKNTPNQELAKMLEEYNLTIASHDKKEILL
FT                   DALKERAKTLKELALLVTEVINPPASYDEKALEKSLKGEAVEVLNNFIAKLSACKELHL
FT                   PSEYHHVMQEVVDEMGIGFGKIGQPLRVALLGKMSGPGLDSVMAVIGIDETILRVKSAL
FT                   ALVK"
FT   gene            151299..152135
FT                   /locus_tag="Suden_0146"
FT                   /old_locus_tag="Tmden_0146"
FT   CDS_pept        151299..152135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0146"
FT                   /old_locus_tag="Tmden_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43427"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43427.1"
FT                   /translation="MYKIILVLFLGTMLSAEMINGISVVVKGEAITIYDIKDEMRLSKV
FT                   NATTATDILIRKKLEAAEIQERKITVDSSEVYDDIKKVAASNKMSIDEFYDAVRDSNGL
FT                   TSAEFKEKTREKILSQKLYSAIAYSSINMPDEDEMREYYELHKDEFSRPKAFSVIIYSS
FT                   QNEEALRKKITTPMFVSDEIKAEERVLGYDKISPELAKMLESTQQKSFTPVIMDQKGSH
FT                   MSFYLVESKMPQSSSYEDVQNQLSNAIMGQKREQVLSDYFARLRGNADIQIVREVK"
FT   gene            152136..152573
FT                   /locus_tag="Suden_0147"
FT                   /old_locus_tag="Tmden_0147"
FT   CDS_pept        152136..152573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0147"
FT                   /old_locus_tag="Tmden_0147"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43428"
FT                   /db_xref="GOA:Q30UA3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43428.1"
FT                   /translation="MLSDENFINIAIEIAKASKCVSKQVGAVIVKDGRILSTGYNGTPA
FT                   GYINCREHWEDKYTHEHHEWSKTYEIHAEMNAIIWAARKGISIENATIYVTLEPCSECS
FT                   KNIIASGIQRIVYLKPYEHTHSEVISKFIKDNNVVIQKLQE"
FT   gene            152577..153122
FT                   /locus_tag="Suden_0148"
FT                   /old_locus_tag="Tmden_0148"
FT   CDS_pept        152577..153122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0148"
FT                   /old_locus_tag="Tmden_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43429"
FT                   /db_xref="GOA:Q30UA2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43429.1"
FT                   /translation="MVEDKELQAEIGKHLMQPENYGKLEDASCIGVGIDHSRKSYVIMY
FT                   IKRDETTILDVMFGTNGTQDTTTLGSIFTDMIKGESIESAQEIADTLNKELQESYASIP
FT                   APKVDLSKPEGEQVERVSTEHQDSANMVLTAFNAAMRHFERKEGGIEEEQYEMSIVKTC
FT                   PYSTTECHFVTKEKSKEV"
FT   gene            complement(153119..153472)
FT                   /locus_tag="Suden_0149"
FT                   /old_locus_tag="Tmden_0149"
FT   CDS_pept        complement(153119..153472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0149"
FT                   /old_locus_tag="Tmden_0149"
FT                   /product="Arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43430"
FT                   /db_xref="GOA:Q30UA1"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43430.1"
FT                   /translation="MQDITIWHNPKCSKSREAMAILEQNGCEVEVVKYLDSAPSKDEII
FT                   TALTMLGMNPKELMRTKEDIYKELNLKDEYDYDKLVDAMVQNPKLIERPIIFKGNRAII
FT                   GRPSEIIEKFLKS"
FT   gene            153538..153993
FT                   /locus_tag="Suden_0150"
FT                   /old_locus_tag="Tmden_0150"
FT   CDS_pept        153538..153993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0150"
FT                   /old_locus_tag="Tmden_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43431"
FT                   /db_xref="GOA:Q30UA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q30UA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43431.1"
FT                   /translation="MVDVVLYIHILGATAWIGGSLLLFALGILLKGKEAQAQTYEYLGP
FT                   LYGYFETFWLIILISTGTFLFFNFNLFSVLTLDINESKLGYMMSHKLFFVVTITMLTII
FT                   HMRIALKTHKNERTIVQKIVSRASSMMIFLLNLIVLWYAMQLRHILS"
FT   gene            complement(153990..154418)
FT                   /locus_tag="Suden_0151"
FT                   /old_locus_tag="Tmden_0151"
FT   CDS_pept        complement(153990..154418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0151"
FT                   /old_locus_tag="Tmden_0151"
FT                   /product="probable CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43432"
FT                   /db_xref="GOA:Q30U99"
FT                   /db_xref="InterPro:IPR016942"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43432.1"
FT                   /translation="MKSCPINYKKADQNIMRILAGLVTLIGLLFILSSQILLLIILLYD
FT                   FLVRIFDYKKISPLFHISSFFAKLAKLKKSEVDSGPKEFASKLGFLFVASAAIIFFLGY
FT                   PLVAIVIMFLLVCCAFLEAAFGYCVGCQIYILLKKFVP"
FT   gene            complement(154426..154830)
FT                   /locus_tag="Suden_0152"
FT                   /old_locus_tag="Tmden_0152"
FT   CDS_pept        complement(154426..154830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0152"
FT                   /old_locus_tag="Tmden_0152"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43433"
FT                   /db_xref="GOA:Q30U98"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43433.1"
FT                   /translation="MPLISTKGSYGLAAICELSKRKENSPMQIKEIALNANVPQNYLEQ
FT                   LLGKLRRAGLVESIRGAKGGYILARPPQDIKILDILMALEDDLKIVDTLVEHPILKLFF
FT                   EDASESVKSIFNINMMELSAYQNKFLNYNI"
FT   gene            155049..155507
FT                   /locus_tag="Suden_0153"
FT                   /old_locus_tag="Tmden_0153"
FT   CDS_pept        155049..155507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0153"
FT                   /old_locus_tag="Tmden_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43434"
FT                   /db_xref="GOA:Q30U97"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43434.1"
FT                   /translation="MGVCMTQIKLKTLNIIDENQTRMHAGLVVLILIAYMASGNLSFIY
FT                   MLIYDFFARIYVTSLISPLYLLSKGLVNLIGLKQRFSEESAKEFASHIGLMIIFVALYA
FT                   ELLNWTSFSYMLITFFGVWKTFEATKDICFACKLYELLVRKNIRVESL"
FT   gene            155504..156427
FT                   /locus_tag="Suden_0154"
FT                   /old_locus_tag="Tmden_0154"
FT   CDS_pept        155504..156427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0154"
FT                   /old_locus_tag="Tmden_0154"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43435"
FT                   /db_xref="GOA:Q30U96"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43435.1"
FT                   /translation="MKYAKNVTELIGNTPLVRINIASQNALVLGKCEFMNPTHSIKDRI
FT                   GKYMIQEALTQGLITKNTTVIEPTSGNTGIALASVCASLGIKLILTMPSSMSKERIQLL
FT                   RALGARVVLTDAKQGMMGAVREAKELCSQHSEALMLQQFSNRANPEIHRKTTALEIIRD
FT                   TQGKVDILVLGVGTGGSITGVGEVLKKHNPNIKIIAVEPENSPVLSGGEAGPHEIQGIG
FT                   AGFIPEILNTEIYDEIIRVSGEDAINCSREMAKKEGLLVGISSGANVFASTQAAKRQEN
FT                   RGKTIVTILCDTAERYLSCGLYDEDE"
FT   gene            156433..156663
FT                   /locus_tag="Suden_0155"
FT                   /old_locus_tag="Tmden_0155"
FT   CDS_pept        156433..156663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0155"
FT                   /old_locus_tag="Tmden_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43436"
FT                   /db_xref="GOA:Q30U95"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43436.1"
FT                   /translation="MQEKAYRSIVKTLSWRTIGTLDTMVISYLITGNLTMAASIGSIEL
FT                   FTKMFLYYFHERAWNKISLGRHKITANDYHI"
FT   gene            156676..157392
FT                   /locus_tag="Suden_0156"
FT                   /old_locus_tag="Tmden_0156"
FT   CDS_pept        156676..157392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0156"
FT                   /old_locus_tag="Tmden_0156"
FT                   /product="phosphoadenylylsulfate reductase (thioredoxin)"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43437"
FT                   /db_xref="GOA:Q30U94"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43437.1"
FT                   /translation="MKEKINFLNKEFKNVPTKELLEFFLKESKDSIALSSSFGAEDQVL
FT                   SDMVLKIESETNIFTLDTGRLPYETYDVMQRTNLKYNTKIKVYFPNSEDIEKLYQQQGI
FT                   NGFYDSVENRKECCYARKIAPLKRALMGIDIWITGLRAQQSLTRKSTQLFEWDEENRVI
FT                   KLNPLILWSEEDVWRYINENSVPYNALHDSGYPSIGCAPCTRAVEEGTDIRSGRWWWES
FT                   PEHKECGLHIKEIKQC"
FT   gene            157386..158297
FT                   /locus_tag="Suden_0157"
FT                   /old_locus_tag="Tmden_0157"
FT   CDS_pept        157386..158297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0157"
FT                   /old_locus_tag="Tmden_0157"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43438"
FT                   /db_xref="GOA:Q30U93"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30U93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43438.1"
FT                   /translation="MLDTKKLTHLKQLEAESIHILREVVAEFDNPVMMYSVGKDSAVML
FT                   HLALKAFFPAKLPFPLLHVDTKWKFKEMIEFRDKRAKEEGFELLVHTNPEGIEKNINPF
FT                   VHGSAVHTDIMKTEGLKQALNKYKFDAVFGGARRDEEKSRAKERIYSFRDKNHRWDPKN
FT                   QRPELWNLYNSKVHKGESIRVFPLSNWTELDIWQYIYLEGIPIVPLYFAKRRPVIEKDG
FT                   VKIMVDDERMPIEEHEVVKEEMVRFRTLGCYPLTGAVESSATTLPEIIQEMLLTKTSER
FT                   QGRMIDNDSSGSMEKKKIEGYF"
FT   gene            158299..159711
FT                   /locus_tag="Suden_0158"
FT                   /old_locus_tag="Tmden_0158"
FT   CDS_pept        158299..159711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0158"
FT                   /old_locus_tag="Tmden_0158"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43439"
FT                   /db_xref="GOA:Q30U92"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43439.1"
FT                   /translation="MSLLETKIATDIESYLKEHENKELLRFITCGSVDDGKSTLIGRLL
FT                   HDSKMIFEDQLAAIKKDSKKSGTTDGEFDLALLVDGLQSEREQGITIDVAYRYFTTDKR
FT                   KFIIADTPGHEQYTRNMATGASTADLAIILIDARYGIQTQTRRHSFIAKLLGIKHIVVA
FT                   VNKMDLVDFSQEVYENIAKEYLLFAKDIGLSDDISLIPLSALNGDNIVERSQKSPWYKG
FT                   ETLMHLLENIEISSKRDLSHFRLPIQYVNRPNLDFRGFCGTISSGVIRVGDLITVLPSK
FT                   KSSRVKEIVTYDGNLEYAYAQEAVTLTLEDEIDISRGDLIVKSDEEPQSADAFDVNIVW
FT                   MSEDALVKGKRYLIKRASCVSVASVDEFYYKTDVNTLEKQSANMLNLNEIGHVKLDLEH
FT                   SLAYDSYENNKAMGSFIIIDRITNNTLGAGMIVEKSLQESKAKVSQYGAFELELNALVR
FT                   KYFPHFECKEIF"
FT   gene            159721..161280
FT                   /locus_tag="Suden_0159"
FT                   /old_locus_tag="Tmden_0159"
FT   CDS_pept        159721..161280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0159"
FT                   /old_locus_tag="Tmden_0159"
FT                   /product="Assimilatory sulfite reductase (ferredoxin)"
FT                   /EC_number="1.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43440"
FT                   /db_xref="GOA:Q30U91"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43440.1"
FT                   /translation="MSKETKAQRVERIKKDKDGLDVLQDIYRYAKTEEEIDPEDIDRFK
FT                   WYGLYTQNRNLQDEDDSTLYFMLRVKLPEAKLNLKGLEAVADISRKYARATADFTTRQD
FT                   IQFHFITIKDLPAIFARLKEVNLSTVFASGDVPRNVVTCPVNGIDKEQICDVNALAQDI
FT                   NRYFDKNAELSNLPRKYKVGVSGCSKHCISHEIQDLSFNAIKTETGEILFCVNVGGGLA
FT                   SNKRIASHIGYVTASQVLPIVKAVTQIYKEYGNRENRRKARLGHLLDLWGVEKFIEILH
FT                   ENIDFILQNRELQEYVPYEKREHFGVHESVEDGKSYVGCAIDGGRIGADGLYKLLEILQ
FT                   NNGATTIKATTTQNLVITDVPSSSVNALSKALKEIDIDVNPSPFKARTLSCTGKNFCKY
FT                   AVSETKDLASRLVAHLQNRFPDFKEPLSFSVNGCSHSCAHPHVVDIGLLGCKVENNRKY
FT                   VSGFELILGGHLEGDKSNFAKSTGIKFIPEDACQIVENIIESYLNSHYKNFHDYATGKI
FT                   YG"
FT   gene            161273..162601
FT                   /locus_tag="Suden_0160"
FT                   /old_locus_tag="Tmden_0160"
FT   CDS_pept        161273..162601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0160"
FT                   /old_locus_tag="Tmden_0160"
FT                   /product="NifS-like protein, Aminotransferase class V
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43441"
FT                   /db_xref="GOA:Q30U90"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43441.1"
FT                   /translation="MDKDIFSPILRDKKNIRDEIKKGIIGVHKKYYFDYTASGLAYKTI
FT                   ELRVQEVLKTYANTHSKEASMAAKTDFYYTQARRHLKRLLKLESDFAILPCGCGATSAI
FT                   KRFQEIVGIYIPPATRKRFNINNDKESTPLVITGPYEHHSNEVSYREALCDTVRIGLNN
FT                   RGVIDLEQLEQILQTSTHSQIIGAFCIASNVTGIITPYEKISLLLRKYNAIVCFDAAAS
FT                   SPYMNIPSSLYDAMFLSPHKLIGGPGSCGILAIRKGLIDEDIAPTFAGGGTFKYVNRNT
FT                   HQFIDEKEAREDAGTPGILQLIRATLAYQLRNEVGFIRIKKQKNILMKHLIDALMDIKG
FT                   CTIYGNLEEENIGIISFNIDGVDPYLLCSYMSNLDGIQSRAGCSCAGPYGHDLLGLKDN
FT                   SNFAKKPGWLRLSIHYAQEINDIDYLLGALKKSIIEIKKIKSD"
FT   gene            162700..163581
FT                   /locus_tag="Suden_0161"
FT                   /old_locus_tag="Tmden_0161"
FT   CDS_pept        162700..163581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0161"
FT                   /old_locus_tag="Tmden_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43442"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43442.1"
FT                   /translation="MRIDLKNRTSKEILDYFEGLHVKEGAVVEAEFLDADIDTFGYKAF
FT                   VDLAQLFFMKMLTPIKNETTTVLRFQKLHLESSFHKADKSSEKYGADSEFFKIDKTAQF
FT                   SFLYHYQKALEFIDIKSKKRVLNLGVNRGDEFRVIKEMLSCEEFELTEFVGVDYSTSAI
FT                   EYAKDDFLDDKNVKFICHDINRLCELDLGEFDLIISIGTLQSSNIEFNATFMSIYQNYL
FT                   HKDGAIILGFPNCRWIDGEMIYGAKTPNYAFSEMSLVLKDIHFCKKYLQQKKYRVTIRG
FT                   KDYLCLTARKVI"
FT   gene            163617..164294
FT                   /locus_tag="Suden_0162"
FT                   /old_locus_tag="Tmden_0162"
FT   CDS_pept        163617..164294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0162"
FT                   /old_locus_tag="Tmden_0162"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43443"
FT                   /db_xref="GOA:Q30U88"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43443.1"
FT                   /translation="MVHNNMILGNELFQKSFFKAYEKEFLQLSQKGQTPKALYIGCSDS
FT                   RVLPNLITQSAPGDLFVVRNVGNFVAPYKPDEDFHSTASAIEYAVTVLEVKSIIVCGHT
FT                   KCGAIEAIHKKSCANNPELVHTKTWLTLGESAKAQAILALGLRADKETLYRLTEKLSVV
FT                   SQLENLLTYPSVKKRVDNAEIAIHGWIYDIESGEIEYYDPEISQFVHLSSLKIEEEEEE
FT                   SSL"
FT   gene            complement(164289..166094)
FT                   /locus_tag="Suden_0163"
FT                   /old_locus_tag="Tmden_0163"
FT   CDS_pept        complement(164289..166094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0163"
FT                   /old_locus_tag="Tmden_0163"
FT                   /product="Asparagine synthase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43444"
FT                   /db_xref="GOA:Q30U87"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43444.1"
FT                   /translation="MCAIFGILGEHDEKKAKDALALLSHRGGDFCGITQGQNLFFAHHK
FT                   LSITGTNSDSNQPFSYEKILLSFNGEIYNYKELRADLSCEFNFKTQSEAEVIAASYLKW
FT                   GVNFVLHLRGMFAIALLDDEILYLFRDRLGKKPLFYLHVNAFIFASEIKALVPFLHSIE
FT                   MDEDALLSYLSFLAPTPPFTFFKNIKKLAAGEYLIFKDSKVEIKRYFDLLDTTPSLITN
FT                   RDEAVFLVQNALEEAINIRLATDVPMASLLSGGIDSAAINAYAKKASMDIQTYTLGYKE
FT                   FAKYDERQNASLSASLLGVKNRAVEISQREFDESCDIVLDALDEPLNDPAAVPLYLLFG
FT                   HIKKDGYKVVLSGEGSDELFLGYRQYFEFLDIEKLTNLKNKNWLSGYFHSNFSMNREWE
FT                   RYKRVFDGSLLFRTTGENFTDLQKNVSMKRNVRDNESLKYIQNYRETFLASSHSDESIW
FT                   YSYIDLHLFQAEHYLTKLDRLSMAHSIESRTPFLDHKLASLVFSIDPKIRYMDGVTKSL
FT                   LKSALKPMLDEKILSRRKKGFSNPFMEYLIESKKISLIKEVNEKTGIFKKEILDEHIKK
FT                   AANGGFKQHIWGLYVLSVWLKKYLL"
FT   gene            complement(166094..166681)
FT                   /locus_tag="Suden_0164"
FT                   /old_locus_tag="Tmden_0164"
FT   CDS_pept        complement(166094..166681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0164"
FT                   /old_locus_tag="Tmden_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43445"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43445.1"
FT                   /translation="MPKIDNKTFYSSAIEMYGITAKGVNWHSKESQNLRFEIILEMLPE
FT                   VMSDFSVADAGCGFGDLYLYMQKKRRVPKEYIGIDTLVDMYSIASERTGCEIVVADICK
FT                   DSLPSADFYICSGAMNVLNDFETHLFMQNCFRTCRVGFLFNVLYGDKRSETYNYLTKTK
FT                   IDKIAADLGVAEVIFRDDYLQDDVTVMFKKSL"
FT   gene            166808..167761
FT                   /locus_tag="Suden_0165"
FT                   /old_locus_tag="Tmden_0165"
FT   CDS_pept        166808..167761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0165"
FT                   /old_locus_tag="Tmden_0165"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43446"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43446.1"
FT                   /translation="MSHMYNLAIIGAGPSGIATAVESYLLGVRDIIILEKDQNHNSTIR
FT                   KYYKDNKRVDKDWKGQKVELEGKIYFVDGTKESTLDFFDEILNNHSVELRTHTEVQNIK
FT                   KRDGYFEIFIAGESINAKYVVVTIGRMGKPNKPDYKIPQGVKDKVAFTLDNCGIGEKIL
FT                   VVGGGDSAIEYAIDLSAKNEVAICYRRETFRRANPTNQRDIANAIMHKEVEPILGVDIN
FT                   SLEDENGRVKVIFSEREADIYDRVIYAIGGTTPSAFLASSGIKEEDGKPSHDENYETNI
FT                   EGLFVAGDITQESGGSIALGLNHGYAIAKHIQEKKL"
FT   gene            complement(167766..168170)
FT                   /locus_tag="Suden_0166"
FT                   /old_locus_tag="Tmden_0166"
FT   CDS_pept        complement(167766..168170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0166"
FT                   /old_locus_tag="Tmden_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43447"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43447.1"
FT                   /translation="MKNIILILLFSVFVFADGYRDFAESMSYETSYEVALKRAKEQKKN
FT                   LMVLMVTNYCPWCSKFEKKTLMDADIDRAIKAKYIPLIINKEEKEFPSFLNVPVVPTTF
FT                   FIEASTEKPFHQSVGFSNKIDFKNLLDALK"
FT   gene            complement(168167..168619)
FT                   /locus_tag="Suden_0167"
FT                   /old_locus_tag="Tmden_0167"
FT   CDS_pept        complement(168167..168619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0167"
FT                   /old_locus_tag="Tmden_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43448"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43448.1"
FT                   /translation="MSKFKTIFVTLFFLFFASHVGAQTPFTLSGVKSYYPVVELNTDKI
FT                   DIKYKEKILEMLIKKSQKLGIETKNFSSRSLAFLIGFIGIGDTLALKMELMVGENAMRL
FT                   DTKESVFVISYMNSRIFVPQELEEELIDNAEELLDMFEAQYKEDNL"
FT   gene            complement(168612..169775)
FT                   /locus_tag="Suden_0168"
FT                   /old_locus_tag="Tmden_0168"
FT   CDS_pept        complement(168612..169775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0168"
FT                   /old_locus_tag="Tmden_0168"
FT                   /product="Sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43449"
FT                   /db_xref="GOA:Q30U82"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43449.1"
FT                   /translation="MYENIILIVTISLIIIFSPFFAKLIKLPTTPIEIIFGAVFAYIGL
FT                   IHEEHLFKIVAELGFLYLMFIAGTEINLKSTLKTPKELMQKIIIYLAILYSFSIAISLY
FT                   FELGKIFMVLMPLISVGLIATLSKEYGKTPWLALSMTAGAIGEIVSIGFLTLTSATLET
FT                   GVGFALAQTIFALALFLLFMFLLFRAIELLFWWFPTVATSLMPHDDNKEQDIRLSMGIF
FT                   FILVGAMLYLKLELAFGAFLAGIFIPTFFEHKKELPEKLASFGFGFLIPIFFIHIGSSF
FT                   NLEALFMDGLITKALLITLAMTMMRLIASLVFIKELKLVDSLLMGLSHSMPLTLLIAMA
FT                   TLAYNGKSITELYYYALILASLFQAIAIMVIIKLINNYKIKSRIVDE"
FT   gene            complement(169779..170624)
FT                   /locus_tag="Suden_0169"
FT                   /old_locus_tag="Tmden_0169"
FT   CDS_pept        complement(169779..170624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0169"
FT                   /old_locus_tag="Tmden_0169"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43450"
FT                   /db_xref="GOA:Q30U81"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30U81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43450.1"
FT                   /translation="MNQKIFLCSICNINSGTCNEDCKFCSQSVRYKADIDRYKQKEISL
FT                   ILKEAQDAYSNGALGFCLVTSDKGLNDKTLNFVCSIAEVLSKELPELRLIACNGTATIE
FT                   QLLTLRASGIKAYNHNLETSREFYPKICTTHSWDERYETCQNINNAGLVLISGGIFGLG
FT                   EREEDRVSMLKSLDSLKPTSVPINFYHHNEALELSPNPLSVDEALSLIKLTRAMIPDAQ
FT                   RIMVAGGRELMFGDRESEIFANGANSIVIGNYLTTSGKAMQRDLEMLKSLNLDVASSVK
FT                   "
FT   gene            complement(170621..171142)
FT                   /locus_tag="Suden_0170"
FT                   /old_locus_tag="Tmden_0170"
FT   CDS_pept        complement(170621..171142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0170"
FT                   /old_locus_tag="Tmden_0170"
FT                   /product="Protein of unknown function UPF0025"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43451"
FT                   /db_xref="GOA:Q30U80"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43451.1"
FT                   /translation="MKIGIISDTHRKVKKARRAINTLIEDGAEFIIHAGDIVDVEILNL
FT                   LRDSGVEYVAVYGNNDAHLAEFHTQFNLVQEPYYFEVADIKFKLMHIPFYMSPDADVVV
FT                   FGHTHEFSLEFINNTLFVNSGEICARNKPLSEWAMLDVENKSYKLTRYTRENKSDIIEK
FT                   KNFKYLREKK"
FT   gene            complement(171145..173376)
FT                   /locus_tag="Suden_0171"
FT                   /old_locus_tag="Tmden_0171"
FT   CDS_pept        complement(171145..173376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0171"
FT                   /old_locus_tag="Tmden_0171"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43452"
FT                   /db_xref="GOA:Q30U79"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43452.1"
FT                   /translation="MNLIIVESPAKAKTIKNFLGKEYEVIASKGHIRDLPKSRFGITVD
FT                   ENSHLIPAYSVAKENAATVKEITTLAKKSDIIYIATDEDREGEAIGWHIAHAIKKDPAE
FT                   LPRIVFHEITKTAIENALLNARKIDMDMVNAQQARRILDRVVGYKLSPLLSSKIQKGLS
FT                   AGRVQSSTLKLVVDREREIRAFVAEEYWTIDTLFAKDIEASLISHMGEKLSKLSITNKA
FT                   DASSIVKSVKEDSFIISKIETKERRSATPPPFMTSTLQQVASSKLGFTPKKTMMVAQTL
FT                   YEGVKTPSGTSGVITYMRTDSLNLAHEALTAVRGLIESRFGKKYLPAEPKIYTKKAKGA
FT                   QEAHEAIRPTMLAFTPEVAASFLKPDEIKLYRLIYERFVSCQMNDAVFEQQSIIFSGAN
FT                   NEYKAIGRKLTFDGFYALTGAEDKDKLLPSLSEGQSAQIQKIESTQHFTEPPARYSEAA
FT                   LIKKLESEGIGRPSTYAPTIATLSNRTYVTIEKKQIIPTEMAFTVTEILEKNFSNIVDL
FT                   SFTANMEEKLDEIAEGQNDWQKLLSDFYGDFLAQVEEGKTNIVSLKMATPLGRACPKCG
FT                   EELLLRSGRFGEFIACSAFPKCKYTEQVEGEKKEGEENAQSSSSDEICDKCGKEMVTKN
FT                   GRNGPFLACSGYPDCKNTKSINVEEKTSETPCPDCGGKISLKNSRRGPFWGCENYPTCK
FT                   FISKFEPSKYKCRESGCDGALAFRVFRGKEIYECIKCKAKTPAQEIVAE"
FT   gene            173585..174763
FT                   /locus_tag="Suden_0172"
FT                   /old_locus_tag="Tmden_0172"
FT   CDS_pept        173585..174763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0172"
FT                   /old_locus_tag="Tmden_0172"
FT                   /product="Flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43453"
FT                   /db_xref="GOA:Q30U78"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43453.1"
FT                   /translation="MGFRINTNISAMNAHRNAQQTNIGLDKSLGSLSSGLRITKAADDA
FT                   SGMAIADSLRQQAQGLGQAVSNANDGIGITQTADGALDEYINIANTIRTKAIQAASDGQ
FT                   TLDTRKAIQADIDKLMAEAQNIASTTSFNGQTLLNGGYQNKSFHIGAYSGEAVKISIED
FT                   SRTEKIGKFALAESTTGLTATTGQAGVSTVSLSVTVTSADGTTSTSTGEAVLTSGAHSS
FT                   YEIAQMVVDAFNSDAQTDGTNARASVYELTSSTAGTAAFGVRVDSSDKFTTTEAGFTIG
FT                   DATAALTNNFSTIDVTTREKAEKAIIISDYTLKDLDSRRSDIGSVQNQLESTIRNISVT
FT                   QVNVQAAESQIRDVDFAAESANFAKFNILAQSGSYAMSQANAVQQNVMRLLQ"
FT   gene            174976..176154
FT                   /locus_tag="Suden_0173"
FT                   /old_locus_tag="Tmden_0173"
FT   CDS_pept        174976..176154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0173"
FT                   /old_locus_tag="Tmden_0173"
FT                   /product="Flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43454"
FT                   /db_xref="GOA:Q30U77"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43454.1"
FT                   /translation="MGFRINTNISAMNAHRNASMTNLGLDKSLGSLSSGLRITKAADDA
FT                   SGMAIADSLRQQAQGLGQAVMNSNDGIGVTQTADGALDEYINIANTIRTKAIQAASDGQ
FT                   TSDTRKAIQADIDRLMQEAQNIASTTSFNGQTLLNGGYQNKSFHIGAYSGETVKISIED
FT                   SRTEKVGKFSLAESTTGLTATTGQAGVSTVSLSVTVTSADGTTSTSTGEAVLTSGAHSS
FT                   YEIAQMVVDAFNSDAQTDGTNARASVYELTSSTAGTAAFGIRVDSSDNFTTTEAGFTIG
FT                   DATAALTNNFSTIDVTTREKAEKAIIISDYTLKDLDSRRSDIGSVQNQLESTIRNISVT
FT                   QVNVQAAESQIRDVDFAAESANFAKFNILAQSGSYAMSQANAVQQNVLKLLQ"
FT   gene            complement(176198..178186)
FT                   /locus_tag="Suden_0174"
FT                   /old_locus_tag="Tmden_0174"
FT   CDS_pept        complement(176198..178186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0174"
FT                   /old_locus_tag="Tmden_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43455"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43455.1"
FT                   /translation="MQKIEDKAVLNYKQNMEFFEKEHKRLYEMLIALETLLSDGKYPQK
FT                   YELEYKNSYFDIKELSSGNYLYGQNSIKYSKELLDTISFKKDDQVLESSYNFIYDKNSI
FT                   DLLKEADAFFPHATTAPIIYYHSSNTNASMSMNKIYKFIFLGVGLGLHIKDIIQKTKTE
FT                   IILVTDNDIELFRLSMFTCNYKDALCGKKTFFSIAQSSIELAHTFNSFYENGIIRNHYL
FT                   KFCLFSSKDESTIKQVQQAILIRPEKCYSHSRLLQKSQKILNRIAKDYKFVNLQKKESE
FT                   NFFNDKPFLVLAAGPSLNAHKEWLKKHHKKFIIIAPLAALKTLYKLDIPADIVVHIDEN
FT                   EPLAKRELDFFENRDYFKETIFIFTASVADIFFETFEKEKIYLLEDRTSYKLNNCFIDV
FT                   ASVGEASYAIALSFSKGDIYLLGLDLAIGDDGSTHAKDHSDHRNLDTSSANSITQSASL
FT                   DTAVTQVRGNFRKQVNTIPLLAMSIPVVDIHTSKLKLPNQNIYNLSDGAYFQETIALEP
FT                   SDVKVTKIIKKIDLKSHLLALFDKYSSSSLSNEELQMLKDRQKRVQKYYDFVNTFREDS
FT                   SSSSEIFMQSYTKLLNSMVAFEQDELHQIMMNYLLISSTYISDLFNTKELDNHKKHIKK
FT                   IKKIIITLLEKIIKAYEQEIEKVLEDL"
FT   gene            complement(178232..178936)
FT                   /locus_tag="Suden_0175"
FT                   /old_locus_tag="Tmden_0175"
FT   CDS_pept        complement(178232..178936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0175"
FT                   /old_locus_tag="Tmden_0175"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43456"
FT                   /db_xref="GOA:Q30U75"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43456.1"
FT                   /translation="MRALLLAAGIGSRLRPITNTIPKCLVPINGKPLLEYWLKNLSEAG
FT                   IDEFLINTHHLHVQVEEFIESSKYRDKITLVYEKKLLNTGSTLLTNRAFFDNEPFMLVH
FT                   ADNLSFCDFGKFINAHKNRPNNCDITMMLFKSDNPSSCGIVELDNRGIVQEFYEKVKNP
FT                   PSNLANGAVYICEASLFDFLECLDKKEIDFSNDVLPKYLGKINTYFNNTYHRDIGTIES
FT                   YALSQIEVLKQN"
FT   gene            complement(178933..180342)
FT                   /locus_tag="Suden_0176"
FT                   /old_locus_tag="Tmden_0176"
FT   CDS_pept        complement(178933..180342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0176"
FT                   /old_locus_tag="Tmden_0176"
FT                   /product="Cytidyltransferase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43457"
FT                   /db_xref="GOA:Q30U74"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43457.1"
FT                   /translation="MKKVFVSGDFNILHPGHLRLLKFAKESGEYLTVGVNSDAMSYKGI
FT                   NQEIRLESIKATSYVDEAFILEVSALEYIKEHMPDIVVKGKEHENRENSELDTINAYGG
FT                   KLLFSSGEIGFSSMDLLRKEFLSTNYKVNHSNKYTNRHSFKPHELKSIVESFANLNVLV
FT                   IGDTIVDEYITCEPLGMSQEDPTIVVTPLLSNKFLGGAAIVASHAKTLGANVKFISVIG
FT                   SDNNNFVKDTLEKLDIDVSLHTDTSRPTTLKQRFRAKEKTLLRVNHLKQHGVSRDIEKK
FT                   ILKSINECIDKVDLIIFSDFSYGVLTKNIINSITAMGIEKKILMAADSQSSSQIGDISK
FT                   FKHMTLVTPTEREIRLSLNDFESGLVVLSEKLASKTDAKYIFTTLGAEGVMIYNNVSSG
FT                   LLTDNIEALGALVKDVSGAGDSLLTCSSMALAVGADIWKSAYLGSLASAIQVSRIGNVP
FT                   IKKDEILKELE"
FT   gene            complement(180351..181469)
FT                   /locus_tag="Suden_0177"
FT                   /old_locus_tag="Tmden_0177"
FT   CDS_pept        complement(180351..181469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0177"
FT                   /old_locus_tag="Tmden_0177"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43458"
FT                   /db_xref="GOA:Q30U73"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43458.1"
FT                   /translation="MQIKKDNKIILDATKIYWHQERIKQWDKGERIVPITIDMALTRAC
FT                   NYGCHFCYARLQENDRFDITKDVIDNFLEDCAEIGVKAISLVSDGESTLSPVYEHTIIR
FT                   GSQLGLSMAVATHGYNTRYEALERILPHLTYLRVNISAGEAKRYGEIMGVKEDYFYQVI
FT                   QNIKDMVEIKKKNNLSVTIGMQMVLMPEDADQVIPLAKLGKEIRPDYLVVKHTSDSEDG
FT                   ALGVDYSKYAELTHILEEAESYSDDEYQVSVKWSKINSEGKRSYQKCYGAPFQLQISGS
FT                   GLVAPCGMFFNEKYSRFHIGNITQTRFRDIVKSEKYWEIMNHISSENFDAQTMCGSLCL
FT                   QHKVNEFLDDYKKGLHPLEAPTGEKPQHINFI"
FT   gene            complement(181447..181746)
FT                   /locus_tag="Suden_0178"
FT                   /old_locus_tag="Tmden_0178"
FT   CDS_pept        complement(181447..181746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0178"
FT                   /old_locus_tag="Tmden_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43459"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43459.1"
FT                   /translation="MQKVSEREYYRYESPELKLWKKLTADKQFERVSGLSQIFKEKLKV
FT                   IDVHNQSIKVELYVQKDDVYDVLVTYEAYLREKLNNIPIIVLLEGKTDANKKRQ"
FT   gene            complement(181752..182741)
FT                   /locus_tag="Suden_0179"
FT                   /old_locus_tag="Tmden_0179"
FT   CDS_pept        complement(181752..182741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0179"
FT                   /old_locus_tag="Tmden_0179"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43460"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43460.1"
FT                   /translation="MKYLVLGSNSFSGGSFINYLLDNEEDAKIFAISRSAEYHDSLLAY
FT                   KNNPKQNRVKFFQLDINNDSQNISDLIFDNKIDYIINFAAQGMVAQSWDAPLEWFNTNT
FT                   LSLVALLDKIYKFSFIKKFVQVSTPEVYGSCNNIKESMALLPSSPYAASKASADLILYS
FT                   YFKTHGFPINYTRASNVYGAYQQLYRIIPKTILMIKKNQKLQLHGGGKAVRSFIHIDDV
FT                   CKATLKIAKEAKSGEIYHLSDTKTISIYDLVNLICNKLGKNILEQIELVQERTSEDNLY
FT                   LMNNEKLLREFNLTPHVKLSDGIDDVVRWMELNYEDLKNFPDHYIHKA"
FT   gene            complement(182741..183229)
FT                   /locus_tag="Suden_0180"
FT                   /old_locus_tag="Tmden_0180"
FT   CDS_pept        complement(182741..183229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0180"
FT                   /old_locus_tag="Tmden_0180"
FT                   /product="Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43461"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43461.1"
FT                   /translation="MSNLVSKQDIMKELYSYFKEDESMVLLAGDMGFAVLDEFFDNHSN
FT                   RAFNTGINEQATVSMAAGMSMTGLKPIIYSQIPFITMRAYEQLRYDVNEHKLNIKIIGV
FT                   GADNYFSMLGRSHCMDDDDIKLISILKNILILSPTKESVRDEVKKMIEHNGPVYMRSL"
FT   gene            complement(183222..184019)
FT                   /locus_tag="Suden_0181"
FT                   /old_locus_tag="Tmden_0181"
FT   CDS_pept        complement(183222..184019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0181"
FT                   /old_locus_tag="Tmden_0181"
FT                   /product="transketolase subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43462"
FT                   /db_xref="GOA:Q30U69"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43462.1"
FT                   /translation="MINSKEIRHKTIKLSCDTGAGHLAPSLSTVEILSVLFNKYLKYTK
FT                   NNPQDDSRDRFILSKGHGAYAYYIILNELGFLPDFELEKFNTDEASIKGCLTQNSNYMI
FT                   EASTGSLGHGLPIAVGMAQSFKIQNKPNRVICMVGDGEMQEGSNMEALMLAYRFKLDNL
FT                   MVIVDANNLQAMGRVDDIALDNNRLSKVLSSFIDDGFYDIDGHNEELISECFDKFYNTK
FT                   NKNFSIMFARTIKGKGVTILEDSQKHHFRCPTLDGYVLELDNE"
FT   gene            complement(184031..185140)
FT                   /locus_tag="Suden_0182"
FT                   /old_locus_tag="Tmden_0182"
FT   CDS_pept        complement(184031..185140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0182"
FT                   /old_locus_tag="Tmden_0182"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43463"
FT                   /db_xref="GOA:Q30U68"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43463.1"
FT                   /translation="MMDNQMADTYSIDSHKLLYHPLEVSKWYETKDDWEKQKEIYPIYL
FT                   EITPIGSCNHRCTFCSVDYIGYKSIKQDEKILGDRIREMASLGVKSIMFAGEGEPTLYK
FT                   PLPNILDICSEVGIDTSLTTNAVAINETTVKNYVKNCKWIKVSINAGDRDTYASVHQTK
FT                   PEDFDKVVDNLSTAVKIKKENNYSCTIGAQMLLLPENMQSAILLAKKMSQIGVDYLVIK
FT                   PYTQSLYGTSRKYEGLTYKSMMGLEEELKKYETDEFKVIFRANTMKKLEELKQPYEKCY
FT                   ATPFFWGYIMADGSVYSCSAFLGNENFNLGNINTQTFKEIWQGDKRKQNINYVKNELDI
FT                   SSCRKNCRMDEVNRYLWALKHPNAHVNFI"
FT   gene            complement(185118..186533)
FT                   /locus_tag="Suden_0183"
FT                   /old_locus_tag="Tmden_0183"
FT   CDS_pept        complement(185118..186533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0183"
FT                   /old_locus_tag="Tmden_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43464"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43464.1"
FT                   /translation="MIEPDTYFLSSKEALRVAKQQNRSDDQDHEFLQVCYYNGEKIDSN
FT                   LANLVHLPINSLVDDLAQGEFRLPTKIDFNGLDILQEEVDVISENLTKAINEAQLFRQK
FT                   LNNIYVDRLKNAKLDFNEPLRFYLFAHSCTTVMQHISKNIADTLIEMGYEVFFHLYEGH
FT                   EEYNNYKKIFEFNPHVTININFIRNSFLSDDVFNFVWVQDPMPYLSDDSKITLRKRDYI
FT                   FSLVNLIDDLLEKKGVEFQRQSFCVNEKIYKLNPSIKREKKIVFIGSSYLDFIPEDNDQ
FT                   VNEAVKFMISFFHAGGEFTDEKIDKISNTFRLDKHYLSARIIPFIIRDISLIDLCQIKS
FT                   KYKIEIYGSGWDKYEVLRPYYKGVLNYGEEIAEVYNSATFAFAPHQNYILQQRTLEAAA
FT                   CGAIPIVYDCRKLSKEKSYSEAVVFFKTFEDIEKVLLKKSPKKDFKRLLQENSYKGFIQ
FT                   KLLNIINDGQPNG"
FT   gene            186598..187152
FT                   /locus_tag="Suden_0184"
FT                   /old_locus_tag="Tmden_0184"
FT   CDS_pept        186598..187152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0184"
FT                   /old_locus_tag="Tmden_0184"
FT                   /product="Sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43465"
FT                   /db_xref="GOA:Q30U66"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43465.1"
FT                   /translation="METFTKQYISKLVDTLKKSDLKSISKIVDALDNAKGKIYIIGNGG
FT                   SAATASHMVNDLGAGLRRRGIKSFDVESLSDNTPVCSALANDIGYKNIFYMQLKDRLKP
FT                   EDILIAISCSGNSKNITKAVKYAKKIGSKIIGITGFDGGKLKKRSDINFHVETDAGEYG
FT                   IVEDMHMVLNHIIYSYYISKA"
FT   gene            complement(187149..188201)
FT                   /locus_tag="Suden_0185"
FT                   /old_locus_tag="Tmden_0185"
FT   CDS_pept        complement(187149..188201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0185"
FT                   /old_locus_tag="Tmden_0185"
FT                   /product="Protein of unknown function DUF354"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43466"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43466.1"
FT                   /translation="MIWFDLVTPKSVLFFEPIIKEIQKQKEVFITTRGGEGYKETIELL
FT                   DLCNLPYTNIGNFGGGSLESKFRASIDRQIKFMEFLNEHHIDRLVCLSSVDACRAAFGL
FT                   GIKIINFYDIPLSDYKTNFTRALPQARLTIPLAHKMFKPFVVPDEVIERFGLDSSQIYE
FT                   YNFIDPLIWLKNFKYDFEYVKKILKNYNIDYKKPTIVIREEEYKASYVDKKYPMLYEAI
FT                   DEIQKLTNSNIIIIPRYESNYLKKAFPLASVLEEKVEIQHLLFFCDLFIGGGGTINSEA
FT                   CFLGTPTISTRSFISHYDKYQIDNNLMVWVETKEELIKKAKLLIGTKVDTRAIKQMSID
FT                   IDDMIKNILS"
FT   gene            complement(188202..189953)
FT                   /locus_tag="Suden_0186"
FT                   /old_locus_tag="Tmden_0186"
FT   CDS_pept        complement(188202..189953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0186"
FT                   /old_locus_tag="Tmden_0186"
FT                   /product="asparagine synthase (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43467"
FT                   /db_xref="GOA:Q30U64"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43467.1"
FT                   /translation="MCGIIGSTEINFNHNEVLNSLKHRGEDYQNYIIQNEMFFAHTRLS
FT                   IIDLDEEANQPMIFDEITLVFNGEIYNYKELIKEFSLECVTKSDSEVLIRLYQKFGFDF
FT                   LNSLEGMFAFCIYDKEKNLFFCARDRFGKKPLYYYCEKGKFYFASEIKAILKMLKTTPK
FT                   LNEEALWQYLALQSPQGENTFYSGVKKLPASSYLLHQNSDIKVSTYYSLADIKITHYDE
FT                   KQILKDVEKLLNDAVQKRLVGDVEVATLLSGGLDSSFITALYAKKSKHKVHTFSIGYDE
FT                   HKHYCELGFAKAASEYIGTIHHEYKISKDEYLEAIEKVLEHLDEPMADSACIPTYILSK
FT                   EIHNQGFKVCLSGEGSDESFLGYDNYFKMLNYYHLKNPQKTPFDLTKEWEYNNRRLNNQ
FT                   QVYQSSGETFTYAQLQRLFSKKIAPILHPYVSTYPPEQWLTYIDFSIWIAEVLMTKVDR
FT                   MSMAHSLELRAPFLDHHLVEYLLGVESSIKIGDTNKAILKKIARNYLPNSIIDRRKKGF
FT                   SSPFIEWLYDAHSEEILNLLLDVNKQLGIFNDDFLTFLYEEGKRGHFKQHVYSLYIFCR
FT                   WYKKVYM"
FT   gene            complement(189941..191071)
FT                   /locus_tag="Suden_0187"
FT                   /old_locus_tag="Tmden_0187"
FT   CDS_pept        complement(189941..191071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0187"
FT                   /old_locus_tag="Tmden_0187"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43468"
FT                   /db_xref="GOA:Q30U63"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43468.1"
FT                   /translation="MKKILFLTQNLDIGGVQKSVSMLANSLSDIYDCSLLLFEESKPIC
FT                   YLLRENITVETVQMQKMDLSDEDSGINIFNYRKKELSKFVQKLRPDLIFSYEDYHNILS
FT                   LSIDSDAKRIISCRISLKNVYTKSSRVHLLTPDFYFENITKLYKNAQAVVCVSDFIKKE
FT                   LLDISEKINALNIYNGIDKSMILEQSSKEVNLDFSYILHVGRLHPQKGQKDLIRAYHKI
FT                   HANISQNLLLIGEGLLRDELQEMINSYNLSHRVFLMGNISEPYHYMHKADFCIMPSYQE
FT                   GFSNTVLEMLSTSALIASKYSGYDEILNDYGNLFDVGDIDALSALILKYSNDKSITKEL
FT                   KKLQKNDVEPFTTEKSMQNYKQLISHVLLGVVKCAE"
FT   gene            191250..192089
FT                   /locus_tag="Suden_0188"
FT                   /old_locus_tag="Tmden_0188"
FT   CDS_pept        191250..192089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0188"
FT                   /old_locus_tag="Tmden_0188"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43469"
FT                   /db_xref="GOA:Q30U62"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43469.1"
FT                   /translation="MLSIIEKFPTRIAIELTPICNLACNMCPRHIIDKNSGFLDFELWK
FT                   RLLDEIKEFSPDTIVLPFWRGESLLHKEFVKFSKYALEKNIRLHISTNGHHVKDEKAKI
FT                   LSKYEFITFSLHTKEGFESALDFVKKYKTNTNTIQASFVECESEMMPFLDELIQSENFC
FT                   GFDAIRLYEEHTKEGKFGYSGKEIFESRIFCPKLTNTLVISSDGYISRCNHIWKTENYN
FT                   LNTKSIKEAWASEVMGDIKNNYPDSMCLSCDQWSGNTNGKIWKKEDNLLSEINIGNI"
FT   gene            192095..192922
FT                   /locus_tag="Suden_0189"
FT                   /old_locus_tag="Tmden_0189"
FT   CDS_pept        192095..192922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0189"
FT                   /old_locus_tag="Tmden_0189"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43470"
FT                   /db_xref="GOA:Q30U61"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43470.1"
FT                   /translation="MQNIIMEILNSLDVKRGDRVLDFGCGDANLVKFINENEYTCYGVD
FT                   IQLDIINLAKRRFQESFLNPDLLRAIPIIRDGYTIKNHGFRLPFEDEFFDCVVSFQVFE
FT                   HISNIEEVIKELYRVVKVDGKVYLEFPSSYTIVEPHLEIPFVHYLKYSKFRENYIFFFA
FT                   KLKKIDEPRKYAKIQNDYLKTSCFYRFHNEFDKLFKDGGFAKKDYSYERRSLRVQKDKV
FT                   FTLRELLLYKQRRYDNKSNLNSFGYGVKIYLKIHAFFYSILTNRMIVFTKEDK"
FT   gene            192919..194100
FT                   /locus_tag="Suden_0190"
FT                   /old_locus_tag="Tmden_0190"
FT   CDS_pept        192919..194100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0190"
FT                   /old_locus_tag="Tmden_0190"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43471"
FT                   /db_xref="GOA:Q30U60"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43471.1"
FT                   /translation="MNIPISKPYFDECEDENILKPLHSGWVVQGKFVQEFQTLFASHVE
FT                   VKYAHATTSCTTALHLALVALDIGADDEVIIPSFTYIATANVVEHVGAKPLFCDIELDS
FT                   FNMDVSKIETLITKKTKVIIAVNLFGLCANLEEIIKLAKKYNLKVIEDSACGFDAWLGQ
FT                   KHSGTFGDIGCFSFHPRKSLCTGEGGMLITNDDELNSKIAQLKDHGASKSDMLRHKEGG
FT                   SLLPEFNFAGFNYRMTDMQGALGVCQMKKASEIMCKKRILAKRYDEALKELNFLQVPTF
FT                   SVEYVHGYQSYVCLFTDSQDVRNLTKEKIDIINIKRNIFMKKLESCGIATRQGTHAVHT
FT                   LGFYKEKYDLKSEDFLMSYAADRLTIALPLYPQMSDEEFDYVVSQLKSCSNSE"
FT   gene            complement(194070..195164)
FT                   /locus_tag="Suden_0191"
FT                   /old_locus_tag="Tmden_0191"
FT   CDS_pept        complement(194070..195164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0191"
FT                   /old_locus_tag="Tmden_0191"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43472"
FT                   /db_xref="GOA:Q30U59"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43472.1"
FT                   /translation="MKKIAFFTQNLSTGGVQKSVSSLANYLASYYDVSIILAEDNKALN
FT                   YFIDKKIKIHKIKTKKVDIKKDGVGRELFDYRASELDKILHDLDADLTISYEDYNNFIL
FT                   LQTKNGCKKVLSCRVSLSESYKKDSFIHLLESSFYFEMIKESYQKADLIIAVAKHIENE
FT                   LLQLNSAINSRTIYNGIKEMISVEDETEHNNFILNVGRLHPQKGQKDLIYAFNDIKDEI
FT                   NEKLIILGDGGLRQELESLILELNLQNRVLLKGFANPYPYIKKCSLFVFPSYYEGFSNS
FT                   ILELMSVKKAIVSYNYKGADEILPKGSLVELSDTENLSKKILHYLKNKSNKQNLGNKLY
FT                   EICKKFTLQKSFDSFHSEFEQLLS"
FT   gene            complement(195165..195890)
FT                   /locus_tag="Suden_0192"
FT                   /old_locus_tag="Tmden_0192"
FT   CDS_pept        complement(195165..195890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0192"
FT                   /old_locus_tag="Tmden_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43473.1"
FT                   /translation="MKKRIEVLHKIIAQKQKGTKDKRMYSYLNTKKYGYEKINNYFCGE
FT                   NVLELGTDGSSTSSILVRWSKKLTIVDMHDKFTSQIQKDEKLKDVNFILSSWEEYKPDE
FT                   KFSDIFLTDSLEHIQEPVKLLKLIKNWLSEDGRLHIIVPNALSIHRLVGVEMGFLSSPY
FT                   ELNDNDISSNHIKVYDHNILKQEIKDAGLNIVVCEGVQFKPNTDIQLADLDENFSRALN
FT                   NLSYMFNEYCAEIYVCCKL"
FT   gene            complement(195874..196968)
FT                   /locus_tag="Suden_0193"
FT                   /old_locus_tag="Tmden_0193"
FT   CDS_pept        complement(195874..196968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0193"
FT                   /old_locus_tag="Tmden_0193"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43474"
FT                   /db_xref="GOA:Q30U57"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43474.1"
FT                   /translation="MKILFIIDTMSTGGAQKVLLSHCEYLVKCSHQVTLVSLKKINKHK
FT                   ISDKINYVELIDLNEKITTNIFSILQELSIYVKQVEIIVGFSDFIVNYIAYLSAKVYDK
FT                   PLLICVRNQLSKQIETYPQHTEINKDLMSFILSNSNVLVQSEVIKKDMLDNFNIKNAKV
FT                   TVLANPISMKIIKPKNIFDSHKKNIVVVGRLSIQKNILLIIKALPLLKKEYLERLCLHI
FT                   IGDGDEHTKLEKEINSLNLNKYIKFHGYKKEILPYINEADIMILASRFEGQPNVILEAF
FT                   SQNTLVLASDIEPIKELVNDNENGVLFKDNDVNSLVSKLVYCLDNDLNKLVKNAYTSLE
FT                   RYGDVHHKFENILKNIVSDYEKKN"
FT   gene            complement(196965..197879)
FT                   /locus_tag="Suden_0194"
FT                   /old_locus_tag="Tmden_0194"
FT   CDS_pept        complement(196965..197879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0194"
FT                   /old_locus_tag="Tmden_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43475"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43475.1"
FT                   /translation="MLQKRDSCPVCDSKESSTVCEFKYEKLYDFFSVYDGFNDEDFNTI
FT                   KDDFYTLLKCKNCEHHYQQMVADEDFSYTLYEKWINPEKSYKYQKSKYNSRFFNILGYE
FT                   INLLFHHFNKDASTIKILDFGAGWGDFAILAKAHGFDVYAVELSDVRLKNLQKNNIKIV
FT                   SLQECDIKFDYIRSDQVFEHLSSPKTLLKQLTNLLNKDAILRVAVPNTDALYEKLQVTE
FT                   INHASDFQNEFNAIFPLEHLNCFNPKNLELMANSVGLKKYKFPLKAEYASSTNWALENI
FT                   FSNLYKPIINRYLKDKNNMCFTK"
FT   gene            complement(197882..198910)
FT                   /locus_tag="Suden_0195"
FT                   /old_locus_tag="Tmden_0195"
FT   CDS_pept        complement(197882..198910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0195"
FT                   /old_locus_tag="Tmden_0195"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43476"
FT                   /db_xref="GOA:Q30U55"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43476.1"
FT                   /translation="MNHNIISYNYPKSATINIEGLCNFKCNYCPYHSQTRTTYTEKNNY
FT                   KISFDTAKEQIDILKSYGVKHINICATGEPFLNFDIFKIFKYIKNVGCTSSVLTNASSV
FT                   ISKSLQEIIDSDLLYFSTDLDADNRETFKEIQGRDQFDAWYKNIESLNKLRKLNDNKMK
FT                   IVVNTIINKDTFNELDGMLDICIDLGIDEWSLNVLVAEDSNDYINNIKSMRYERELVSS
FT                   KIEKLKKRANDNNIRLQSPEYFDINIDIYNDLECNKPWRESIMINVPLPNDEPGENIGR
FT                   VVIGCTTNKSVEYNLGNIHKNTLEEIWNGSEFQRFRKNFIDGCDKECSDDCLYHKFTKK
FT                   DN"
FT   gene            complement(198900..200429)
FT                   /locus_tag="Suden_0196"
FT                   /old_locus_tag="Tmden_0196"
FT   CDS_pept        complement(198900..200429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0196"
FT                   /old_locus_tag="Tmden_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43477"
FT                   /db_xref="GOA:Q30U54"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43477.1"
FT                   /translation="MTVWLILLIAFILRIIPRLISKNSWNYDTYFHMAISRIIKKHNYK
FT                   IPKDKGRFSLDDNMDYPWLFHWLFSFVPDKNIYLAEKISSAIIDVIHIALAMWISHKLF
FT                   INLDMQNANGHLWVGFLMAISPSFLRIGMGPRAYNATPRVLSQLLLFIFFVSLAFFYQE
FT                   GSTTWLIIGLVCSVLINISSIFGFQFIWFISIILALFGFYEALVLTILGLIISFLIFGN
FT                   KVYIVIRGNVLSMKYYYSTLAKNYVGLIEQKACISCYFKRFKQNFLTTKMLNWFMMDQY
FT                   PLHILIFFMPQALIVLFYQDYLSQDSDFLFIVFLSSFILFLLVLIPKFVFIGEAERYLE
FT                   HTLFIQIFLFVEIFANLNNTVLIIISIWYIICYTQYIRLYLKYYKNIKVPYKLIEQIDK
FT                   EENIIYPLGQYSWILLYNLKKAKICYYSTSWTNSKVSQEDLHLITGNYPYPGTNLRVLK
FT                   QKFGITHILTNELAIQNYKNFIKNTQNDNLEFIDKEDNCIIYKIEDFKNES"
FT   gene            complement(200430..201533)
FT                   /locus_tag="Suden_0197"
FT                   /old_locus_tag="Tmden_0197"
FT   CDS_pept        complement(200430..201533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0197"
FT                   /old_locus_tag="Tmden_0197"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43478"
FT                   /db_xref="GOA:Q30U53"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43478.1"
FT                   /translation="MSYVNNKNLIYKFYSTRSLKGFAKNFLLKSMAGQKMFLYNKNIPR
FT                   VINISFNEHTCMFKCKICPYSQNEVADMYKQKKEMSFETLKNIVSSVPNDSFYSFDISS
FT                   IGETLEFKNLAKFISYMKEQKPLVNTIISTNGLLLNEKIARDLIKSGLDNIQFSLFAGD
FT                   EDGHKFVTQSDSFTKVKKNIINFKKIKDSLGSKTPFTQTFMIETKENKHLSNSFVEKWS
FT                   SFVDKAFIRHMYKMGHPIDGMTPSYEDENHKKERYPCVAPWYSTSIISNGDVLGCYMFN
FT                   WHAKEKESMVIGNINKNTLSEIYTSKNNQDFRDNQLDLNFKSCEACKDCNLWDAYTNIW
FT                   EKDSKSYKYSSLKVFDFFNTKLEYRGG"
FT   gene            complement(201533..202288)
FT                   /locus_tag="Suden_0198"
FT                   /old_locus_tag="Tmden_0198"
FT   CDS_pept        complement(201533..202288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0198"
FT                   /old_locus_tag="Tmden_0198"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43479"
FT                   /db_xref="GOA:Q30U52"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43479.1"
FT                   /translation="MTNNIIEKYKKILQKQDFEFLKRIYSNDIKVYEKRILQYEFTNFE
FT                   NVLDAGCGFGQWSIPLAKHNTNVYSIDISKERVSFTEELAQELNIKNLTTSLQSINSTN
FT                   FKDNSFDAIFCYGVFFLTDWKKTLQEFKRLLKPKAKLYLNANGMGWYLNLLINEHNKTS
FT                   SYNPRKYALDCIINTERYINNKSLYQEGLDVIIEKNELLDALKLYDFFDIVVADEGKLN
FT                   SQEAHSFFKGTYHGQTGVYELTALKDKSN"
FT   gene            complement(202292..203314)
FT                   /locus_tag="Suden_0199"
FT                   /old_locus_tag="Tmden_0199"
FT   CDS_pept        complement(202292..203314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0199"
FT                   /old_locus_tag="Tmden_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43480"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43480.1"
FT                   /translation="MDNFASIKNQIKKSIANFNLDLSNKIILTEAATGNYVVTPAIAAL
FT                   AGAKYVYAFTKDSKYGSVEDVKKQTNNLLKYLNLEDRVEIITDINSLNLDEVDILTNTG
FT                   FLRPIDDKIINKLNSKCVIPLMWETWEYRKSDLDIEECAKKNIKVYGTNEDDSRLRTKE
FT                   YLGYMVLKFLLTLNHTPISSNILILGCNHFTLYVQKVLNQNDYNYTIINEYKNIINIDS
FT                   YDAIVLLEHHNNKLLIGDSGYIKTKDIRSDVDVIHICGSVDFTNANFNYIPKVPASFGN
FT                   MSYTVDNIGSNVIIELHTAGLKVATGMIEANSLNLKKSEYKDFMQNNYPAMSFKDEKYW
FT                   "
FT   gene            complement(203307..205274)
FT                   /locus_tag="Suden_0200"
FT                   /old_locus_tag="Tmden_0200"
FT   CDS_pept        complement(203307..205274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0200"
FT                   /old_locus_tag="Tmden_0200"
FT                   /product="Asparagine synthase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43481"
FT                   /db_xref="GOA:Q30U50"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43481.1"
FT                   /translation="MCGIIGVVSLKKPSLNIEYTNAMIKTLHHRGPDGSGSCFFHTGCR
FT                   HTKRISFFKAYYKNINTNELHPHDWDLFFGHTRLSIQDLSINAHQPMSDLSQNIWITYN
FT                   GEIYNFKELKAELQICGHRFKSNSDTEVIIYSYIEWGIECIKKFNGMFAFALYDNFKKE
FT                   LFLTRDRYGIKPLYYTLNNDGTLLFASETKSILEYKDYSYEVDKAALVEYFTFQNIFTD
FT                   KTLHENIKLLPAGNYIKINLREKEHSLKTQQYWDFDFTKPLNLKDEREYTEELDRLFTQ
FT                   AVNRQLVSDVEVGSYLSGGIDSGAIAAIASKSIKNLKTFTVGFDLNSASGLELAYDERQ
FT                   KAEYMSYLFKTEHYEMVLKSGDMERCLSDFTYHLEEPRVGQSYPNYYANKLASKFVKVV
FT                   LAGTGSDELFAGYPWRYYRAVNNVDFDEYINKYYEFWQRLIPNREICKVFKPIWGDVKD
FT                   VCTRDIFADVFKKHSNRLTSPEDYVNHSLYFEAKTFLHGLLVVEDKLSMAHSLETRVPF
FT                   LDNDLVDFSQQIPVNLKLSNLQNIISMNENETGNKQHKYFQKSNDGKNILRETASRYIP
FT                   NNITTLTKQGFSSPDASWFKGESIEFVKEKLLNKDANIYKYMDKDAVQSSVNEHLNGKQ
FT                   NRRLFIWSLLNFEEWSNIYG"
FT   gene            complement(205276..207390)
FT                   /locus_tag="Suden_0201"
FT                   /old_locus_tag="Tmden_0201"
FT   CDS_pept        complement(205276..207390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0201"
FT                   /old_locus_tag="Tmden_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43482"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43482.1"
FT                   /translation="MKQVSTYYFNPQVALYDALHSENSVDTLFFYDGVFLQEAPLNCIN
FT                   VPIGTFFDYFSKTIHPQIIKLNFDGVGFSDDTKEQIAQSITQAIDSIKKQKEDIVNTFL
FT                   DTDVCASNLNVMLLVFLQYVRDNEEPNKDIILKLLTITIFFKEHILTIEPIIIELSTSI
FT                   LKHLQRDKNIFNIHLNYALELIQGLPLKEVEAEYFKLLSEHQTILDIIQNFVLIKTIFN
FT                   QDRFKEYIEKFSLALFDDNFFESSTLEQKKKIFKLYYLSVLKYNRSRDYIAIYKVLYPI
FT                   FEKAIQRELDELIFYMYTPLLMSWDETAPSQDGLKEFNDKIEKPIENLIKSKLIKKYDL
FT                   KPNKKKIDNSKKIKVAFLIDRVIPYSIYNVFYSLLESLSKAPTAEYEFIIYNLNFIESG
FT                   SLDETVQELKELGFKYVDLHKEYVGDEYPFYEIIEKTLKVRDRLIEEKIDMIIGFNSRP
FT                   EYNFLFTTRTAPKQIYWSHGNNEYDLENIDKKIAHGSIGDRLDFDSFSINMEEDYYNPH
FT                   VDMNEVKKIKDSYPKDSFILGTIGRLIKIEDDEYLQTVASIMKKNPQTIYLACGSGKQE
FT                   SIKKRIEQLGISDRFFFPGYIDTHVYGHVIDLWLEPFKISNGESLNEYMYKNRPYIALW
FT                   NEWSEKDKLKESYLYDKYVWPYSIQNYIDVADELINNKELVEFVLEKRKPINEEALKQI
FT                   NKTFLDAIKD"
FT   gene            complement(207399..208787)
FT                   /locus_tag="Suden_0202"
FT                   /old_locus_tag="Tmden_0202"
FT   CDS_pept        complement(207399..208787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0202"
FT                   /old_locus_tag="Tmden_0202"
FT                   /product="Flagellar hook-associated protein 2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43483"
FT                   /db_xref="GOA:Q30U48"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43483.1"
FT                   /translation="MGSNISSLGIGSGVLTADVIDQLKEADTSRIVKPLENKITLNNQK
FT                   QDAYKLLDSLMKTFKASASALSYDTIFDSKSVKSSGKAEVKVDAGSTVESFSLETVALA
FT                   KKDITKFGSVATPASTIASGAGVLKINNFEIPYDGTTTLSALAQSITEIAGSSVSASVL
FT                   QTGNGSYNLVLSSKSTGASQAISVSDTDDGTAGAGSLNAALFDPYNAITNPNGYEKVQT
FT                   ASDATFKYNGIAMTRATNEVSDLILGVNIKLKQEGDFSLVDISQDSTAISDELKLFTDS
FT                   YNALIANLHDMTLKDEATGAEGIFNGNSFVKSISRDLTRTITSLNTNNNSLINYGIDID
FT                   RSGKMSFNKATLETKLKEDPDAVKLFFTGGTNSEGNKVTGFFTTVDEKLKSYTGYGNLL
FT                   SNFETDLKNEGKSLSKNHAAAKASLDTRYEIMAKRFTAYDGMISRINSQFSSLQMMIDA
FT                   EANN"
FT   gene            208925..209323
FT                   /locus_tag="Suden_0203"
FT                   /old_locus_tag="Tmden_0203"
FT   CDS_pept        208925..209323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0203"
FT                   /old_locus_tag="Tmden_0203"
FT                   /product="Flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43484"
FT                   /db_xref="GOA:Q30U47"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43484.1"
FT                   /translation="MKETNGDQKGLNMYGSSAHNIYAQNNVGIESPAKLIEMLYEGVLR
FT                   FNAQAKKAINDKNIEKKIYWTNRSIAIVVELVSVLDKSQGEVSDYLNGLYNYQIQLLTT
FT                   ASLRGDTTKLDEVSTVFKALLEAWRETT"
FT   gene            209324..209578
FT                   /locus_tag="Suden_0204"
FT                   /old_locus_tag="Tmden_0204"
FT   CDS_pept        209324..209578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0204"
FT                   /old_locus_tag="Tmden_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43485"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43485.1"
FT                   /translation="MWIKKLQIAIIEKDADTISILIETTPKFESVKEIESAIYLLKEAN
FT                   EVMHTLKNETALTMKQLKKNIDFLESTQPQIRSKLDLRF"
FT   gene            209647..209757
FT                   /gene="ffs"
FT                   /locus_tag="Suden_R0006"
FT                   /old_locus_tag="Tmden_R0006"
FT   misc_RNA        209647..209757
FT                   /gene="ffs"
FT                   /locus_tag="Suden_R0006"
FT                   /old_locus_tag="Tmden_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            complement(209852..210082)
FT                   /locus_tag="Suden_0205"
FT                   /old_locus_tag="Tmden_0205"
FT   CDS_pept        complement(209852..210082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0205"
FT                   /old_locus_tag="Tmden_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43486"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43486.1"
FT                   /translation="MNSIKHINNALSDLDKEVEAILADMSLAMNEKDNRMLPLLQQKRV
FT                   LSQTLEDLNYLKNNPPKPNQACGISKHRKDN"
FT   gene            210149..210340
FT                   /locus_tag="Suden_0206"
FT                   /old_locus_tag="Tmden_0206"
FT   CDS_pept        210149..210340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0206"
FT                   /old_locus_tag="Tmden_0206"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43487"
FT                   /db_xref="GOA:Q30U44"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30U44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43487.1"
FT                   /translation="MPKMKSVKGAVKRFKVKKNGTVKRGTAFRSHILTKQDPQTRTTQH
FT                   KSKIIAKVDEKNVKAMIN"
FT   gene            210448..210804
FT                   /locus_tag="Suden_0207"
FT                   /old_locus_tag="Tmden_0207"
FT   CDS_pept        210448..210804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0207"
FT                   /old_locus_tag="Tmden_0207"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43488"
FT                   /db_xref="GOA:Q30U43"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30U43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43488.1"
FT                   /translation="MPRVKTGVVRRRRHKKILKLAKGFYSGRRKHYRKAKEQLERSMYY
FT                   SFRDRKQKKRDFRKLWIIRINAACRLNGMNYSTFINGLSKAGIELDRKILADMAMNDAA
FT                   AFSAVAASAKAALK"
FT   gene            complement(210856..212550)
FT                   /locus_tag="Suden_0208"
FT                   /old_locus_tag="Tmden_0208"
FT   CDS_pept        complement(210856..212550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0208"
FT                   /old_locus_tag="Tmden_0208"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43489"
FT                   /db_xref="GOA:Q30U42"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43489.1"
FT                   /translation="MSSDVDTSLLDCLSSLTLLCVEDNKTTQLIYHSIFKNITKRVIFA
FT                   DNGKDGFEIFKTQKIDIIITDYEMPNLNGIEMTKLIRELDKDIPIILVSAVQEIDIIVE
FT                   ALKLNVNNFLKKPIILTEVIQAVEKVSKILIADNYLREKREKKLKELETKGKYNSLQEE
FT                   LAFAKELNIIRNDFYYQMHENSSIALIDFFYKPLDVLSGDSYSAREIDKNMQLYFIIDG
FT                   MGKGLSASLSSMLLTSYLNHLIDKRVNNFDFKSLINSAVEYIKPVLLEDEAMSADFMLI
FT                   DYKNSKLHYAKFAMPSSLLQTTNGKIVKIKSNNAPLSKYIKKIKISSFNISNILKFLFY
FT                   SDGVVENSIREKDKTYANYLQSDFLASFTKDELREKILWRIDKQEDDMTFIFINRFNLM
FT                   KYISNVQNVFDTSLDAIEKANEWYGDFWSCTSSDYKLIYNAGVVFNELFMNAYEHGNLG
FT                   LDAQMKHKLINDDNYFATLEKLEKTCNKKISVCINIIEYNSNKYVTTAIRDEGAGFDTQ
FT                   ILSDIFRNRKNFNGRGVYISRQASLGIYYNTKGTSVLFLHKLESEKA"
FT   gene            complement(212550..214526)
FT                   /locus_tag="Suden_0209"
FT                   /old_locus_tag="Tmden_0209"
FT   CDS_pept        complement(212550..214526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0209"
FT                   /old_locus_tag="Tmden_0209"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43490"
FT                   /db_xref="GOA:Q30U41"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43490.1"
FT                   /translation="MSIKYKLNLITAIVVSFALIIIAIATLKAIDDKENISKSQSLNTL
FT                   SQKLSLLIHETQKERGASAGFIGSHGKQFGDILPNQRASTTKEYESLKVYIQSLDLDFF
FT                   PKELKDEISAFNEKMSQIEQIRSKVTELSIGSKEVVTYYTEMNSKILNITSLSAKLANS
FT                   AELVKALSAYNNFLKSKERAGVERAVLSSTFAADKFSDGAFAKWITLVAEQDAFLDSFL
FT                   SMATQSSKDLYKQKINSPVIAEVNKMREIAKLRANEGSLGVDSVIWFSTITKKIDILKE
FT                   IDDELAKQNTLLLEELKAASIQKATISIGSYLAFAIAIFIIIFIISRGVNRSVRSSLEK
FT                   IDCVSSNLDLTCDIIVEGNDEISRISKALNVMIIAFKESVYQAKDVSATTSSESKVLNS
FT                   IVEQLTKNGIVADKKITVINTLVTEVGQRLDAIEESSITVTEDLNITYSVLDTFVNQLH
FT                   LVVEAIEHGSNRQQELVQKVYSLTEQAKNIKDVLAIISDIADQTNLLALNAAIEAARAG
FT                   EHGRGFAVVADEVRKLAERTQKSLSEISANVNLITQNVIEISEETQVTSENMGNIANSA
FT                   QELISSSEQTKENLSVTNAKSSDVMYQSTYIATKTKELIHNMDEIIELSKKNTEHRNLV
FT                   DEAATKLLSDANRLQNELSKFKI"
FT   gene            complement(214526..214816)
FT                   /locus_tag="Suden_0210"
FT                   /old_locus_tag="Tmden_0210"
FT   CDS_pept        complement(214526..214816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0210"
FT                   /old_locus_tag="Tmden_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43491"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43491.1"
FT                   /translation="MELQISSNIVTIAGNIKSISDFQAIKKIVDDVAAAHKAIHLNIVD
FT                   SLSITSSVIGYLNKLVLKDNIDLHVNVGNEQLLELLDDLNLTAMFKAKRGL"
FT   gene            complement(214898..216079)
FT                   /locus_tag="Suden_0211"
FT                   /old_locus_tag="Tmden_0211"
FT   CDS_pept        complement(214898..216079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0211"
FT                   /old_locus_tag="Tmden_0211"
FT                   /product="Recombination protein MgsA"
FT                   /note="central region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43492"
FT                   /db_xref="GOA:Q30U39"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43492.1"
FT                   /translation="MADFTHLLRPSNFDELIGQDHLSKDKAPLRVLCQKGVLGHSFFFG
FT                   PSGTGKTSIARIIAKTMELPFYEFNATSIKIEQLRAIFEQYKNTLQKPLIFIDEVHRLA
FT                   KNQQEVLLPVMENNSALIIGASTENPFFSLTSAIRSRSMLFELHHISNEALSRLLRRAL
FT                   DSSDITCSDEALEYLIKSSGGDARSMLKLLEFASNIGTHITLDILKSLRPNALSVGSSE
FT                   AGVHYDLSSAMIKSIRGSDMDAAIYYLARLIDGGESAEFIARRLVILASEDVGNANPQA
FT                   LTLATSAMTSVSKIGYPEARIILSQAVIYLCASPKSNSAYLAIKSALSAVNDGVMLDIP
FT                   KNITQNSKGYLYPHDFGGYVKQNYLSKPLKFVTLKPIGYEKKMVDWIESIKKI"
FT   gene            complement(216083..217021)
FT                   /locus_tag="Suden_0212"
FT                   /old_locus_tag="Tmden_0212"
FT   CDS_pept        complement(216083..217021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0212"
FT                   /old_locus_tag="Tmden_0212"
FT                   /product="Pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43493"
FT                   /db_xref="GOA:Q30U38"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43493.1"
FT                   /translation="MRLNKYIAHHSSYSRREADKAIQDGYVRVNGEIQDNPATDIYEGV
FT                   DVVYVSGKPVTPRDKYTVIVYNKPKGELVTKSDPKERKTIYDTLPKEYKHYVPVGRLDY
FT                   ASEGLLLLTDASKVASALMESNLERIYKIKIKGEVTSEMEAAMLNGMMLDDATAGGHSH
FT                   SKVTSMEFKPFIGYKIQKNEPNYSILKVALSEGKNRELRRFFAHFGTDIVDLKRVSFAE
FT                   IELNNLPTGKVRFLSRSEYSALSKFLKEEKKAEEKSEKKPSVKKYDKTDNKKTDYKKSD
FT                   KDSKKPRYKDDKKKDDKKKVFKDKKVTKKRG"
FT   gene            complement(217018..217980)
FT                   /locus_tag="Suden_0213"
FT                   /old_locus_tag="Tmden_0213"
FT   CDS_pept        complement(217018..217980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0213"
FT                   /old_locus_tag="Tmden_0213"
FT                   /product="KpsF/GutQ"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43494"
FT                   /db_xref="GOA:Q30U37"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43494.1"
FT                   /translation="MNYKEIAQETLKIEAQTLLDSADKIDDVFDKAVEIILTCKGKLIV
FT                   TGVGKSGLIGAKMAATFASTGTPSFFLHPTEALHGDLGMISHSDVVIAISYSGESEELS
FT                   SILPHIKRFNTPLIGMTRDKNSTLGKYSDLVIDVIVNKEACPLGIAPTSSTTLTLALGD
FT                   ALAVCLMRAKNFKKSDFASFHPGGALGKQLFVKVKDLMRVKELPIVKADTKVKDAIFKI
FT                   SEGRLGTVLVTDEQNRLLALMSDGDIRRALMSEDFSLEESVLKYATKNPKTIEDENILA
FT                   SEALVIIEEMKIQLLVVTDKHRRVLGVLHIHTLIEKGIS"
FT   gene            complement(218027..219043)
FT                   /locus_tag="Suden_0214"
FT                   /old_locus_tag="Tmden_0214"
FT   CDS_pept        complement(218027..219043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0214"
FT                   /old_locus_tag="Tmden_0214"
FT                   /product="Cytochrome c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43495"
FT                   /db_xref="GOA:Q30U36"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43495.1"
FT                   /translation="MYTKILLSAVIVTSSLSADLLIDAKKAGLKPIPTDKKELSKLIDN
FT                   PKNPISEKKVELGKKLYFDPRLSKSGFISCNSCHNLSEGGDDGIPAAIGHMWTPNPHHL
FT                   NSPTVYNSVFFNSQFWDGRDPHLEAQAQGPMQAAPEMSATPEHVAAVVTSMPQYVADFK
FT                   AAYGKDVKITFEKIADTIATFERTLVTPSVYDDFLNGKKDALTKAQKDGLKTFIDKGCA
FT                   TCHNGIALGGEMNAFNITGVYKFQDVGDFKGDKNGMVKVPTLRNITQTAPYFHNGQIWE
FT                   LRDAIKEMGRIQLGADINDVEVASIEEFLKALDGRKEPVVLPQLPASTQTTPKPDIK"
FT   gene            219227..219961
FT                   /locus_tag="Suden_0215"
FT                   /old_locus_tag="Tmden_0215"
FT   CDS_pept        219227..219961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0215"
FT                   /old_locus_tag="Tmden_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43496"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43496.1"
FT                   /translation="MRNRLGKYVSSINTLNVEERALYCNTLILAEEGAGKTNLACRIRN
FT                   YVIDSNVATLYLDFSNSEEHEIEIRYKDENFNYIRFDESDEFQAEFDALVSQNKHIYMA
FT                   VDPNYFSNKRDITSKLTFTLQHKGLLANYYYFFHDIENLNGFYTKFEDFLLYMLNFLNL
FT                   KKYGLTFLAQPHSSFENPQLKLLFTFLYLGKCSNLEYFNTANLKKLPKNRFFYQYRTNY
FT                   HTLLFNDIKSNIVQIDEYLFKE"
FT   gene            219964..221328
FT                   /locus_tag="Suden_0216"
FT                   /old_locus_tag="Tmden_0216"
FT   CDS_pept        219964..221328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0216"
FT                   /old_locus_tag="Tmden_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43497"
FT                   /db_xref="GOA:Q30U34"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43497.1"
FT                   /translation="MQKLFDEVASLDERCYREFYLSEDILMEHAAHGMAEYIRSNFKKN
FT                   VKISIVCGSGNNGADGLALGRLLHGDFDVSLICAKPPKSKMALLQKQRAASIGVRESLE
FT                   LLDCDVLVDAIVGTGFSLEADKEMAQLIEKMNAINAFKLACDVPSLYLFNADVTCTMGA
FT                   LKKRMFLDEAKEYVGEIHVIDLGICRDIYERSSNWNLLDLQDLKLPHRFKKDSHKGSYG
FT                   HLAVISGQMSGASIMSAMSALRFGSGLVTLVGFEKIEIPHSIMYSHAVPKNTTALALGM
FT                   GLGAEFSKAELAKFLSNGLPLVADADIFGMQIVLDILKRESVVITPHVKEFVSLLKIAD
FT                   IAEISVDELQKNRFMYVEMFCKAYPKVTLLLKGANVIIAQDETFYINPHGKQSLAKGGS
FT                   GDVLSGLIGALLAQGYAPLQAAIHGSLAHVKLSILYEGADFSLTPDDLIDAIGKL"
FT   gene            221374..222153
FT                   /locus_tag="Suden_0217"
FT                   /old_locus_tag="Tmden_0217"
FT   CDS_pept        221374..222153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0217"
FT                   /old_locus_tag="Tmden_0217"
FT                   /product="Thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43498"
FT                   /db_xref="GOA:Q30U33"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30U33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43498.1"
FT                   /translation="MQNLLKIGKYELGSRLIVGSGKYKDFQTTKEATLASGSELITVAV
FT                   RRLNITDPNKENLRDTFKGTNVKFLPNSAGCVTAEEAITTFRLTREATGIDLIKLEVIG
FT                   DTQKTLYPDVIETIKACQILSKEGFIIMAYTSDDPIMAKRLEDAGAHAIMPLAAPIGSG
FT                   LGIQNPYNIVFIREAVNLPVIVDAGIGCASDAAYAMELGADGVLTNTAIAGAQNPMMMA
FT                   EAMKHAVIAGRMSYLSGRIQKRPYATASSPINGMIQF"
FT   gene            complement(222150..223064)
FT                   /locus_tag="Suden_0218"
FT                   /old_locus_tag="Tmden_0218"
FT   CDS_pept        complement(222150..223064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0218"
FT                   /old_locus_tag="Tmden_0218"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43499"
FT                   /db_xref="GOA:Q30U32"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43499.1"
FT                   /translation="MMIDGYIPTILIVDDKATNIAILSDLLKDDYKIKVANSGQRALSL
FT                   VREKEKPDLILLDIEMPQMSGYDVCKALKSSAETIDIPIIFVTAKNSSEDEEYGLNLGA
FT                   IDYIKKPFHSGIIKIRIKNHLTLKLKSKKLEELSMCDSLTGISNRRYFDEILEQKYREI
FT                   IREPKNLSIIMIDIDYFKLYNDNYGHWMGDECLTKVAIALKKAIKRPTDVLARYGGEEF
FT                   VVLLKGVDKDGAKQVAQSLIDSISNLNLAHNFSPVSKIVTISAGVAIKEVDEDISKEDL
FT                   IKKADAELYRAKNSGRNKFCAGF"
FT   gene            complement(223061..227419)
FT                   /locus_tag="Suden_0219"
FT                   /old_locus_tag="Tmden_0219"
FT   CDS_pept        complement(223061..227419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0219"
FT                   /old_locus_tag="Tmden_0219"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43500"
FT                   /db_xref="GOA:Q30U31"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43500.1"
FT                   /translation="MKKTFIIISFLFTSLYAHESVKFGVFAYKGVEQTRKQYEPLVKAL
FT                   NEKLDKKIILEVLTQQEINEKISKKELDIVTTNPTHFLSIRDKYALSGAIATLNGYDKG
FT                   VITNKLAGVIIVRPESEIKNLKDIKNKIIAAPSKSHMGGYRAQAYELFLAGVDISKKSK
FT                   KIIEMKGSHQEVVKAVLTGVIDVGFIRDGILEEMIYKKEISEGDIRVVNEQKGVDYPYK
FT                   ISTKLYPEWPVFSLPHLEEEIVKDFIAALFSLKPNDEMKKNGIYNYTLPADYLQVEELS
FT                   RTLRLPPFDKAIDVTFMDILNSHKIELIIIFISLLLGLFYHLRERRRKNFISSLLSNIG
FT                   EGVYGIDNNGNCTWINKKALNMLGYSEKEILHKNQHDIFHSHKPSREKYNADECPINLT
FT                   SKDKVTRTLNEHFIKKDGSLLPIILTVTSIDEGGAIVVFRDISNSIAKEQALKRSEREL
FT                   RLEKQRLDAIIQGTNVGTGEWNIQTGDTIFNERWAEIIGYTLDEISPTSIDTWEKFSHP
FT                   DDFIATKKLLEEHLDGKTEYFESEMRMKHKNGHWVWVVDRAKVFEWDKDGKPVLMSGTH
FT                   QDITERKLAQEKIEHINNQLESLLESIPDLIWMKDVNGVYITCNKRFEDFFGASLDEIK
FT                   GKTDYDFVSKELADFFREHDKKAMHSNVPLTNFEEITFAVDSHKEFLQTTKTAVRGRNG
FT                   EILGILGIGRDLSELKRSEQKLRDSKELLDLFFKQSMHGFFFMMLDEPIEWNDSIDKEK
FT                   TLDYVFEHQRVTKINEAMLEQYKAKEEEFLGFTPTDFFKHNIEEGRDIWRELFSRGIYH
FT                   VNTNEQKFDGTPMVIDGDYICLYNSEGKITGHFGVQREITQDIRDKEALQEAKEEAERA
FT                   NNSKSEFLANMSHEIRTPMNAIIGFSEILLESDLDEKQLHQLHKINSSSKMLLSIINDI
FT                   LDFSKIEANRLEIEHREFNLESILSKIKMLFKQTALDKGLEFYCNVEEGVPSMVVADEL
FT                   RITQVLINLLGNAIKFTKEGAVKVDLKISKKDEKSATLLFSVIDSGIGISQNQIEKLFK
FT                   PFSQADDSITRRYGGSGLGLSISSRLVSAMGGEIDVKSKEGVGSTFSFEIIVGVNSWSQ
FT                   NSLKLENMDISKDASKLLKYPDFSNVKLLLVEDNEINQEITTEILKKVKITPDLANNGK
FT                   EAVDIFVAKPNYYDIILMDIQMPIMSGYEATKIIREHDKEIPIIALTAAAMIEDRHKTL
FT                   DAGMNDHLSKPIDSNEMFSSIAKWLDIDFTIKQKSSNTKVKDSAVLDLEYAINELNLNS
FT                   DILHKILSKFYEELESDFASLVELLHVEDKSAKSLIHALKGVSSNIGAKELASIATYID
FT                   TQLKKAQAIKPEDIALLKEAIERVKEKIVSYLRENPLQEDEMREEDFKNLYLEVSQDIK
FT                   NGTMVEFQNQQLLFNLLKTKVNRHELELWMREMDNFDYDKAYNIMKEWQL"
FT   gene            complement(227596..229215)
FT                   /locus_tag="Suden_0220"
FT                   /old_locus_tag="Tmden_0220"
FT   CDS_pept        complement(227596..229215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0220"
FT                   /old_locus_tag="Tmden_0220"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43501"
FT                   /db_xref="GOA:Q30U30"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43501.1"
FT                   /translation="MIKFNKYALIGTIFILSLFSSFYFIDVFSEKNMELQKQILIKQAQ
FT                   THFKDQVNTRVWNASYGGVYAIPKEGQKPNPYLRDNILKVDENLTLIKINPAWMSRQLS
FT                   EISNIDGFHFRITSLKLINPDNKATPFEERALKYFDETNEKEYYEIDKESNFNYMGALI
FT                   TTEYCLPCHKHQGYSLGDVRGGISVSLDSKEYFEVTSSIKTSIILLKIFVVIFLFTIFS
FT                   LIFKQLRYNQQLQTEVKRRTKEIESTKHLLQEIIDTDSSFIVLTDDKEIIYANETILNF
FT                   TGYHSIEEFKKNNEYIFDVFEKIEDNSNFMQTCNDGIHWIEYLIKEQNSKNLKVCIKKD
FT                   GKYRYFKPYAKEIKTDDKVLYLITFDEITNEYVKIKELEHMASTDALTKLFNRTKLNDV
FT                   LEKEMALSRTVPSPLSVIFLDIDYFKAVNDTYGHDAGDRVLINIANIITSSIRAGDIAA
FT                   RWGGEEFMIILQATPVSEASVLGEKLRARVEGHLFETVGKITISLGVTEYINAESEESF
FT                   IKRVDEALYEAKERGRNKIIIK"
FT   gene            complement(229251..229526)
FT                   /locus_tag="Suden_0221"
FT                   /old_locus_tag="Tmden_0221"
FT   CDS_pept        complement(229251..229526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0221"
FT                   /old_locus_tag="Tmden_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43502"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43502.1"
FT                   /translation="MSETKERCIELLTNNSINLDSEIDFNVNSEIYVLSFAFIVESFMQ
FT                   ASEESQLAFLAALEKALLSKEDGAEKFFESMGQLLLMTHLSKEIIV"
FT   gene            complement(229523..230968)
FT                   /locus_tag="Suden_0222"
FT                   /old_locus_tag="Tmden_0222"
FT   CDS_pept        complement(229523..230968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0222"
FT                   /old_locus_tag="Tmden_0222"
FT                   /product="Sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43503"
FT                   /db_xref="GOA:Q30U28"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43503.1"
FT                   /translation="MGEFFSGVNSFLEAALFFDILFGMVEGVKLPFLVVWLISGGIYLT
FT                   LLTKFINLRMFKHSFDILRGKYRTVDDVGEISSFGALTTALSATVGLGNIAGVALAVAL
FT                   GGPGATFWMIVAGFLGMSLKFTEVTLSLQHRVFLKDGTVMGGAMEYLSRGLAEKGYAKF
FT                   GKILSLIFAVFMIGGAIGGGNVFQVSQALGVVSQEVEFFDKFPIIFGILIAVFVGFVII
FT                   GGVTRIAKITEFLVPIMAIIYVSASLWILAYHFEKIDDAISIIFHEAFSTSALYGGVAG
FT                   SIVHGFQRAVFSSEAGIGSSPVAHAPVKTKYPVRQGLVALYEPFIDTIVICTMTALVIV
FT                   ITGVYEHDGAYMALIEAKEGAALTSAAYGTVISWFPIILSISITLFAFSTIIAWAYYGE
FT                   RAWVYLFGSTYSIIYKLSFLLLIIIGTVVNTAVLVDFSFMLFLTMSLPNILGLFILSKD
FT                   VKRALEEYLVKLKSGELDREAIR"
FT   gene            231140..231217
FT                   /gene="tRNA-Pro1"
FT                   /locus_tag="Suden_R0007"
FT                   /old_locus_tag="Tmden_R0007"
FT   tRNA            231140..231217
FT                   /gene="tRNA-Pro1"
FT                   /locus_tag="Suden_R0007"
FT                   /old_locus_tag="Tmden_R0007"
FT                   /product="tRNA-Pro"
FT   gene            231241..231317
FT                   /gene="tRNA-His1"
FT                   /locus_tag="Suden_R0008"
FT                   /old_locus_tag="Tmden_R0008"
FT   tRNA            231241..231317
FT                   /gene="tRNA-His1"
FT                   /locus_tag="Suden_R0008"
FT                   /old_locus_tag="Tmden_R0008"
FT                   /product="tRNA-His"
FT   gene            231360..231436
FT                   /gene="tRNA-Arg1"
FT                   /locus_tag="Suden_R0009"
FT                   /old_locus_tag="Tmden_R0009"
FT   tRNA            231360..231436
FT                   /gene="tRNA-Arg1"
FT                   /locus_tag="Suden_R0009"
FT                   /old_locus_tag="Tmden_R0009"
FT                   /product="tRNA-Arg"
FT   gene            231452..231528
FT                   /gene="tRNA-Arg2"
FT                   /locus_tag="Suden_R0010"
FT                   /old_locus_tag="Tmden_R0010"
FT   tRNA            231452..231528
FT                   /gene="tRNA-Arg2"
FT                   /locus_tag="Suden_R0010"
FT                   /old_locus_tag="Tmden_R0010"
FT                   /product="tRNA-Arg"
FT   gene            231550..231633
FT                   /gene="tRNA-Leu1"
FT                   /locus_tag="Suden_R0011"
FT                   /old_locus_tag="Tmden_R0011"
FT   tRNA            231550..231633
FT                   /gene="tRNA-Leu1"
FT                   /locus_tag="Suden_R0011"
FT                   /old_locus_tag="Tmden_R0011"
FT                   /product="tRNA-Leu"
FT   gene            complement(233117..234271)
FT                   /locus_tag="Suden_0223"
FT                   /old_locus_tag="Tmden_0223"
FT   CDS_pept        complement(233117..234271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0223"
FT                   /old_locus_tag="Tmden_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43504"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43504.1"
FT                   /translation="MNIFEKIYKKGLDRDDETIDVHQIIKIYDTYLTKDVKNFLKFLRR
FT                   KDNFLYFMMEIPNKINQIHNKEYIESNIIDPYYDGELSDEDLYKIDIEVMRDILLNYYL
FT                   SEAKDSLLYYETYGEIFPFSIYFDVYRTEFQEVVKKKYVEPIVRNLYPLSENLKDDTEF
FT                   NEDDMLKSFYINVTNNSFTAAVMRFEEIIMPKCLEILGPQYKRNFIKYSNDAIINVKHW
FT                   NILFFDYSENNKFNNQKYLSETNIKWIPVLDRSDINFDQFYGKFLAKSLEQYIFGYAIK
FT                   HTIGTSSNLKLILENNFYFISEFAPIMNYISSIVKLGSQINYLFIKILSMNCNLTDIET
FT                   TFIVNTLEISTKTKDKQKLKIKTYKNIEKELPFIDSNYAKFRWT"
FT   gene            235156..236025
FT                   /locus_tag="Suden_0224"
FT                   /old_locus_tag="Tmden_0224"
FT   CDS_pept        235156..236025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0224"
FT                   /old_locus_tag="Tmden_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43505"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43505.1"
FT                   /translation="MIKEKRESFILKKEHLAMFLDEIKDDIINYSEQALNLEFNPSEYY
FT                   AFERIINLIHGNTPENKDNFIKKAYHNVQRKVCYVNKQDSEQEGKTPFEKGIMTATKNQ
FT                   YKNVNMGIIESEKYNNKNILDRSYMGLNFDTKDKKASYAAARNFRKKYRPIVKEAMAKL
FT                   RYKYHTFKNAIPAQEFKQNMNTDVFRDKIDYERLYKYVSCFDIKPTKETFHLLRGVIYI
FT                   LCLKHNPSLVPEHYKKSLGIIGKEFIPINKDSEEDTKAKEALLELMEDMELTPEKFEQL
FT                   RKEFQNEF"
FT   gene            complement(236216..236479)
FT                   /locus_tag="Suden_0225"
FT                   /old_locus_tag="Tmden_0225"
FT   CDS_pept        complement(236216..236479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0225"
FT                   /old_locus_tag="Tmden_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43506"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43506.1"
FT                   /translation="MAQKSYDKALFRLISILSMLTKDERPTISSLAEEFNVSKRTIQTD
FT                   IYQRLRGWDITKDKFGRLVFRDGVDIFNAIGKFGRKGKRVVF"
FT   gene            236707..236982
FT                   /locus_tag="Suden_0226"
FT                   /old_locus_tag="Tmden_0226"
FT   CDS_pept        236707..236982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0226"
FT                   /old_locus_tag="Tmden_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43507"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43507.1"
FT                   /translation="MIELSKYSIKRCFMTKEQFILRLKELEISKQDFSELCRVPYSTIN
FT                   NWGVMREGKPLVIPNWVEPFLEYYEKAKKLEYVMREICQKIESVKG"
FT   gene            complement(236979..238109)
FT                   /locus_tag="Suden_0227"
FT                   /old_locus_tag="Tmden_0227"
FT   CDS_pept        complement(236979..238109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0227"
FT                   /old_locus_tag="Tmden_0227"
FT                   /product="Filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43508"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43508.1"
FT                   /translation="MKRWIWQQSEYPNFAYDLKRLESLIQKVSLEQGYLIALAQTIDKD
FT                   NILQRRFESLMNEAISTSAIEGEILNRDSVKASIQKKLGFKEIHYKKIDETTDYLIEIL
FT                   IDANTNYDKELTMERLFGWHNALFPKGYSGLRKVNTASFRGEETMEVVGIERGREVVFY
FT                   EAPPRADLEHEMQRFLDWFNAAEPSLIKACTAHLWFVIIHPFDDGNGRIARAITDLVLS
FT                   KIENSKISRLYSMSSVINTDRKGYYSALEHTTGYINKENNPLDITNWCEWFLSTLHNAL
FT                   IDTKKKLDYIVQKTKFWDRHKNDELNAREIKVLNFILDMGAENFQGNLSKKKYMSIADT
FT                   ASTNASRDIAQLLELGCIRQKEGSSGRNTAYEIILD"
FT   gene            238230..238643
FT                   /locus_tag="Suden_0228"
FT                   /old_locus_tag="Tmden_0228"
FT   CDS_pept        238230..238643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0228"
FT                   /old_locus_tag="Tmden_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43509"
FT                   /db_xref="GOA:Q30U22"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43509.1"
FT                   /translation="MLSLTFLILFIKTEEGDGVALEIFKLSIILGFALVLLHFSALKKS
FT                   EKPSLRTVPFIFMGSFVFVTILSYLFALYDNSSIKEKRRAFYDENSFICETGAFKKKEH
FT                   YLVSIKDGWSVYEDNYFKKEDLLLEISNCEQKR"
FT   gene            238651..239148
FT                   /locus_tag="Suden_0229"
FT                   /old_locus_tag="Tmden_0229"
FT   CDS_pept        238651..239148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0229"
FT                   /old_locus_tag="Tmden_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43510"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43510.1"
FT                   /translation="MVSFFCFENYFQAVDEDVIKEVTWGSGNYREKALLLWDLENIPYS
FT                   HLPKVKQSLKFAPERSFIISTQTINPSKLKSIHREGFEVLRAHKSDSDEKIKSVYRILK
FT                   EYDEFIFISSDSDFVDIGKKILSERKKLTWIMQDANKKRIAMKMNLCDKNLKLITLSKF
FT                   EL"
FT   gene            239224..239646
FT                   /locus_tag="Suden_0230"
FT                   /old_locus_tag="Tmden_0230"
FT   CDS_pept        239224..239646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0230"
FT                   /old_locus_tag="Tmden_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43511"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43511.1"
FT                   /translation="MSKILYSNVNILIDEHNREILVNPADERFYYIGHKEMHSVFFDAR
FT                   LSLNENGIYTIEGRQTIYSEHSAMGSDYEKLLCKHPKELIKKSSLFWLFGLYKVRGVHK
FT                   REVYCKYICRYKEYCIIQREKIISSEFAEDKSELKK"
FT   gene            239906..240190
FT                   /locus_tag="Suden_0231"
FT                   /old_locus_tag="Tmden_0231"
FT   CDS_pept        239906..240190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0231"
FT                   /old_locus_tag="Tmden_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43512"
FT                   /db_xref="GOA:Q30U19"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43512.1"
FT                   /translation="MKSILESLVAIIVVGTIFMGILYLLKLGINHTNSFDMDEKVEAFE
FT                   NQKTLLCSTGITNNQKLLVNKNNNWEIYKEKYFKREDMLLEIRICMVEE"
FT   gene            240196..240375
FT                   /locus_tag="Suden_0232"
FT                   /old_locus_tag="Tmden_0232"
FT   CDS_pept        240196..240375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0232"
FT                   /old_locus_tag="Tmden_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43513"
FT                   /db_xref="GOA:Q30U18"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43513.1"
FT                   /translation="MRTPDYVVIMIGLFFIAESLSSAFASYKMRDCEDEKKIQELEEHV
FT                   KRFEEKLNKDDNLG"
FT   gene            240410..240655
FT                   /locus_tag="Suden_0233"
FT                   /old_locus_tag="Tmden_0233"
FT   CDS_pept        240410..240655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0233"
FT                   /old_locus_tag="Tmden_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43514"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43514.1"
FT                   /translation="MKNYLILENYRMLIKKDELNRVFLSYAINSGNEIIEHTEGILKVV
FT                   NCEIADAMYKYFDTDLISYGVEVFDENTEFVNQSEY"
FT   gene            complement(240717..240968)
FT                   /locus_tag="Suden_0234"
FT                   /old_locus_tag="Tmden_0234"
FT   CDS_pept        complement(240717..240968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0234"
FT                   /old_locus_tag="Tmden_0234"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43515"
FT                   /db_xref="GOA:Q30U16"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43515.1"
FT                   /translation="MHILNDLTPAELENFYRDIGKNVKNARKEKKISQMQLALAIGHNS
FT                   VGHIAKAELYKYEKHFSLEQLFKISRILDISLHDLIPE"
FT   gene            241091..241450
FT                   /locus_tag="Suden_0235"
FT                   /old_locus_tag="Tmden_0235"
FT   CDS_pept        241091..241450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0235"
FT                   /old_locus_tag="Tmden_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43516"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43516.1"
FT                   /translation="MALSEEDKLWIEKIRKDTEREERELKRRGIIPYTEDELEEINAKK
FT                   AEMREQARFAAEALKKVRVSKIGFESSHYVDLTDGIDINLAMDLTSTTYINPATGFPMI
FT                   SGIGGLDSGGNTYGF"
FT   gene            241524..242681
FT                   /locus_tag="Suden_0236"
FT                   /old_locus_tag="Tmden_0236"
FT   CDS_pept        241524..242681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0236"
FT                   /old_locus_tag="Tmden_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43517"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43517.1"
FT                   /translation="MIRKLVLIIPALVFAFGNKQQYEIDQKAQQIGFSKIFDKYKNGIL
FT                   EPSSLEFNSMVYDDSNNIIIAGAKSGKPIVRKVDVHGNELWRKQYGDDYGGVQYIEKAS
FT                   ENTYILIRNTEDKKNKNSFLTQVLLIDTYGNLKGESLFPLLLDENSKIKQTNDKGFILV
FT                   SGTNIIKMDANGFKVWHQTYENLDLNDFIELVNDEYLFVGKKNIDEKKIDKSAHIMRTD
FT                   SKGNILWNKDYTNINEFQNIIAKPNELILMGNMPLQVTITKIDQKGNIIWNYIHTASEN
FT                   TFGRDFIENKSGNFVVAGKIYMSSVKSEYLMIFELTNNGELLWNHSYGLSYGSDTANSI
FT                   LEAPDGYIMSGVITPIEHKRNESGFFPSRERGWIFKVNRQGVYSD"
FT   gene            243104..244984
FT                   /locus_tag="Suden_0237"
FT                   /old_locus_tag="Tmden_0237"
FT   CDS_pept        243104..244984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0237"
FT                   /old_locus_tag="Tmden_0237"
FT                   /product="Protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43518"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43518.1"
FT                   /translation="MEFEITIAVLVLSVVVISSVVWMRKSIQSSPDATLQNELNEKRDL
FT                   AARVPLLTETIENLRVENKDLLLSIDTHKTYLSQKDVTIAENEKDLIEFSKKVTSTENR
FT                   VVKLENEKNELNISVETLKSQLQQAKNDLDKKEHELQQLNLGFQKDIERLNNKNSDLQN
FT                   EINVHKDELRIAQKKIDNLLEENTALQSEKSVLQANSNALNESKNELLQAIKLLKDDLT
FT                   SAQVKIESLQESNGELKAEKSKFQAELSAQQENNEKLKKDFEEQSKKLELKLNEIMQQN
FT                   LDSKLKKFDETSMKSLDGLLKPFKENLDTFKKKVEDSQENSTKKFAELSKEIEQVTKAG
FT                   MNISKEAESLTKALKGKKQMQGSWGEMILESVLEYSGLRKGAHYETQESYKDEEGNTKR
FT                   PDVIIKLPQERTIIIDSKVSLNDYSNYIHAETDEERLLATNGIVTSFKNHIDTLDSKDY
FT                   AHYKVGTLQYVFMFVPIEGAFAMAIQQDPKLYEYALKKHIAIVNPSTLTVSLRTIYLYW
FT                   QSEQSNTLASKLFDEAGKLYDKMVGFSDSFGKIGKQLQSATSTYEHAHKQLTEGPGNLM
FT                   GRVENLKRLGARTSKTLKDSKMEFQDFDEAEMEIELLPEPVIETLSSDDD"
FT   gene            245096..246103
FT                   /locus_tag="Suden_0238"
FT                   /old_locus_tag="Tmden_0238"
FT   CDS_pept        245096..246103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0238"
FT                   /old_locus_tag="Tmden_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43519"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43519.1"
FT                   /translation="MEEILEKIYRQAQDYFSNSPVIVLGSGASAAHGLPGMWQLSEYLK
FT                   NNIIPNPEHLKSWNEFIELLNNGVDLESALHQVTLHPDITKDIIIKTWELINPKDIEVF
FT                   NSIVASNAMLPLSTIIKKLFNSTASDLNIITTNYDRLAEYACDIEGYYHYSGFTSGLLR
FT                   TKANKDYLKTKRKVNIWKVHGSLDWFRKENNDLIGLSNLESYPASLLPEIVTPGIEKYS
FT                   KTHLEPYRTIIHEADNALETSNSYLCIGYGFNDKHIQEKLVNKCVHGNAKLLILTRNLT
FT                   EATQEFITTKGCKNYLAFEIDNEVDTKIYSSLLAEPIVIPNMNFWSLSGFLQLI"
FT   gene            246116..247855
FT                   /locus_tag="Suden_0239"
FT                   /old_locus_tag="Tmden_0239"
FT   CDS_pept        246116..247855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0239"
FT                   /old_locus_tag="Tmden_0239"
FT                   /product="Protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43520"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43520.1"
FT                   /translation="MPIFNYQDHETLGKVISVDTGVVIIEVSDLEKLKRLQVNRLVVLQ
FT                   SSKAEQYLIGLIQKLMRKKIFDEELEEEEFKEENLCKITLIGTFKNREGTQENVFRRTL
FT                   ETVPEIDANCFALEDDKLTSFMRVISQSSGEGNALSIGNYTLDENARAYINGNKLFQRH
FT                   AFIGGSTGSGKSWTTAKIIEQMAQLENVNSIIFDLHGEYKPLQSIDNIEYFKIAGPSDI
FT                   EQEKGIEDNVLYIPYWLLSYEALVSMFVDRSDQNAPNQSMIIAREIRNAKEAYLTSKSE
FT                   TEILKNFTIDSPIPFDLGGLLTTLNVINSEMVPGAAPRKEKMGDFNGKLSRMISRLENK
FT                   ISDRRLGFLFQGGADVMEFEWLNKLVKTTIGVKLENEKAGIKIIDFSEVPSDILPLIVS
FT                   LIARLSFSVQQWTESSKRHPIALLCDEAHLYIPDKNNSNSSDEISLKIFERIAKEGRKY
FT                   GVSLVVISQRPSEVNRTVLSQCSNFIAMRLTNTDDQMVIKKLLPDNLGGFGDILPILDT
FT                   GEALVVGDASLLPSRIRVDKPTITPDSGTIEFWDEWQIATDPTRLDSAIENWRKQSIQV
FT                   ISV"
FT   gene            247907..253171
FT                   /locus_tag="Suden_0240"
FT                   /old_locus_tag="Tmden_0240"
FT   CDS_pept        247907..253171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0240"
FT                   /old_locus_tag="Tmden_0240"
FT                   /product="conserved hypothetical protein, putative DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43521"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43521.1"
FT                   /translation="MEIDISKISNLDNKVSNEPIIIEAKFSPKFNLAFLQNSVLVLLEL
FT                   NVVNNSDQPLSNLTLTLTSTPTFIKAKVWNIETIVAQQRFDIHDRNIQLDNAMLLDLNE
FT                   SESVHISLSLTSNENVIATFEQTLELLPRNQWSGISHMPEMIVAYVQPNDTKVEHLLKK
FT                   AASILREHNKEASLNGYIGGSTKAWEISSAIWTAIGSLGLDYALPPASFEQTGQKIRTP
FT                   GQIWETGLVTCLDSTLFICAALEQCGLNPIIIFTKGHSFAGVWLKDEESSTVIIDDITA
FT                   IRKRIKLKELVVFETTFLTKRPCPSFTKAIEQGEKQLAEGEDDMFEMIIDIKRARMQRI
FT                   KPLSSLDSKANATPLVQEAESLDPIFDEAPDLPDDEILHNEEISSKPTDRLDMWQRKLL
FT                   DLSLRNNLLNFRTNKRMIKLDAPNPGQLEDRLADGNTIRIKPRPDLMNGSDLRDKTIHE
FT                   SRELEDIHKVHALDALQRNEVFVSVNTEELESRLTELYRTARATLSEGGSNTLFLAVGF
FT                   LSWTRSDKDDKRYRAPLILIPVILNRKSMREGFSLVLHDDEARFNPTLVQMLRQDFELE
FT                   LPIDQRELPKDDHGLDISGIWRQVSNAIKDIKGWEVSEEVVLSTFSFAKYLMWKDLIDH
FT                   TEQLKQNPVVRHLIETPRDPYPSNVTFTDPKKLDDDYAPDKTFCPLPVDSSQLSAVMAS
FT                   AKGKDFVLIGPPGTGKSQTIANIIAQCLAEKKTVLFVSEKITALDVVYRRLRDVGLGDF
FT                   CLELHSNKARKLDVLQQLNRAWDAKGNSDTEEWKREAQKLKILRDELNQFVKHLHKTYP
FT                   NNLTPHQAIGQILIGEHFPKLGLQWSSPDTHDIETIERLRALAERLDVNAREVGNIKDN
FT                   NLNIIAHDEWSPSWQEKIIETSALMITKINQLELASDTYFKALGFSSSSFELRVRNGLS
FT                   LFAQALPQAAGYDRRFVLRPDIGRLMDDLDRGIQYVKQHQNIFKQLSVPYHGDITKIVV
FT                   EELNEQWNNAEQTFWPISWFKKRSVHNKLGVYIQGKNKPNVPTDLLKIKELQVLESNIN
FT                   NLSDLTHKTSALWTGLNTRLNEAESVQAFHKTLSEAIVSLANDAENLVIIKGALEKLFG
FT                   DGNTLLETNGSVATAGNNYHKALNEFNDTFEYFISTAGISSTELLEKVEDNLSKLSEMC
FT                   SEIPAMKPKLHTWCGWRKAHKEAVNAGLNPLVLGIEQGKVNLGEVRNTFETDYCRWWLN
FT                   SIVDNDDILRTFIVAEHEKRIADFKILDERFTKLTSEYIYAILCADLPEQEGVKKSSEW
FT                   GILKREMQKKRAHKPLRELISLMPTTITKLTPCLLMSPLSIAQYLSTDIALFDVVVFDE
FT                   ASQIPVWDAIGAIARGKQVIMVGDPKQLPPTSFFNRASTAGEDDIDEDIEVDLESILDE
FT                   CLGANLPTLNLSWHYRSRHESLIAFSNHRYYAGGLVTFPSPVTDDRAVSFQHIKDGVYE
FT                   KGGTRTNRPEALALVDELVSKLKERKFQDSKLTIGVVTFNSEQQRLIEDLLDEARRNNP
FT                   DIETYFAEDALEPVFVKNLESVQGDERDIMYFSIGYGPDLTGKISMNFGPMNKSGGERR
FT                   LNVAITRARYELRVFSSLKAEQIDLSRTQSGGVRDLKHFLEFAERGSRAIMGNNSDSIN
FT                   NHDSKFEEAIANALKEKGWEVHPKIGVSSFRIDLGIVDPDSPGHYIAGIECDGATYNRA
FT                   TTARDRDKLRENILKGLGWNIFRIWSTDWWQDRSGSLEKLHMQLESILNQKREEVII"
FT   gene            complement(253559..254692)
FT                   /locus_tag="Suden_0241"
FT                   /old_locus_tag="Tmden_0241"
FT   CDS_pept        complement(253559..254692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0241"
FT                   /old_locus_tag="Tmden_0241"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43522"
FT                   /db_xref="GOA:Q30U09"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43522.1"
FT                   /translation="MAKFINSKKYEGVQYYIKADGTKSYYVRYKDEENRLKRVKIGDET
FT                   DGTTEVYCKNKRIEILNAQNKGEQPPKIVKNHRKKVLTLNEVADKYFTTKDSSRSTFDR
FT                   ISKYKKHIAPVLGHRGVTGITKNDLISIQDSIIKEQNLSPQTANMVIELFGTIFIYGFK
FT                   EEMYEAVNPTLKVQKFKVRNTRERFLNKLEIEELFDAAKQYDEKNANGGVLELFTKLAL
FT                   TTGARMESVLNIKKCDIDLQNDIIRLVDLKNGGEVYSGYITDTTRELLYQKSKAIKFTD
FT                   YLISFNNNGKKIGARQLQTRLKPLLDDLFNQGLDVKDRKNRIVIHSLRHTCASQLAMAN
FT                   VPILQIQELLNHADISQTVRYAKLQGDANKKAIQGVF"
FT   gene            complement(254763..256343)
FT                   /locus_tag="Suden_0242"
FT                   /old_locus_tag="Tmden_0242"
FT   CDS_pept        complement(254763..256343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0242"
FT                   /old_locus_tag="Tmden_0242"
FT                   /product="HipA-like protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43523"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43523.1"
FT                   /translation="MKLNQTEEIILNIVTKEQEIVASVLIAITQMNPRTVQRALKKLAE
FT                   YGLIEALGTTKDRRYKRIYNKDEAPHQYIVFNSGEKSGKLSFGNGEYTFVYENNYKGEE
FT                   FEGLKKSSTNKSSELFAFFENLIPEYERREKLLQGKEDLGLVLEELSNSHGALDFIPMS
FT                   EVHKYVSNYGKRASWVSVKNEILQDNNFPNLLDFELLIDDDILDAESNTEHSDLSGFQT
FT                   KIDVEIDFKNKQIKESDSAEYLLKPRNKKKHNYFHVDDDGKKRHFPYIAFNEHLFMSFA
FT                   KNELGFNVPYTAIIKAKDIDYHYITKRYDRYKGLKYPQKDFAQVLNILSKNKYKSDSQT
FT                   LFEAINKTLMNKEQKLEALRFYYYSYLIKHADLHLKNIAALNIGNNKYILSPLYDLISI
FT                   GIYNGDAYDIGLGMKSPYKKPKNWNINDFYTLGSAIGIAPIAFKKEARKITKIFLQKMP
FT                   QYIKKVQEFEKIHPLPMQQTRDSKSSATFSKRLTSMFENKIIQLKKSGIIQELELVQEA
FT                   GGLLNAEKN"
FT   gene            complement(257213..259519)
FT                   /locus_tag="Suden_0243"
FT                   /old_locus_tag="Tmden_0243"
FT   CDS_pept        complement(257213..259519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0243"
FT                   /old_locus_tag="Tmden_0243"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43524"
FT                   /db_xref="GOA:Q30U07"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43524.1"
FT                   /translation="MRLDTDNTGWEMIGEQIVNNSSVSPQIEIFGNQVYVAYRNTNTSL
FT                   TVKTLNLGDVTPTWADLGVISLSNGGSPYSSFKMALSANGTPSIAWADSNNYTLNIVKY
FT                   DSDANDGVGAWDLPTEVFNFGGWNGQAKQIDLKFNGETPYVVFLKNSWEGAFVYTTTEE
FT                   GSWEILGSTIELGNAASLDLEFDNTGTPYMISSDWQGVVVVKYNSDTSAWNELDPTNSS
FT                   SALANTKVDLQFDSNNKPFLVGHDSNGEMVYMEFGPVPESSDNGGGSNGDEDNGDNDNN
FT                   EDNGGGATPPPPSNGGGSSTPVAPTSPVTPAPTAPIVSTVDGTTVQTTTTTQTRTTTDA
FT                   SGNKTTATVSAEKFTILPVSTTRTDSTGGATTADVPLFWGESSRTEWATTASIPVGIGL
FT                   STEGSRAPAEVQTKQTALADLIFYIDNTTPNTDNGKSKMLSGGTTFLGALSNIETLVVN
FT                   KVTLTSTDIAASVTPITITGTANTIVTTAGDIAPVEALVIDAHTLPFNSTLQLQNVEFA
FT                   VIIGEDLTIRGGEGKNILFTGAGHQNIMLGEDDDELYAGDGDDTVGSAGGDDRIFGEAG
FT                   NDTIFGGEGNDMLHGGSGTDVATYSGNIAEYIITRDEGKTYVALASNPNEIDTIINTET
FT                   IKFADGNYTIENSIMLNKIATLYTQILGRQAEIDGFQYWAKDTISLGNIALGFIESAEY
FT                   KSSSGVNWETLDASAKVEQFYEALLGRSSDEGGKAYWVNAINTGMTFEQAAEGFIESIE
FT                   MQGIYQAKEDWNFFV"
FT   gene            complement(259538..260059)
FT                   /locus_tag="Suden_0244"
FT                   /old_locus_tag="Tmden_0244"
FT   CDS_pept        complement(259538..260059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0244"
FT                   /old_locus_tag="Tmden_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43525"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43525.1"
FT                   /translation="MVNDKTITLYKTDGNVLVKTFATGDGELFEVDGSNVYIDLGNFML
FT                   DYATDYYVKIDAGAFIDEAGNEFAGITDATTWNFSTMAKPDGIWTPVGETFGTSWGSSD
FT                   LEFSGTTPFVLFDTQDADWNNVLTVKTLDNTGNWVTVGNEGFITANQSTSDLEIGPDGK
FT                   PYVVSYESGF"
FT   gene            complement(260154..261116)
FT                   /locus_tag="Suden_0245"
FT                   /old_locus_tag="Tmden_0245"
FT   CDS_pept        complement(260154..261116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0245"
FT                   /old_locus_tag="Tmden_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43526"
FT                   /db_xref="GOA:Q30U05"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43526.1"
FT                   /translation="MSDTGEGAALHGKPTDIKIDADGNFYVSHFLMLESSGIYKYASDF
FT                   TEVAEISATANTWSMIINNDGLIVAGDLLISEDFSIGGEIFKIDTLNYALSGTPDSSAS
FT                   GEYLITLIATDADSNATEHTFTITVNDVPESQAAPVIDLFTGNGGEGTNNFTGESYDYN
FT                   LVPFTNGASPISDADSTELQSLKISIPTAQLTRESYTEYLTDGGGDWDIQIDLNLNYVG
FT                   SYTTPDGNITFDLQSSVIDNNCVITFTGQNGNAESVAAFNELLSLLHYRYNNGKVIQGG
FT                   LESHQRTFSITAVDAEGNETTTPATFTVAPGGGYCCTRI"
FT   gene            complement(261123..262403)
FT                   /locus_tag="Suden_0246"
FT                   /old_locus_tag="Tmden_0246"
FT   CDS_pept        complement(261123..262403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0246"
FT                   /old_locus_tag="Tmden_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43527"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43527.1"
FT                   /translation="MQHTLLNATSLIFIDAHLEEIDTLCANLPHDAEIQLLNSEENLLI
FT                   QIAAQLKNRNDIAALHLITHGRSGELLLGDNGVFLETLPLYGKELLAITQAMSSEGEIL
FT                   IYGCEVAFGERGSAFVEMLRDITGLKIAASTHKVGSSELGGSWELDNAHVNSIVSPLVV
FT                   SEFKGVLDPSPDTTAPVITSTPITTVDEGSRYNYALAATDDNTVTWSVKGGTALPSWLS
FT                   LGKGESLTTLVPDFSDPRGMAYNEVTGDIYATANSFLSFMMEVATESFIWKISPNGDKA
FT                   LFTTSVSGQIGSMVIVGDYLYAGNLSLGSGIAGEIVRYDLSDTDGAVTPEVLLSLDSPG
FT                   IYSAGALGLAAHGSFLYAVDYANSKILKIDLANLTAEPMVYLDLGLQNKSQPYGIAFDA
FT                   AGNLYGTLLGAQEGGVGEVYKFDGTNF"
FT   gene            262552..263232
FT                   /locus_tag="Suden_0247"
FT                   /old_locus_tag="Tmden_0247"
FT   CDS_pept        262552..263232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0247"
FT                   /old_locus_tag="Tmden_0247"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43528"
FT                   /db_xref="GOA:Q30U03"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43528.1"
FT                   /translation="MLETLKDKSILFLEDNLEFAQNTIVLLNIFIKTIYHVVTISQAKA
FT                   ILKSRHVDIIICDIKLKNENGLDFIKEIRSSDLLTPIMIISGHKDESFLFRAIPLYLSA
FT                   YLLKPIKYEELIEALQICSEKIIINSKEKINLKDGWCFDTKLCILKKDEEEYALNKKEA
FT                   QFMKLIAYNSERLITKEMLHESVWEFEDMSDSAVTNFMLRIRRRFGKNFIYTIPDLGFR
FT                   FNIH"
FT   gene            complement(263206..266403)
FT                   /locus_tag="Suden_0248"
FT                   /old_locus_tag="Tmden_0248"
FT   CDS_pept        complement(263206..266403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0248"
FT                   /old_locus_tag="Tmden_0248"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43529"
FT                   /db_xref="GOA:Q30U02"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43529.1"
FT                   /translation="MQFIFRLLFITLATLSSLYSEQLQKVSLQLQWFDQFQFAGYYVAK
FT                   EKGFYEDAGLDVSLLKFENSILPIKSILSGSATYGVGRSNLIIEKSNGKSVVLLASILQ
FT                   SSASVFVTTKDSNISTVKDFVGKRIMLSDDVVSDLGLRAMINKKNVPTGNIVVQKNSFD
FT                   INDLINHKTDLMAAYLSNEPFLLEQKGVKYTIFDPKDYGLDVYSDILFTSQEEMNNNPQ
FT                   RVEAFTQASLKGWRYAFENIEETVALILEKYNSQNKSKEALLYEAAVLKKLAYANGAEL
FT                   GQLDMTKIEKIYDYYSSMGLIEKKIDFKSFVYQVKKPQISFSEQEREFILKHPEILLSD
FT                   VQWEPFSSISGGNNSGVFKEYYDEIQKVSGLKFSFVQIGNAENFQLVLDALKEKKIDMI
FT                   DGTGKTDARGEYALFAGPFMQVSLGIASLRDNPYTTLNSLESKKIAMASGGTAMEFIYQ
FT                   HFKNAKIYETESVDKALSLLSHRKIDAVIDNLAVVDYGILRYNNSNLLTTQIDDYDFKI
FT                   YALIRSDYPLLQSIMQKSIEYIRSQEEIKINNTIINDALYRVPKQVSLSIAQKQYLSEK
FT                   KEITMCVDPEWEPFESIDEKGVHQGIAADLIRLVSERTGVAIKLIKTATWEESLELSKT
FT                   NKCDILSFLNQTPQREQWLIFSDTLLSDPNVIITREDHPYVVNLSEVHNETVALPQGTM
FT                   LEERLRKDFPSLKIISAKTEEESMSMVSQKKADMTIRSLIVSANAIRKEGLFNLKIAGQ
FT                   PNNYENIFSIGVLKSEPILISILNKGIHSITDEEKEQIVNKHTAIVLQKESDEKVLKAA
FT                   FYGTIFLLMVLALISLWNTLLRKKVKQEVTKNIEIKEQLFQKSKQAEIGNLIAGISHQW
FT                   REPLSKLSSINLITIAKLKNGIPIDNETMLKQSDEIEKTIDFMSVTMQNFLMFYKKSTT
FT                   KINFSALKSIEASLSIIETKLIDNSVTMEINGDEGILLYGIENEWMQVWLNLINNSIAI
FT                   FIERKIATSKITINVTNEKITFCDNGGGMNMEQKHHGLGINMCHDIVSKYEKTFHLQNF
FT                   ENGICATILLMNIKTKS"
FT   gene            complement(266655..267632)
FT                   /locus_tag="Suden_0249"
FT                   /old_locus_tag="Tmden_0249"
FT   CDS_pept        complement(266655..267632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0249"
FT                   /old_locus_tag="Tmden_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43530"
FT                   /db_xref="GOA:Q30U01"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43530.1"
FT                   /translation="MSKFEKIFWLTIIILTVIFIILQTLATLNKSQSDAPKEALDSVII
FT                   GINLDKADNNISLNIKQEIASINSAIDINIDNIFASVQKNIDPFLDFHYSVVGEYIELG
FT                   AMATDRINETIQKKLFGADFQNSVKEAFKKIDIKYDESINSHIQMIHESATLNIDYKLN
FT                   NEILSRLENDISSFTSMQEGKLSLILGAKLIPKIAQAISTKIALKASSKFLLKSSTKAG
FT                   AKYATTGTAALAGTTCGPFVWICSPLLAITAWFSTDAIVINIDEYYNRDEFKREILEVI
FT                   NEQKSILKDNAKLEYKHSFEELSKNIRLKYKNTAIKKLKIKEQF"
FT   gene            complement(267668..268468)
FT                   /locus_tag="Suden_0250"
FT                   /old_locus_tag="Tmden_0250"
FT   CDS_pept        complement(267668..268468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0250"
FT                   /old_locus_tag="Tmden_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43531"
FT                   /db_xref="GOA:Q30U00"
FT                   /db_xref="UniProtKB/TrEMBL:Q30U00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43531.1"
FT                   /translation="MRYNIAMKYNIKLFVAALLTIFLILFIWRASYHYGCYTLLLPIIV
FT                   LFIISHSFVELKMQERFCFRDCYFVEKSFFANLLSSRSFVVIFYIILSLLMTISLIYAV
FT                   IDFKMFFWIYLIFQLLFATFIFKWFKKILSLSIKQSFLSLFSRELSINISSILLLLVYV
FT                   YISLEGYAPEYLRETLKETQVVASNTISSSCYITNYILKVKIEIDSIFWWSFSSFAEHI
FT                   DNTLLKSIAWFGFIFMNGLAILGLNRFILQIVYYLDKLFSRDAT"
FT   gene            complement(268646..269110)
FT                   /locus_tag="Suden_0251"
FT                   /old_locus_tag="Tmden_0251"
FT   CDS_pept        complement(268646..269110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0251"
FT                   /old_locus_tag="Tmden_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43532"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43532.1"
FT                   /translation="MVIDKIENWQKYPFGEAWQRAFTFLNSLTSETKDAKYEIQGDEIY
FT                   AIVMSYETLLREDAMLESHKKYIDIQATLRGVEAYECHSRDSLVVKKPYEAQKDIEFYQ
FT                   TEAKPHSILNISVGDFVMFYPYDAHMPCLSVDDKKELIKKVVIKIKTELL"
FT   gene            complement(269104..269754)
FT                   /locus_tag="Suden_0252"
FT                   /old_locus_tag="Tmden_0252"
FT   CDS_pept        complement(269104..269754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0252"
FT                   /old_locus_tag="Tmden_0252"
FT                   /product="Protein of unknown function DUF178"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43533"
FT                   /db_xref="GOA:Q30TZ8"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43533.1"
FT                   /translation="MVFGKIEYLNLLPFHIFMKRFTRSSQASMSMNYYKDVPAKTNKKF
FT                   LSRKVDAAFISSIRAKNQKHINLGIIAKKEVLSVLVAPNKKNTQDSESETSNLLAKILH
FT                   VEGKVLIGDKALRYYLQNKPHVDLAKMWHEKYKLPFVFALLCYHNDKALYKKIEKNFLK
FT                   TKIKIPRYILREASTRTNISEENILNYLKYISYNFDKKAKKGLEKFYKEAKKW"
FT   gene            269860..270081
FT                   /locus_tag="Suden_0253"
FT                   /old_locus_tag="Tmden_0253"
FT   CDS_pept        269860..270081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0253"
FT                   /old_locus_tag="Tmden_0253"
FT                   /product="Thiamine S"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43534"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43534.1"
FT                   /translation="MVRVEFLGPIQKESLELNITNLNELSEILKKDETMHEWLENSAVA
FT                   VNDTLVSSRDFALKDGDRVALLPPVCGG"
FT   gene            270085..270522
FT                   /locus_tag="Suden_0254"
FT                   /old_locus_tag="Tmden_0254"
FT   CDS_pept        270085..270522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0254"
FT                   /old_locus_tag="Tmden_0254"
FT                   /product="possible molybdopterin converting factor, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43535"
FT                   /db_xref="GOA:Q30TZ6"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43535.1"
FT                   /translation="MLYLYDGALDVPRILKEWYEQEASSNYGAYIPFVGTVRSEDGIDG
FT                   LSFDIYEPILNSWFDAWQKKAKERGAIIKMAHSRGDVMLHESSYIAAVFSPKRRVALEF
FT                   IDEFVEDFKATAPIWKYDLKDAKRIYALNRSTAIKGSGILK"
FT   gene            270519..271730
FT                   /locus_tag="Suden_0255"
FT                   /old_locus_tag="Tmden_0255"
FT   CDS_pept        270519..271730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0255"
FT                   /old_locus_tag="Tmden_0255"
FT                   /product="Molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43536"
FT                   /db_xref="GOA:Q30TZ5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43536.1"
FT                   /translation="MSLLSYETSQTMLSLLHVNSSRSQNVPLSASLGRVLSEDIIAKHN
FT                   DPEFPTASMDGYAVMHSDLELGKIAVVGYNPAGSDEQRTIKSTECIKTFTGSMMPHGAD
FT                   TLIQIENVTLEDGAIIINESVPKGSSVRPIGEGYRAGDVLIQKGTKIGFAEIGVMAALN
FT                   HVMVKVALKPRVAVISTGSEILDLGEHSDNPSQIRSSNNYTLAALFEQAGAEVIQLGTV
FT                   GDDKSLIMQTFQDALLSADIVVSTGGVSVGDYDFVKDIVPRIGAEVLFKGVAIKPGKHI
FT                   LVAQKEDKFILSLPGFAYSSTVTAILYVLPLIAKMLGKESAYRMVAAKLSEEFKKRSRL
FT                   TEFTACNVVVEDGEYFINFKDKKVGSSAILTNMLNECALMISGEDDGDLQEGTFVNVIL
FT                   IQNF"
FT   gene            271797..272261
FT                   /locus_tag="Suden_0256"
FT                   /old_locus_tag="Tmden_0256"
FT   CDS_pept        271797..272261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0256"
FT                   /old_locus_tag="Tmden_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43537"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43537.1"
FT                   /translation="MKKLFLILVVLLGLARADSDVKKAVFDLTTPDIARFETRLIKGVA
FT                   FNNAHYQTNFKELDIVVIIHGDAYKFFVKDLSKTECKKDKELEPKAKDIHQRLSSLVKT
FT                   YNVKFLMCGAGMKARNISKENVLEFVEVTPSAIVGLIDAQNDGYAYIPIN"
FT   gene            272280..273374
FT                   /locus_tag="Suden_0257"
FT                   /old_locus_tag="Tmden_0257"
FT   CDS_pept        272280..273374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0257"
FT                   /old_locus_tag="Tmden_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43538"
FT                   /db_xref="GOA:Q30TZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43538.1"
FT                   /translation="MLKKTLPIFLFVVALIIYILLSLRYAIDKQNVSYILDKFVLALES
FT                   EIKNKKMDELKMAIMLSRNSALVDALENEDEHLGYKILSGITKEIKNFTQIDIKVQILT
FT                   PDYHIFARSWDDIYTGMPLEDYRSDLQYFSTHKTPRSSIETGRLLSIKTTVPIYRGETL
FT                   LGFVEIISFFDSITDFFKKIGVDFYVLMDDKYYDIAVFMQNNETVDRYIVANRNYNHNN
FT                   LALLRRVDFKELKINRSITLDDSYLFYENMKNGDSESIGMFVFVLNKKYLEYFKEQNDE
FT                   TSFFINITKKALYDVVKHEQADATIKEFTDIKSLLYMKDGVPLDMQSDYIELGYEKLNH
FT                   YTKDELIQLILGQKIIKKVDGKIK"
FT   gene            273371..274024
FT                   /locus_tag="Suden_0258"
FT                   /old_locus_tag="Tmden_0258"
FT   CDS_pept        273371..274024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0258"
FT                   /old_locus_tag="Tmden_0258"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43539"
FT                   /db_xref="GOA:Q30TZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43539.1"
FT                   /translation="MRVLLLEDEFSLRISIKEFLEDIDYSVDDFADGLEAHDAIYAKSY
FT                   DLLLLDINVPSMSGFELLQSIRKDGIKIPAIFLTSMTELQGLKEGYRKGCCDYIRKPFD
FT                   LLELELRIKQAIRSYYLDNSDMVELGEGFVYDMLKGKLTKDDKEIVLRKIEKDLLEMLI
FT                   KNKNSVVSMQMFQDEVWGDYVEPSAIRVQINNLKQKLSETIIHNRRGLGYIIER"
FT   gene            274014..275183
FT                   /locus_tag="Suden_0259"
FT                   /old_locus_tag="Tmden_0259"
FT   CDS_pept        274014..275183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0259"
FT                   /old_locus_tag="Tmden_0259"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43540"
FT                   /db_xref="GOA:Q30TZ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43540.1"
FT                   /translation="MRDKSYALTYAYIYTILVAIILLTPLFIYTSYIKKIQDIKNEYEL
FT                   KNRAHLIVKLMQEHNSEKDYFEYPRFKTFKSGLYDSRLQEIFSLIQEPIKHFREGYHID
FT                   GSRAYYVMVLPEERYFGAKYIVVENQLSYYEVYEKALLILLSIVTCIFLLSILFLDRFA
FT                   KPFKEVNKKLDEFIKDSIHEINTPLAIINVNVDLYGRKYGKNKYMQRIKASTKVLSNIY
FT                   NDMEYLTKNNKLEIKREKIDIKKFLDERIEYFSEIALMKNISILSDMKNEVFINMDVKQ
FT                   LQRIVDNNISNAIKYSYEQNIIEVNTDINEEGEYLLSFRDYGIGIDNVERIFERYYRES
FT                   RQVGGFGIGLNIVGAIIKKENIDVSVESELKKGTTFTYKFPKNLISIKN"
FT   gene            275274..275798
FT                   /locus_tag="Suden_0260"
FT                   /old_locus_tag="Tmden_0260"
FT   CDS_pept        275274..275798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0260"
FT                   /old_locus_tag="Tmden_0260"
FT                   /product="Monoheme cytochrome SoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43541"
FT                   /db_xref="GOA:Q30TZ0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43541.1"
FT                   /translation="MKRSLTLSLLLGMSVFAADYSSVIEVPDAQKIIQKDLLPPLGVNK
FT                   MPTECITTDSKAIARGAYIFHNLNGENAKGNAPEGLSKTVENGKPKQYGNCVACHNIEG
FT                   AVGGGNIGPDLTNYTEMFVKTGVRDAQYVYAKIADPRVDNPHTDMTVNLTTKLFNEKEI
FT                   CELASYVLSKK"
FT   gene            275815..276282
FT                   /locus_tag="Suden_0261"
FT                   /old_locus_tag="Tmden_0261"
FT   CDS_pept        275815..276282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0261"
FT                   /old_locus_tag="Tmden_0261"
FT                   /product="thiosulfate-binding protein SoxY"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43542"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43542.1"
FT                   /translation="MKRRDFLKNLSLSAATVAVIPTMSFAADDKPKASNALAYKDALAA
FT                   ITGGKTPEPSEKVSLKVPEIAENGAVVPVTVEIDYPMTDSDYVKAIHIFAAKNGNSRCI
FT                   DAHLSPANGKAMLSTRVKLGETQEVIALAELSNGNFLIASQSVKVTIGGCG"
FT   gene            276335..276670
FT                   /locus_tag="Suden_0262"
FT                   /old_locus_tag="Tmden_0262"
FT   CDS_pept        276335..276670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0262"
FT                   /old_locus_tag="Tmden_0262"
FT                   /product="sulfur compound chelating protein SoxZ"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43543"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43543.1"
FT                   /translation="MSKSKTLIKIKPNTYKNGDVVKVSFMVMHPMETGLRKDKKTGEVI
FT                   PADYIKSAKFEYNGKVFTTMNIWETLSVNPVITTYMTIDGAGSLKVTFTDSKGTVEESS
FT                   EEIKPKG"
FT   gene            276674..277444
FT                   /locus_tag="Suden_0263"
FT                   /old_locus_tag="Tmden_0263"
FT   CDS_pept        276674..277444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0263"
FT                   /old_locus_tag="Tmden_0263"
FT                   /product="diheme cytochrome SoxA (sulfur oxidation)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43544"
FT                   /db_xref="GOA:Q30TY7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43544.1"
FT                   /translation="MRKVLQIALSVLVASSLAYGSEQFSMSDADRALYEELLDNNPADM
FT                   MLASGSEHLDALGGAASLAKYLEQSEDSLASYLAGFPRYIDKYKSVVSIDQMLQAFMHD
FT                   SGAKAYTLKSEEMFNMSSYVKSLGNEQAINIDINANKYMQEAYALGKEVFNTRRGGRGL
FT                   SCYNCHNSNVIGAVLRTQPLPDISAKGNASAATWPAYRMTKSKLATLQKRFQGCMENAL
FT                   LAVIPLGSKEMTALEVYFTHEAKGAPIAIPGLKR"
FT   gene            277455..279218
FT                   /locus_tag="Suden_0264"
FT                   /old_locus_tag="Tmden_0264"
FT   CDS_pept        277455..279218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0264"
FT                   /old_locus_tag="Tmden_0264"
FT                   /product="sulfate thiol esterase SoxB"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43545"
FT                   /db_xref="GOA:Q30TY6"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43545.1"
FT                   /translation="MEVSRRDFMHICAIFGIGMATISSAAPRGAAQISLKDIFSFKDTG
FT                   NFTLLHMCDLHAHLKPLFWREPSTLISAPNLVGTPGFLCGDAFAKHYGLEPSSLDAYFD
FT                   THIDFESLAKKFGKMGGVAHIKTVLDHVRKTRGADNVLFLDSGDTWQGTGVALKSNGEA
FT                   IVKAQNYLGVDVMVGHWEFTYGKKRVKELIGMLDAKFISQNIIGDDSFSDEFEELIFEP
FT                   YTIEERGGAKIGIIGQSFPFTSTANPKEFTQGWSFGLRLESLQEYVNELKDEHKVDCVV
FT                   LLSHDGFSVDQEVARKVQGIDFILSGHTHDPSPMPIVIDGTVIVIAGSHGKYIGRLDID
FT                   AKNGKVNNYEYKLIPIASNIIPADPAGVKLVDELYAPYAAEMSEVLGKTKNILYKRDTF
FT                   FSTFDQLINDAILDEMKCDISFTPGYRWGTTVLAGENILMDNVYEMCGITYPNVYTFEL
FT                   EGNKIAKLLEDIADNVFNENPLYQQGGDMSRLGGATYDITVGNPNGKRITNLKIGGKNI
FT                   DLKKIYIVSSWGGNLQNAGSNLQKAKTRAVYDVVRDYIKRKKVVDVSNKGNVKLVDFDC
FT                   GCPTKGSRSCD"
FT   gene            279249..280730
FT                   /locus_tag="Suden_0265"
FT                   /old_locus_tag="Tmden_0265"
FT   CDS_pept        279249..280730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0265"
FT                   /old_locus_tag="Tmden_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43546"
FT                   /db_xref="GOA:Q30TY5"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43546.1"
FT                   /translation="MKLLKISAVTALVCLMTTALSAEEVKPKRTLQGNMNEVYNTLPKS
FT                   ANNLSEAFTEGMFYGRLRTNAFRWDFRNDDNGDNKAFGLGGSLIYKTAPLAGLSATAGL
FT                   YYSNSPISNWRQNDSDVGEVKSGKDTFSRYDVRADGDWEMVVLAQAYLQYNISKTDFKL
FT                   GRQIFESALTASNDTKMIPNTFEGISVESKDLPKTTLKAAYFTAQKLRDHTTFHDVLTF
FT                   KDSSGDSWNNNDDSGIHQGLTYARLQAANKDTSNELIVAAISNKSIENLKVDATYTAVP
FT                   DMLSSVIGELNYDIPLGGVTITPGVRYMEQFDNGAGAIGGASLAGNVTDANAASRGYKS
FT                   GNSLDTSLWMARLVASAGAFKGHIGYSKVEDKADIVAPWRGFPTGGYTRAMAQVNWKAD
FT                   AETIMVEGKYDFGKAKILDGFSAMGRYAIQNSDEKKQASGGQADLSIIHIDLVQKLTPT
FT                   LDAKIRLAFIDADERTSGVNKDSYNEYRFEINYLF"
FT   gene            280816..281193
FT                   /locus_tag="Suden_0266"
FT                   /old_locus_tag="Tmden_0266"
FT   CDS_pept        280816..281193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0266"
FT                   /old_locus_tag="Tmden_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43547"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43547.1"
FT                   /translation="MKKVIVSLVFCVSLLFSAEFYTYEEALEIQKTSSKIIMIDVVRDN
FT                   CRYCILMDKLLEDREFSSWIAERFIPVKINIEHDKIDLKLDVKMTPTFYFLDKNQKILK
FT                   MIPGSWSKEDFKDLTKNIKGE"
FT   gene            281195..281629
FT                   /locus_tag="Suden_0267"
FT                   /old_locus_tag="Tmden_0267"
FT   CDS_pept        281195..281629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0267"
FT                   /old_locus_tag="Tmden_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43548"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43548.1"
FT                   /translation="MKLYALVFLMFSLLLHADTVFAQPEPSITEPRQIIFSIKSANDEE
FT                   INHVLSSANNVLKFYGPENVQMRIVAYYHGIKALLKTNKDIALRVKALMLLDVEFYACG
FT                   NTMRTKNIKKEELLEDTLIVTAGIVEITERVKEGWIYIVP"
FT   gene            281651..282556
FT                   /locus_tag="Suden_0268"
FT                   /old_locus_tag="Tmden_0268"
FT   CDS_pept        281651..282556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0268"
FT                   /old_locus_tag="Tmden_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43549"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43549.1"
FT                   /translation="MKKIYVFIVAILMASIVSASGDLHLFEVENKNGAITPQKIEEAFV
FT                   KDGFGIAVNSDMIKPFMIQFKETKFKIFTLMTIYHEQTSFDLVKKYPVAGVFTPLGVGI
FT                   YQDKAENTLHVSILTSASLSKIMGIEDELIKKLESQVLATLKKVLPTAKYKLSQEPLSE
FT                   SRELLTRYELEVDGDDVKTAKENVLLGLDNGLSLYGFIVAGKLDLNKHMKDSPYDFYDG
FT                   YSICKLPVIYTVALTKPEAAAFAPCTLAIYKKKDENKIVLEYPSVYNWISSALIKDKDG
FT                   VDVLLKAQEQFQAILLEIVE"
FT   gene            282619..284610
FT                   /locus_tag="Suden_0269"
FT                   /old_locus_tag="Tmden_0269"
FT   CDS_pept        282619..284610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0269"
FT                   /old_locus_tag="Tmden_0269"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43550"
FT                   /db_xref="GOA:Q30TY1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43550.1"
FT                   /translation="MTIGKRVTILVIGISFALLVSSFFVLNYFKAAIVQNVYSDMRSTL
FT                   TAKIEDRMNAKFDIGVTNAVAMANNSDIIASLKNNDRALAAKTLESIGDTYKEQTDFKN
FT                   IKIHIHDKDVKSFLRNWQVDKFGDDLSSFRHTINKVKESKKSMAAIEVGRNGLTIRGLV
FT                   PVIADNSYLGSLEFMQGFESVVKQFLKEKEYLLVLMDNKLLNVADLSNTKNRISNYTLS
FT                   QKTIDDKFLLEAKTIDMEAVLRDGYFVDKNYFYTYTYIKDFENKPIGIYLLAKDRPSIE
FT                   KAIDGASSIINSALLLVASLIFIITIAILVTIKKIVLNPLNVFQEGLLEFFKYLNKQSN
FT                   KAELIAIDTNDEIGKMAKIVNENILKTKENIELDQDLINDVKRVVMEVERGNLNQEVTK
FT                   STQNQALFELKDSLNKMLYSLKNSVAKDINSLVAVLDSFKNSDFRATLENDEAKVSQAI
FT                   NSIGQTIRDMLRDSNTNADELTRTSVSLIERMQTLAEGSYKQASMLKDISKTMELANSS
FT                   VVEVSQMTKAVVIKSTDIKSVVNVISEIADQTNLLALNAAIEAARAGEHGRGFAVVADE
FT                   VRKLAENTQRSLDDININIESLTQAVVDIGTTIEEQVKDINMATDSIKVIDKTTQEHAI
FT                   HTKEIENIAIKLDEMSKKTLQSISTKKF"
FT   gene            complement(284681..287800)
FT                   /locus_tag="Suden_0270"
FT                   /old_locus_tag="Tmden_0270"
FT   CDS_pept        complement(284681..287800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0270"
FT                   /old_locus_tag="Tmden_0270"
FT                   /product="Resistance-Nodulation-Cell Division Superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43551"
FT                   /db_xref="GOA:Q30TY0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43551.1"
FT                   /translation="MFERVLKFFIENYKINYTLFFLLFAAGIYAYSQIPKEISPSIEPN
FT                   SVTIHGSYAGASVDILNKMAVQEIEDEVKNIVGVDSVTSVVSPGRFTIVLEFDKRVDKA
FT                   TIIRDAEDAIALIKPNLPSDMDDPVIRGVAHSRSIMHVSIISSKISRDKLKLLSKKLKS
FT                   NLLSVKDISDVTIFGDSDLFYEVLIDEKKVNAYNLSLDEILRVFSELSYIFPLGKIDNV
FT                   KEQYYISTQNDKKLSCELENTIININDQQIVLKDIAKIEKKYEDSSTLASMNGEDSITL
FT                   AISQNPKGDAIRIADDVKKLISEMSVDDVDFNIRMDNSIVIRDRLNIVISNILFGLILI
FT                   TLLTAVLINIRIALIIALGIPTSFVMGAIYFYFTAYSINVNSLIGVLIAIGILVDDAIV
FT                   VSENIQQYIEKGYSAKEAALLGTQEVAKAVTIASLTTLFSFIPLLMLSGKLGEIIQLIP
FT                   IAFSALVIASLIESFIFLPIHAAHTLSSNSKTMSWEKINLLYLRALKKLVGYQKSFLLI
FT                   FLIIVPALIYYGVKHSKFQMFQPFDTSSINITFKAKPTTTLEQSLEIVQTLEKNILKEK
FT                   DRFFVKHVSSTAGYRRSATGTTEIYPYVGYISIELHNMKPENFVDKYITPYLSFYYDSK
FT                   DRIRDKSSQDISKDIREWLKEQDYQERFNLNNLMVVENSMGQTKADIRIGVISDDYKKA
FT                   LSAIREIEDGFSKIDGIKYFGDDVKVGTQEIKLKLNSYAEELGITEKYLGTYISGLFLS
FT                   RKVGTIFDGKELLDIKVKSFYIKDDLESFAELEIPIKNRGHVKLKDICEFEKVESLENL
FT                   VKDDGETNFYVFANVDPSIITATEVLQMMNPLIDKLKNTQDIRLKFKGEKEQKETMQTE
FT                   MILASILAIILIFISILYLFNSLRETLIVMSVIPFSILGVYIGHFIMGLNISLPSLIGA
FT                   LGLAGVIVNDGILMMATIKRAKTKEEIFILAPKRFRPIILTSVTTIVGLCSLIFFATAE
FT                   AVTFQPLAVAMGFGLLWGTILNLFYLPVTYNFLHGYKNYNKRSKIFKTFE"
FT   gene            complement(287901..288602)
FT                   /locus_tag="Suden_0271"
FT                   /old_locus_tag="Tmden_0271"
FT   CDS_pept        complement(287901..288602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0271"
FT                   /old_locus_tag="Tmden_0271"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43552"
FT                   /db_xref="GOA:Q30TX9"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43552.1"
FT                   /translation="MNRYVSSFIISAISYTLVGASLIYLFIIKEDTHEKCKIENIQKVN
FT                   ICVIAQPKEIQEETPQKQKIEKPQEPKPLPKPIEKKPLQKPIKREAVVQKEPITEPLKT
FT                   ESIPEVTNEQPQPQVEKENKKATSNIEKVVENDTKERDREIFINNLIKRINDNKSYPIA
FT                   ARRRAIQDSVEVEFMILIDGNVDYIKVISGHNIFEKSATQAIENSFPMEIDKTLFDFPK
FT                   KFKIKIAYILK"
FT   gene            complement(288604..289410)
FT                   /locus_tag="Suden_0272"
FT                   /old_locus_tag="Tmden_0272"
FT   CDS_pept        complement(288604..289410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0272"
FT                   /old_locus_tag="Tmden_0272"
FT                   /product="CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43553"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43553.1"
FT                   /translation="MNYFAGIDIGSTAIKIAIVDENRKLVGHKISASGSMFYKYAKQAL
FT                   KEMLDELNIDEKNLVYRVATGYGRKLFKEADENISEITANAMGAMAAADGKCNIKTIIN
FT                   IGGQDSKAISLDDEGNVVNFAMNDRCAAGTGKFLDVVAMNLEIEVDELGEYHFKSQGTP
FT                   LAINSTCAVFAESEIIGLLGNDHSVEDIVAGVHYSIAKRIIKLLKRVGINEGIYFDGGP
FT                   ALNSGLVNAIENELGKKIFIPEFPQITTSYGAAILALESYEFENKI"
FT   gene            complement(289407..290675)
FT                   /locus_tag="Suden_0273"
FT                   /old_locus_tag="Tmden_0273"
FT   CDS_pept        complement(289407..290675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0273"
FT                   /old_locus_tag="Tmden_0273"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase, D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43554"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43554.1"
FT                   /translation="MTEHKIETPKERLNRHKAMEASAVLEKIKHDYKEPPRAMEYFYDL
FT                   YERVHCKHESLHSDKAKVGTMCIQVPSEIIYALDAVPLRLCNGFYTDDEIGSDFLPSKS
FT                   CPLVKATVGQFVSNNFSDKPDVIISPTTCDQKAKSGAIIESMGFSVYDMEFPRTKESHE
FT                   SREYWRRSVRKFTKDLSENLNTKLSKKKLKESIQKIGYAQHLYHKLNILRKNTASPILG
FT                   KDMFLVTNAFFFDKIDSWIDAMKKLLEECEEMVEAKVNAASKMSPRIVYTGSPPIFPNL
FT                   KIPLLIELCDAIIVADETCSSNRMFNDMVSVDEWFINDMIDSIADRYLKGCTCPIFTKN
FT                   DDRKRRILDLVKDYKADGVVYQAFAGCQVYEMEQRSVLEAMQKAGVPILYIESDYSPSQ
FT                   SGQLTTRIEAFVESLKNRKRRQQ"
FT   gene            complement(290668..291648)
FT                   /locus_tag="Suden_0274"
FT                   /old_locus_tag="Tmden_0274"
FT   CDS_pept        complement(290668..291648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0274"
FT                   /old_locus_tag="Tmden_0274"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43555"
FT                   /db_xref="GOA:Q30TX6"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43555.1"
FT                   /translation="MKKIKDFINKADIRRFRFWLQLFFFVLFIYGGYFAINLGNSIPVF
FT                   SCGYDKEVGGMCYFLPLQHQLARPLDVLFSVASISVLIGFVTFLLWFIVFNKAWCGYAC
FT                   PLGTMQDWLTGLRKKMGIRFSTYTQPQFDKLKKIKYLMLALVIFAPIGVGMGILGGEWR
FT                   TAFCEICPGRMITPLFVGDVSQWSLDFSTKTAMILTSLGLIFTGLFVVGSFIKKRFFCF
FT                   FCPMSAMHYIFSDAALLKLKKDGDKCTKCGDCYNVCDMQIKDIADDVKSTNILRDDCIF
FT                   CMKCVAACPEDDALHVDILNMKLFTSTKGGFAKRMEMDRLEKKND"
FT   gene            complement(291635..294391)
FT                   /locus_tag="Suden_0275"
FT                   /old_locus_tag="Tmden_0275"
FT   CDS_pept        complement(291635..294391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0275"
FT                   /old_locus_tag="Tmden_0275"
FT                   /product="Polyferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43556"
FT                   /db_xref="GOA:Q30TX5"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43556.1"
FT                   /translation="MVNFIKRDKNDIYAKPILGFLFKNQKFLLSLKIAVSLLFVYALYF
FT                   GFAHTLKDNTFTTAVFWGIFWSLFMVVSLPTFGRIFCGICPHGFMGKYITKYGLKKTMP
FT                   KWMQNRYIGVLLLVFGWWGVYYMFPNLFRTAQGTAILFTVMTIIAFVIYFIYKDMSYCK
FT                   YICPVGTLTRAYSKLSFTWLGTYKSACNDCRTFECATACPYNLKPFTFDSRNSMTDCTL
FT                   CMDCSSACEAVSFKVKKPSFSLFSKFQVLNAEVWAFILILASISITMSFHHGIGRSNAA
FT                   GDMIWAKTAEYLKNYIDFGSIDTIGLFAFVYALIFTILAAVIGMFIASKILKKDFNTVF
FT                   YDLGYSYAPLFILGSIAHSLETFFLKGYEHIVEGFAYGFGFSLDVAPLANRGDGWLHMF
FT                   GLLKWVAIVWALIILYKRVKLLDASRVRKIVAFPFAASLIIFFLGINMYTGYIFKTYGK
FT                   ATSTHESHGGGGKLFQSVSTDKAILLQTAKEKNSCATCNMSLTNSYKVNHAAKANNEIK
FT                   QFCSMHCLAQECSINKRELKDFQAVDAKSLKFINAKEAYYVLGSKIKGIMSKSSKFAFS
FT                   DKTDAINFVKANGGEIVSFEDAYKNALEDFEEKSSTNSNIATPKDTIYISDTNPFAGKK
FT                   HGNEHNHGGGRSRIPTKEIWPVFEDTSGNKSCLGVIDAELYLLDADLNKTKISASKKEG
FT                   CSSVSFAMPNNGYYNLFYIDKKIHEGTLHVKTAKYEIMRFNHSNDAIYDKEKMSAHSIK
FT                   ETPFDILRLREDDETFYHNLYSGENIRVQVLLDGEAIEGADVTLSTKTLWSKTLKTDKD
FT                   GVATFTLIEDYFPTWNEFNKRYKNEFLLTASYMRDTQGDINGTKYEKVRYSATYPSFYY
FT                   PNSSQYSSYAYGLSATMLTIILSGFAIYLYRARREKPFKEVRFDEEN"
FT   gene            complement(294404..295000)
FT                   /locus_tag="Suden_0276"
FT                   /old_locus_tag="Tmden_0276"
FT   CDS_pept        complement(294404..295000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0276"
FT                   /old_locus_tag="Tmden_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43557"
FT                   /db_xref="GOA:Q30TX4"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43557.1"
FT                   /translation="MFSCMPFLSPLLVSNSNSTKEALGIILPFSLGRIFSYTFIAIIAY
FT                   LSSAWIKEILNDNSLFGLILGISTMGMGAYLLYKSFKPSYLCGHTTSLIKKPKLNKFGF
FT                   FTIGATMSINPCAPIMALLAVAANSSNIYNTIGLGLFFGLGAVMFSILFYGFIVSKVIK
FT                   GFMAQFSFYKLFIERAAALLLIIVGILVLNGILIL"
FT   gene            complement(295078..295461)
FT                   /locus_tag="Suden_0277"
FT                   /old_locus_tag="Tmden_0277"
FT   CDS_pept        complement(295078..295461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0277"
FT                   /old_locus_tag="Tmden_0277"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43558"
FT                   /db_xref="GOA:Q30TX3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43558.1"
FT                   /translation="MQIKKFDSINVVPFIDIMLVLLVIVLTTATFVAKGLIPVDLPNSK
FT                   STIKEDNKKNLTITIKQNGDILFDKTAVLVQNVEAELSKYETTMPIYINCDKDVKFDFF
FT                   VVILDALKEKNFTNLGIITKKEQ"
FT   gene            complement(295442..295894)
FT                   /locus_tag="Suden_0278"
FT                   /old_locus_tag="Tmden_0278"
FT   CDS_pept        complement(295442..295894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0278"
FT                   /old_locus_tag="Tmden_0278"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43559"
FT                   /db_xref="GOA:Q30TX2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014172"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43559.1"
FT                   /translation="MNIELLKNIVDYGIIGLLGVMSFIAFWFWIERILFYKGIDVRNFK
FT                   TKEELEIALTNNINIISTFGSNAPYIGLLGTVFGIIITFYAMGQSDNLDAKIIMTSLAL
FT                   ALKATAMGLLVAIPATVFYNHLARRIEVVLALWDINEKEKYANQKV"
FT   gene            complement(295915..298107)
FT                   /locus_tag="Suden_0279"
FT                   /old_locus_tag="Tmden_0279"
FT   CDS_pept        complement(295915..298107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0279"
FT                   /old_locus_tag="Tmden_0279"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43560"
FT                   /db_xref="GOA:Q30TX1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43560.1"
FT                   /translation="MNKKIYFSIVCALAINVAASDLGTIKVESSTIDSKFDTKKTEVSN
FT                   TATISGESVDMAHTENIQQILQSIPGVTTEVKSGDTVKIHLRGVENQMYMGEKPGVAIV
FT                   IDGVPVFERTGSVNIDLDNIESIKVIKGGASYLFGDDALSGAVIITTKRGAKYNNNFGA
FT                   VEFGSFGYQKLLARSGYASDNLSFHLQASQKESDGYWQDSASVAKYLNGKLQYYIDDTS
FT                   DVTFGFEYSDREKDTHGTVGGESAARTNPKSIYDGDQDSRDYTRNYDVTLLKLFLTYSK
FT                   DFDSNSNLLLNGYVYTDDTLYLSSPQTQDSSGISNPSLDDKDYTYNNDYAQIQRGIKSE
FT                   YRTSSNQFAALLGLDLRANTYENKSTYRVNQALVSYPRGIRTVIPNYYLAGDKKSDDTT
FT                   DENVYAIYGEYKHQLSQNLSATANLRYDLIKLDYEDYRSNSYKEDFKIYSYRIGSNYRV
FT                   SDNFDIFANFSTGFRAPTVAQLYAGSTSSWGYTQNNPDLKPEKSYNYEIGVRTSFNKIN
FT                   YEAAIFQIDREDFIMKTSGNYGSTNNTNNDMWDNVGGAKHRGLELSAEGKATEKLLFNL
FT                   AYTYLDAYYTKYDNFGIDLDGSAYLSNLTFFNVTGNQIPRTSKHQVNLILDYLPMKNLK
FT                   LSTEINAKSAYYADDLNQIKIPGQATLNLLANYNNKIGDYEYSLFARIDNVLDKSYYNT
FT                   ARSSGDRNEDGVFNAEDLSITVNQGRVYTAGLSVKF"
FT   gene            complement(298260..298826)
FT                   /locus_tag="Suden_0280"
FT                   /old_locus_tag="Tmden_0280"
FT   CDS_pept        complement(298260..298826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0280"
FT                   /old_locus_tag="Tmden_0280"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43561"
FT                   /db_xref="GOA:Q30TX0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43561.1"
FT                   /translation="MTLNLCGIDEAGRGPIAGDLVVAGCILNSHVDGLNDSKKLNEKKR
FT                   EALYEIIIKNSSYHIVKFSAKEIDDNGISICMKKALLEIMKNLTCKEYLFDGNTNFGIN
FT                   NLPTMIKADGKIPEVSAASILAKVTHDRNIINDAKKYPQYQFQKHKGYGTALHVEMIKK
FT                   YGYCEIHRKSYKLKALNTLVTPTLF"
FT   gene            complement(298816..300396)
FT                   /locus_tag="Suden_0281"
FT                   /old_locus_tag="Tmden_0281"
FT   CDS_pept        complement(298816..300396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0281"
FT                   /old_locus_tag="Tmden_0281"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43562"
FT                   /db_xref="GOA:Q30TW9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43562.1"
FT                   /translation="MVSNDISILFVEDDKEVRAQISDFLTSNMFKDVYVANNGKDGLLK
FT                   YNIHKPDIVLSDLNMPIMDGLEMSRAIKALDENTPILLITSNFEKNVTEAAVDIGIEGC
FT                   LFKPLSLNRVEKILTKYIEKIMFQREFKNKQKLLEQYKSIIDISSSVTKTDINGIITYV
FT                   NNPFCDMSGYSKDELLGKNHTIISHPDNSKEFYEEIYSTLRDKKIWRGHIKNRRKNGDS
FT                   YYESSVIAPILDENDEIVECISLKQDITELYAKKELLKKRVKEEIEKNIQLKQEREKER
FT                   LLEERFSIIGKMAAGITHEINTPLTYIKGNLELMMHDIKDLDDEIKQKNYLQEDSKVIL
FT                   EGVNRISSIVESMREMASQAKGMAQESNVYSSLITALILSYTKASYISVQNSPFKISMD
FT                   KNRYSFIAPIQKQRIEQVFIIIINNALDALKLNQPFDARELNISLRDDDEYVVVSFKDN
FT                   GGGIDEGIMPHIFNPFQSTKVEGGIGIGLNVAKRIMQDHGGEILARNYEKGAIFEVYIP
FT                   KRSKLQDDS"
FT   gene            complement(300396..300761)
FT                   /locus_tag="Suden_0282"
FT                   /old_locus_tag="Tmden_0282"
FT   CDS_pept        complement(300396..300761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0282"
FT                   /old_locus_tag="Tmden_0282"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43563"
FT                   /db_xref="GOA:Q30TW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43563.1"
FT                   /translation="MKNIVIIDDESDILNMLERHLSRDSEYKVKTFSNPINAIASLPKD
FT                   TDLILLDIMMPQMNGLDALPKLLEVNPKTKVLMMIAYSTLDKVLNAHRYGATDYVMKPF
FT                   ASLDVLSKKIKEVLRKN"
FT   gene            complement(300758..302086)
FT                   /locus_tag="Suden_0283"
FT                   /old_locus_tag="Tmden_0283"
FT   CDS_pept        complement(300758..302086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0283"
FT                   /old_locus_tag="Tmden_0283"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43564"
FT                   /db_xref="GOA:Q30TW7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43564.1"
FT                   /translation="MFFSKNSDKNRTKELEDEISSLKESLAFYKEIAKFSQEEMLIVFA
FT                   ADGSTLFQNEKALSQIKDSSALYKELQKSSSTISLNDCSGKVVSKKTDDNSAYMYRITK
FT                   TDMRDTRESDILTLHQKAITAALTDTQKTFSQMLEELKVMKSESVEVANDSKDGLFLIQ
FT                   QSAQAMDKLSQNTQLNITGMDSLNQRSGEISTVITLIQDIADQTNLLALNAAIEAARAG
FT                   EHGRGFAVVADEVRKLAEKTQSATKDISLVVKAMQQETNEAQTNTNEVNNIVIDTKVKI
FT                   EDVSLKIKSFEENASRSQYEVEHISDKIFASLAKIDHVIYKHNVYALIFGEENNFKSTS
FT                   HTECRLGKWYSSGIGKDNFSKMPSYAKLETPHAIVHEQANLLASECGEDKVVCSKEIIE
FT                   KRIHAIERASDDVFKYLDALVEEKAKEMMHLAAKTLFKTGEKK"
FT   gene            complement(302170..303234)
FT                   /locus_tag="Suden_0284"
FT                   /old_locus_tag="Tmden_0284"
FT   CDS_pept        complement(302170..303234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0284"
FT                   /old_locus_tag="Tmden_0284"
FT                   /product="conserved hypothetical protein-uncharacterized
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43565"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43565.1"
FT                   /translation="MEILLEELYKIDINLEKFHTRKLFLDKDSYQINGITQSGKTKLVK
FT                   NYLLGLKKSSYLYIDCKDLRIDKDRLNKTLGNFCTNNKISTLVLDNYTPSVNIVNVAQL
FT                   IICCEVHYELDFLTTLKLYPLDYEEFLTYEYKYDSTALNHFFKLGGFPSMHKVSSDERA
FT                   LYLQKILKNNLTSTELEILIFCTKMMAQKISPYSIYERLKQTQKISKNSLYMAFELLSS
FT                   KGYIHQLQKVAHPKAIRKIYLCDISLKSALTIEKQFSKLFENMIYLELLKSNRDAFYDE
FT                   NIDFYLPSCDEVILGMPFADERILFKKMEAIEAFLFTYQIKKVTAITMSTEGRMSHPLS
FT                   RVEMIPFDIWAISD"
FT   gene            303390..303701
FT                   /locus_tag="Suden_0285"
FT                   /old_locus_tag="Tmden_0285"
FT   CDS_pept        303390..303701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0285"
FT                   /old_locus_tag="Tmden_0285"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43566"
FT                   /db_xref="GOA:Q30TW5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43566.1"
FT                   /translation="MEKIRLKLKAYDHRVLDRSVASIVEAVKRTGAVIRGPIPLPTKIR
FT                   KYTVIKSPHVNKSSREQFEIRMHARVIDIVSATPETVDSLMKLDLAPEVDVEVRSMDK"
FT   gene            303711..304286
FT                   /locus_tag="Suden_0286"
FT                   /old_locus_tag="Tmden_0286"
FT   CDS_pept        303711..304286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0286"
FT                   /old_locus_tag="Tmden_0286"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43567"
FT                   /db_xref="GOA:Q30TW4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43567.1"
FT                   /translation="MEYIVEKIGMSRTITVPSKPVTLLRVLDAKVCEVNENSAIVAYKS
FT                   GKKMNKAIEGQQKKYSISSEFNRFVTLEVANSEAGDIDLTPLAEAKVIKATFTTKGRGF
FT                   TGAMKRWNFSGGPAEHGHRFGRRTGSIGNAEWPGRVMKGKKMPGQYGNTQNSVKNEIIS
FT                   FDAENKIIAVVGSVSGANGSLGRVKVAK"
FT   gene            304286..304900
FT                   /locus_tag="Suden_0287"
FT                   /old_locus_tag="Tmden_0287"
FT   CDS_pept        304286..304900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0287"
FT                   /old_locus_tag="Tmden_0287"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43568"
FT                   /db_xref="GOA:Q30TW3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43568.1"
FT                   /translation="MSAIVLNEKMEKASELALPESFSGINPHNLYLYVKSAQAAMRANS
FT                   ASALTRAEVRGGGKKPWAQKGGGRARAGSRRSPVFVGGGKAFGPKNNRNYDLKVNKKQK
FT                   KLALNFALNEHAQKGSLFIVDSIEIASGKTKDAATLFKALNQRDTLFVKTVLDEKTYLA
FT                   FENIASTYVIEENELNAYLAANYRSLVIEKAVWENLVGEAK"
FT   gene            304901..305182
FT                   /locus_tag="Suden_0288"
FT                   /old_locus_tag="Tmden_0288"
FT   CDS_pept        304901..305182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0288"
FT                   /old_locus_tag="Tmden_0288"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43569"
FT                   /db_xref="GOA:Q30TW2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43569.1"
FT                   /translation="MADITDIKSILYTEKTLGMQEDGIIVVQTSPRMSKTGLKEVFREY
FT                   FGIIPTRINSLNQSGKIKKFRGMTGKQNDFKKFYVKLPEGAQIESLAV"
FT   gene            305184..306023
FT                   /locus_tag="Suden_0289"
FT                   /old_locus_tag="Tmden_0289"
FT   CDS_pept        305184..306023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0289"
FT                   /old_locus_tag="Tmden_0289"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43570"
FT                   /db_xref="GOA:Q30TW1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43570.1"
FT                   /translation="MAIKSYKPTTPSRRFYTNVENNDITSKPSVRSLLVKLPASAGRNN
FT                   NGRITSRHREAGAKKLYRIIDFKRDKFGIAGTVSTVEYDPYRNCRIALITYVDGEKRYI
FT                   LLPKGLNVGDAIIADATGVDIKPGNAMKLMNIPVGTSVHNIELKVGKGGQMVRSAGTSA
FT                   QIMGRDGKYVSLRMPSSEMRLVLGECMATVGAVGNEEYINIVLGKAGRTRHMGIRPQTR
FT                   GSAMNPIDHPHGGGEGKTNSGRHPVTPWGKPTKGSKTRRKKASDKLIITRRKSNPKR"
FT   gene            306028..306303
FT                   /locus_tag="Suden_0290"
FT                   /old_locus_tag="Tmden_0290"
FT   CDS_pept        306028..306303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0290"
FT                   /old_locus_tag="Tmden_0290"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43571"
FT                   /db_xref="GOA:Q30TW0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43571.1"
FT                   /translation="MARSVKKGPFVDDHLMKKVLSAKAEGSKKPIKTWSRRSMVLPDMV
FT                   GITFNVHNGRQFVPVYVTENHIGYKLGEFAPTRTFKGHKGSVQKKG"
FT   gene            306306..306623
FT                   /locus_tag="Suden_0291"
FT                   /old_locus_tag="Tmden_0291"
FT   CDS_pept        306306..306623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0291"
FT                   /old_locus_tag="Tmden_0291"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43572"
FT                   /db_xref="GOA:Q30TV9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43572.1"
FT                   /translation="MARALLKFIRVSPIKSRLIAREIQGMNAELALASLEFTPNKAAKI
FT                   IAKVVASAVANSGNEAADCIVTSCRVDNGPVLKRFRPRARGMASGIRKPTAHILVEVEG
FT                   K"
FT   gene            306625..307350
FT                   /locus_tag="Suden_0292"
FT                   /old_locus_tag="Tmden_0292"
FT   CDS_pept        306625..307350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0292"
FT                   /old_locus_tag="Tmden_0292"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43573"
FT                   /db_xref="GOA:Q30TV8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43573.1"
FT                   /translation="MGQKVNPIGLRLGINRNWESRWFPNFKTAAAYLGEDHKIRTYLKK
FT                   ELYYAGVSNIVIERTAKRLRVTIIAARPGIIIGKKGSDIEKLKDTLQALVGKPLSVNIK
FT                   EEKKAQISSQLVAENVATQLERRVAFRRAMKKVMQNAQRGGAKGIKVSVSGRLGGAEMA
FT                   RTEWYLEGRVPLHTLRAKIDYGFAEAHTTYGCIGVKVWIFKGEVLTKGIPAEVKEEQQK
FT                   EGARRPKRAPKRENSGKAE"
FT   gene            307353..307778
FT                   /locus_tag="Suden_0293"
FT                   /old_locus_tag="Tmden_0293"
FT   CDS_pept        307353..307778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0293"
FT                   /old_locus_tag="Tmden_0293"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43574"
FT                   /db_xref="GOA:Q30TV7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43574.1"
FT                   /translation="MLMPKRTKYRKMMKGRNRGYARSGYTLAFGDIALKAVEAGRINSR
FT                   QIESARISATRHIKRNGKIWIRVFPAKPLTAKPLETRMGKGKGSVDQWVMNIKPGRIIF
FT                   EMAGVPEELAREALTLALHKLPFKTKIITAEMSNEIF"
FT   gene            307765..307950
FT                   /locus_tag="Suden_0294"
FT                   /old_locus_tag="Tmden_0294"
FT   CDS_pept        307765..307950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0294"
FT                   /old_locus_tag="Tmden_0294"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43575"
FT                   /db_xref="GOA:Q30TV6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43575.1"
FT                   /translation="MKYSDLADKNVVELQAMLKEKKTQLFTLKIKRQMMQLQDTSELRI
FT                   AKKDVARINTALSAAK"
FT   gene            307960..308208
FT                   /locus_tag="Suden_0295"
FT                   /old_locus_tag="Tmden_0295"
FT   CDS_pept        307960..308208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0295"
FT                   /old_locus_tag="Tmden_0295"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43576"
FT                   /db_xref="GOA:Q30TV5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43576.1"
FT                   /translation="MTHKREIQGNVVKISGDKTASIVVERRVMHPRYHKVVKRFKKYLV
FT                   HDERNELKVGDEIVAIECRPLSKTKSYRLKSVVVGVK"
FT   gene            308208..308576
FT                   /locus_tag="Suden_0296"
FT                   /old_locus_tag="Tmden_0296"
FT   CDS_pept        308208..308576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0296"
FT                   /old_locus_tag="Tmden_0296"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43577"
FT                   /db_xref="GOA:Q30TV4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43577.1"
FT                   /translation="MIQAFTRLNVADNTGAKEVMCIKVLGGSKRRYAQVGDVIIASVKK
FT                   ATPTAKVKKGKVVKAVIVRTAKEIHRENGSLIRFDDNAAVILDDKREPIGTRIFGPIAR
FT                   EVRYSGFMKIVSLAPEVV"
FT   gene            308576..308806
FT                   /locus_tag="Suden_0297"
FT                   /old_locus_tag="Tmden_0297"
FT   CDS_pept        308576..308806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0297"
FT                   /old_locus_tag="Tmden_0297"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43578"
FT                   /db_xref="GOA:Q30TV3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43578.1"
FT                   /translation="MAKFKFKKGDTVEIIAGDDRGTKATVLAVLPKKNKVIVEGCKIVK
FT                   KAIKPTEENTKGGHLNKEMPIDVSNVRKVEA"
FT   gene            308809..309354
FT                   /locus_tag="Suden_0298"
FT                   /old_locus_tag="Tmden_0298"
FT   CDS_pept        308809..309354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0298"
FT                   /old_locus_tag="Tmden_0298"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43579"
FT                   /db_xref="GOA:Q30TV2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43579.1"
FT                   /translation="MARMKDKYLALKAELQADLGIKNPMQTPALEKIVISVGAGFAMKD
FT                   NKLIQNIEDTITTIAGQKASTVIAKKSVAGFKVREGMPVGVRVTLRGEKMYNFFDRLVS
FT                   MALPRVKDFRGVPRNGFDGRGNYNFGLQEQLIFPEVSYDSVMQIHGMNITVVTSAESDK
FT                   AGFALLEKMGMPFSKGSN"
FT   gene            309354..309539
FT                   /locus_tag="Suden_0299"
FT                   /old_locus_tag="Tmden_0299"
FT   CDS_pept        309354..309539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0299"
FT                   /old_locus_tag="Tmden_0299"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43580"
FT                   /db_xref="GOA:Q30TV1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43580.1"
FT                   /translation="MAKKSMIVKAAREPKFKVRGYTRCQICGRPHSVIRDFGICRVCFR
FT                   KMANEGLIPGVRKSSW"
FT   gene            309645..310040
FT                   /locus_tag="Suden_0300"
FT                   /old_locus_tag="Tmden_0300"
FT   CDS_pept        309645..310040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0300"
FT                   /old_locus_tag="Tmden_0300"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43581"
FT                   /db_xref="GOA:Q30TV0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43581.1"
FT                   /translation="MINDLVSDALTRIRNAGMRRLDVTTLVHSKSVEALANILVEKGYI
FT                   ESCNVVEDGVKKTINVVLKYSDNGKSVINEMKRISKPGRRVYKGKDEIKRFKNGYGTII
FT                   VSTSHGVLPNDKAYALGVGGEVMCTVW"
FT   gene            310050..310586
FT                   /locus_tag="Suden_0301"
FT                   /old_locus_tag="Tmden_0301"
FT   CDS_pept        310050..310586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0301"
FT                   /old_locus_tag="Tmden_0301"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43582"
FT                   /db_xref="GOA:Q30TU9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43582.1"
FT                   /translation="MSRIGKLPVEFAADVKVSANGNVITFVKGKNSVDLDTKGNVAFNI
FT                   DGNVITFATLSDSRTHRAFWGTYRALAANIVTGLTTGYTKQLEINGVGYRASANANVLN
FT                   LQLGYSHDINYNLPEGVEAVVEKNVITLKSHDKQALGQVAAEVRGFRPPEPYKGKGIKY
FT                   SDETIVRKAGKTSKK"
FT   gene            310600..310956
FT                   /locus_tag="Suden_0302"
FT                   /old_locus_tag="Tmden_0302"
FT   CDS_pept        310600..310956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0302"
FT                   /old_locus_tag="Tmden_0302"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43583"
FT                   /db_xref="GOA:Q30TU8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43583.1"
FT                   /translation="MKAKVLKSKIANRLKRKRRIRAKISGCASLPRVSVFRSNRYLSVQ
FT                   AINDATATTLTSLSSKATGHKANKEGGAALGAAFAAKLKEVGISQIVFDRNGYQYHGVI
FT                   AAFGDALRENEIKF"
FT   gene            310965..311405
FT                   /locus_tag="Suden_0303"
FT                   /old_locus_tag="Tmden_0303"
FT   CDS_pept        310965..311405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0303"
FT                   /old_locus_tag="Tmden_0303"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43584"
FT                   /db_xref="GOA:Q30TU7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43584.1"
FT                   /translation="MEINREDFEESIVNIGRVTKVVKGGRRFRFTALVVVGNKKGTIGF
FT                   GAGKAKEVPDAIKKAVDNAFKNLSKVSIKGTTIAHDIEHKYNASRILLKPASEGTGVIA
FT                   GGAVRPVLELAGIKDVLTKSIGSNNPGTLVRATVEALGRLKG"
FT   gene            311409..311807
FT                   /locus_tag="Suden_0304"
FT                   /old_locus_tag="Tmden_0304"
FT   CDS_pept        311409..311807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0304"
FT                   /old_locus_tag="Tmden_0304"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43585"
FT                   /db_xref="GOA:Q30TU6"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43585.1"
FT                   /translation="MGIENLTPAEGSTANRKRVGRGCGSGMGKTSTRGGKGQTARSGSS
FT                   RKRNFEGGQTPLARRLPKIGFTSRVVKPYVINVEKIKAVAELAEITMESIRGVHKIAAG
FT                   ITKVKLVGASAKDLASKIKDDNVTATGK"
FT   gene            311810..313072
FT                   /locus_tag="Suden_0305"
FT                   /old_locus_tag="Tmden_0305"
FT   CDS_pept        311810..313072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0305"
FT                   /old_locus_tag="Tmden_0305"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43586"
FT                   /db_xref="GOA:Q30TU5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43586.1"
FT                   /translation="MNKNLVNKIFITIGFLFIYRLLAYVPVPGVDAAVIASFFDSHQSD
FT                   ALGLFNMFSGNAVERMSIIALGIMPYITASIIMELLAATFPTLGQMKKERDGMVKYMQI
FT                   IRYATIVITIIQAIGISVGLQSLTGPNGNSAILADHNTFIMLSAVSMLAGTMLLMWIGE
FT                   QITQSGIGNGISLIIFAGIVSAIPSAIGQTFTMVNTGAMSFITVLAILALIFGTVAVII
FT                   YVELGERRIPVTYAKKVMLQNQNKRVMNYIPIKVNLAGVIPVIFASAILMFPMTVMSSS
FT                   TNPTIMAIADYLNPNSYFFNFLTFVFVVFFAFFYASITFNSKDISENLKKQGGFIPGIR
FT                   TGNATAEFLNTTASNLTFTGALYLGLVATLPFMIIKGMGVPFFFGGTAVLIVVQVALDT
FT                   MRKIEAQIYMSKYETLSAVGL"
FT   gene            313076..313834
FT                   /locus_tag="Suden_0306"
FT                   /old_locus_tag="Tmden_0306"
FT   CDS_pept        313076..313834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0306"
FT                   /old_locus_tag="Tmden_0306"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43587"
FT                   /db_xref="GOA:Q30TU4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43587.1"
FT                   /translation="MAIALRQPADIEKLRAANKIVGGALELLRQNTKIGISLKELDAMA
FT                   EDYIRSHEARPSFKGLYGFPNAVCTSLNHVIIHGIPTEYKLQEGDIIGYDIGTELNGWF
FT                   GDAAITVAVGEVSDKDKELIACAKDSLYEAIDAIKVGMRFKELSVILENAIRSRGFVPL
FT                   HSFCGHGIGKKPHEEPEIPNYLEGKDPKGGPKIKNGMVFCLEPMICQKDSKPLILENKW
FT                   DVVSADGLRGSHYEHTVAVVNGKAEILSLA"
FT   gene            313851..314069
FT                   /locus_tag="Suden_0307"
FT                   /old_locus_tag="Tmden_0307"
FT   CDS_pept        313851..314069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0307"
FT                   /old_locus_tag="Tmden_0307"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43588"
FT                   /db_xref="GOA:Q30TU3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43588.1"
FT                   /translation="MAKSDVIEVDGKIIEALPNATFRVELENGHIILCHIAGKMRMHYI
FT                   KILPGDKVKLELTPYSLDKGRITYRYK"
FT   gene            complement(314103..314840)
FT                   /locus_tag="Suden_0308"
FT                   /old_locus_tag="Tmden_0308"
FT   CDS_pept        complement(314103..314840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0308"
FT                   /old_locus_tag="Tmden_0308"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43589"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43589.1"
FT                   /translation="MKFVLILLFALHVNAYDAFIKPAQLNEILQENNLILLDVSKYSDY
FT                   KKSHISGAIHTNISKFINNKYTGVSINFNQKIEDEMCNLGINENSHVVIYSRTNSIDYL
FT                   NATYLASTFLQHGFENISILDGGYMAWVFKYNNKVTSIESKPLKNGTFKATYNPQILVD
FT                   EEYLKDTTETTVAKSLKEIFFDDLTLRSEFELKKLFSNELTLEKERQNTIYSDTYLTAL
FT                   ANWYVLYKMFDLKNMKIYKSDIE"
FT   gene            complement(314848..315150)
FT                   /locus_tag="Suden_0309"
FT                   /old_locus_tag="Tmden_0309"
FT   CDS_pept        complement(314848..315150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0309"
FT                   /old_locus_tag="Tmden_0309"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43590"
FT                   /db_xref="GOA:Q30TU1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43590.1"
FT                   /translation="MSEVKKCNSLLEIRNEIDKIDDLIVELISKRSHLVRQAASFKNSI
FT                   EEVKADDRVDYILQKVRHSAIKADVSPNMISDLFKIMINEMVETEISEFRNTQTF"
FT   gene            complement(315204..315890)
FT                   /locus_tag="Suden_0310"
FT                   /old_locus_tag="Tmden_0310"
FT   CDS_pept        complement(315204..315890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0310"
FT                   /old_locus_tag="Tmden_0310"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43591"
FT                   /db_xref="GOA:Q30TU0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43591.1"
FT                   /translation="MTLNQIKMAIYSIFLTNYYGFKLKGSNSKDKKRLRVEYSTKLLNS
FT                   LNIKINIINKSKLPQDGQYLLVSNHRTIIDPLIIEFATKDSSIFGYWIAKKELYSSLFF
FT                   GSFTRNAGTILLDREASQMGGFFKDIKECTKEKNSIFIFPEGTRNKSEVQLSEFKDGSE
FT                   IIAIKNRLPILPVYIRSQAEKTLLLAIKDSTLERTIDIEIGDIIDYKNRELPLREAYKR
FT                   VFNITE"
FT   gene            complement(315900..316106)
FT                   /locus_tag="Suden_0311"
FT                   /old_locus_tag="Tmden_0311"
FT   CDS_pept        complement(315900..316106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0311"
FT                   /old_locus_tag="Tmden_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43592"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43592.1"
FT                   /translation="MAKNRKSIELHDKKISFELENVSYDVIRFYPTKMTLDVMVFENGA
FT                   KEGIKTLPFAHLPKEIKKIIKPN"
FT   gene            complement(316108..316956)
FT                   /locus_tag="Suden_0312"
FT                   /old_locus_tag="Tmden_0312"
FT   CDS_pept        complement(316108..316956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0312"
FT                   /old_locus_tag="Tmden_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43593"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43593.1"
FT                   /translation="MEQNHHLELGIINSLRVDRYTPHGIFLEALDGKDVLLPQAYVTQS
FT                   MQEDTLLEVFLYTDSEDRLVATTLKPKAMLDEFALFEVVDVAPFGAFVNWGLPKDLFVP
FT                   KMFQKEPFKVGDKRFLKIIYDDRTHRLVGTEKLGDFFERRVKGLSQHKEADILIIAKTP
FT                   LGYKCIVEKLYEGLIYHNEIFEKIEIGDKKRAFVKNIRKDGCIDLSLQPDSSKRKDASV
FT                   EKVKLLLNKNGGSMPYNYKSDAELIKDVFELSKKEFKRSLTALVDSNTIEVRENGIYLK
FT                   S"
FT   gene            complement(317024..318277)
FT                   /locus_tag="Suden_0313"
FT                   /old_locus_tag="Tmden_0313"
FT   CDS_pept        complement(317024..318277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0313"
FT                   /old_locus_tag="Tmden_0313"
FT                   /product="Arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43594"
FT                   /db_xref="GOA:Q30TT7"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43594.1"
FT                   /translation="MLLPFLIFLVTLILIIWQPRGLQIGTIAISGAIVALIFGVVNFND
FT                   VLSVFDIIWDATLAFIGIIIFSMILDEIGFFEYCALVMAKLSNGSGRAMFFYSIILGAL
FT                   VSALFANDGAALILTPILLAKMKILRLNTKTILAFLLAGGFISDSASLPFVFSNLTNIV
FT                   TANYFNIGFGTFFANMIFPFFISTLISMLILWIVLRKDIPLHVDITLLKNPKDAIKHKG
FT                   LFNFSWLFIALLLCSYFIGDTYHLPISLFALGGALIFLLIATFAKAVKPKEIIKDAPWQ
FT                   VVWFSLGLYIVVYGLKNAGLTNYLSEILLYLNTQSQLIAVVGTGFLAAILSAVMNNMPT
FT                   IMIMDIALKDIANEAMIYANIIGCNLGPKMTPFGSLATLLWLHTLEKKGIKINYYSYTK
FT                   FGLLVTPIVLLAVLLSLL"
FT   gene            complement(318277..318675)
FT                   /locus_tag="Suden_0314"
FT                   /old_locus_tag="Tmden_0314"
FT   CDS_pept        complement(318277..318675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0314"
FT                   /old_locus_tag="Tmden_0314"
FT                   /product="Arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43595"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43595.1"
FT                   /translation="MNKKILVLCTGNSCRSIIAEALINAHVKGVRAYSAGVRASGVVNP
FT                   NAKAVLQKAQIWRDEYHSKTIEEIEDIDFDLVITVCDNAKESCPIFKKKSKVIHVGFVD
FT                   PDGKEIAEFFKIFDEIKSKLLPIIEKEL"
FT   gene            complement(318668..318979)
FT                   /locus_tag="Suden_0315"
FT                   /old_locus_tag="Tmden_0315"
FT   CDS_pept        complement(318668..318979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0315"
FT                   /old_locus_tag="Tmden_0315"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43596"
FT                   /db_xref="GOA:Q30TT5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43596.1"
FT                   /translation="MDVFLKTIGAVNDYTRVEILHYINQSGEVCVCDIENSFSMIQSRI
FT                   SRHLKILKDAGFLKVDRRGRWAFYSIVEPMDEFRASILKEINSLGINISLQKKGCNLE"
FT   gene            complement(319119..320528)
FT                   /locus_tag="Suden_0316"
FT                   /old_locus_tag="Tmden_0316"
FT   CDS_pept        complement(319119..320528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0316"
FT                   /old_locus_tag="Tmden_0316"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43597"
FT                   /db_xref="GOA:Q30TT4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43597.1"
FT                   /translation="MFKSLRLKLLFYFFIINFIVLFIYGGFIYSTAKKGLLNTTDAQLK
FT                   MISLDVIPDFKESSYSNAKGFADELLGEFSITPLFLKIIHYNKQSKTIEHESISSDDMS
FT                   YLFEIPLNEIGHLNSIYYFNKGIYRVSSMLIFEKEDSKFFIQLATKKDIDSAYIKQLLY
FT                   NLIIATPIILIIFLFIANILINKTLSPVKEVIESVKLISVKSLSNRIDTKKIPSEIEEL
FT                   VSTFNHLLSNLEDSFNKITSFSQDASHELKTPLTVIRGEIEVALKQERSTEEYKDILKD
FT                   ILEESINIQEIINQLLFLAKKDTSEIKSGFLEIYLDEIVTDTALWIEKFAKNKNIDIVI
FT                   KKIIPSTIYANETLLKIAINNILKNAIVYSKSDTTIEISMDETSQEYLLIIKDNGYGIS
FT                   DEDLPFIFDRFYRADKARSRKDAGFGLGLSIVKMILDIHNYKIKLQSRKDIGTTVTILI
FT                   PKNELLLTRNI"
FT   gene            complement(320521..321195)
FT                   /locus_tag="Suden_0317"
FT                   /old_locus_tag="Tmden_0317"
FT   CDS_pept        complement(320521..321195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0317"
FT                   /old_locus_tag="Tmden_0317"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43598"
FT                   /db_xref="GOA:Q30TT3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43598.1"
FT                   /translation="MRILVVEDDEKIASFIKKGLQEESYSVDVTSNGYEAIYLVETNSY
FT                   DIVLLDLMIHGLGGIDVCKNIRGKNIATPIIMLTARDAIKDKVEGLDCGANDYLTKPFS
FT                   FEELLARIRSKLRTTSTLSSTIAIADLTINTARREVKRGDKKINLTAKEYALLEYLARN
FT                   SKKLLSETIIKENLSDMAEVSMSNIVNVYIYRLRNKIDKDYEPKLIHTVRGLGYMLSEK
FT                   DV"
FT   gene            complement(321199..321558)
FT                   /locus_tag="Suden_0318"
FT                   /old_locus_tag="Tmden_0318"
FT   CDS_pept        complement(321199..321558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0318"
FT                   /old_locus_tag="Tmden_0318"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43599"
FT                   /db_xref="GOA:Q30TT2"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43599.1"
FT                   /translation="MRNQPKYNFFKNTSYAIKGLRDLVATETSFKIELFVAITLLPVII
FT                   FIDVSLTNKLLMFITLFSMLIAEAINSAIERVVDLVTLEHHPLAGRAKDIGSSVVFLSI
FT                   AIFVVTWIFIIWETL"
FT   gene            complement(321555..323495)
FT                   /locus_tag="Suden_0319"
FT                   /old_locus_tag="Tmden_0319"
FT   CDS_pept        complement(321555..323495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0319"
FT                   /old_locus_tag="Tmden_0319"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43600"
FT                   /db_xref="GOA:Q30TT1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43600.1"
FT                   /translation="MFKYLIKYYLYMITLFFIGRAVLFVLYFDNFKDSGVDYWLTFIYG
FT                   LRMDTIVASTLLLIPLILLSLTPAKLKESVEKFLKYYFLVVFSIIIYIENATLPFIAQY
FT                   DVRPNYLFVEYLVYPQEVFAMIFADYKLELLVAFGMIGAFIYLYLKYAKNSTSKIFETS
FT                   YLKRIALFLPIFLLLFIGARSSFGHRPANASDAMYTTNRMVNEITKNSIYSILYAVYSN
FT                   SAHGSEKMMAKYGKMDTKEAIKRVKKRLNIKTTDDDSLFLRVQESHFKTTKPKNLVIFI
FT                   QESFGYQFVEAVGGEKGITPNFNNLSKEGILFTDLYSNGTRSIRGLAGMSAGNLAIPGD
FT                   GVLKRSKSQSGFFTIASLLKPFDYHTTFMYGGESRFDNMRSWYLGNGFDEIIDQPCFVN
FT                   PTFTAPWGVCDEDLAVRANEEFKKMHEKNQKFATVMFSQSNHSPFEYPYEKIELLDGVA
FT                   PNSVKNAIKYADFAIGRLIEMAKKEPYYKDTIFVIVADHNVRVYGNDLIPVDMFHIPAL
FT                   ILGADVKPQIYDKISTQPDVLATALDLIGLDFTYPIMGHSIFSDEKQNISLMQFHTSYA
FT                   LRVDDKVAIIGTDQKASTFIYEDPANYMDTNNHLTPTQSDEELEKDALAFVVALSYMYE
FT                   KKLYKPKDKNN"
FT   gene            323665..325587
FT                   /locus_tag="Suden_0320"
FT                   /old_locus_tag="Tmden_0320"
FT   CDS_pept        323665..325587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0320"
FT                   /old_locus_tag="Tmden_0320"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43601"
FT                   /db_xref="GOA:Q30TT0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43601.1"
FT                   /translation="MQESMRNRFHFIGIVFWIFLAISAITRTVLLVKSIDVVSLSILEI
FT                   LKIYLIGAFYDSVSAGYLVIPFVIYLFFIPQKLFNHKLHRYLTYAFSYTLLFGAVFLSF
FT                   SEWFFWDEFSVRFNFIAVDYLVYTKEVIGNIKESYPMGLLLTVIATIAALLFYFLYKTK
FT                   RVDTLLRDSSTIKQRIKPTLIYLLIPIISFAQVTDGLSKFSANQYNNELSKSGLYSLFG
FT                   AFRNNTLDYNTFYLSEDEQSALSNLKKSLSSDNSTFLNDGGVTRNIINKSQEKDYNVVM
FT                   IVVESLSGRFLESLGGDKGLTPNLDSLVKESMFFDNFYATGTRTIRGMESITLSVPPMP
FT                   GRSIVKKPDNHNMYSSGFIFRNKGYETKFIYGGYGYFDNMNEFFSNNGFSVVDRVNFSD
FT                   EEDTFHTVWGVCDEDLLNKTLKEADMSYHAHKPFMSFVMTTSNHRPYDYPNGRVDIPSH
FT                   TGRDGAVKYTDYAIGDFLKKAKDKPWFKNTIFVIVADHCATSAGKSELPLDKYHIPMII
FT                   YAPELIQPQVINKISSQIDIMPTLFNMLNWSYKSKFYGKDILEESFEPRALVGTYQKLG
FT                   LYKDDVLSVLSVGKKLNSYEVLEQDIFSTKYKEVSLDTKIKDEILSYYQSASYIQERKL
FT                   DRYED"
FT   gene            325577..326257
FT                   /locus_tag="Suden_0321"
FT                   /old_locus_tag="Tmden_0321"
FT   CDS_pept        325577..326257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0321"
FT                   /old_locus_tag="Tmden_0321"
FT                   /product="PAP2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43602"
FT                   /db_xref="GOA:Q30TS9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43602.1"
FT                   /translation="MKINREIVIILTTLIALFLLFEITNIDMFVQKFFYDDISHKWLLS
FT                   HEKGSWLDIVFYTGIKKSIIAFAVIILFLYLYSFRKSAKKLREYREGLLIVWLSVAIVP
FT                   ALIGFLKATTNVPCPCDAFVFGGDYPYIRVLDSMPQEIMKKFKCYPAGHASGGFALMSL
FT                   FFLFKSKINQILALVVTLIIGWSMGIYKMLIGDHYLSHTIITMVLSWLLILIIKKVVNK
FT                   YCKL"
FT   gene            326313..326657
FT                   /locus_tag="Suden_0322"
FT                   /old_locus_tag="Tmden_0322"
FT   CDS_pept        326313..326657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0322"
FT                   /old_locus_tag="Tmden_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43603"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43603.1"
FT                   /translation="MILGKCPYCKDGNIEVRDKEVSGKKVKLYACSNAHWSTEDGEMFE
FT                   PTKESTCSFRIWQNALAKYGKWLTYKEIRELLENESVEVELLSKKYGKKIYYKKYIITN
FT                   EEYGVSVLWE"
FT   gene            326933..327046
FT                   /locus_tag="Suden_0323"
FT                   /old_locus_tag="Tmden_0323"
FT   CDS_pept        326933..327046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0323"
FT                   /old_locus_tag="Tmden_0323"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43604"
FT                   /db_xref="GOA:Q30TS7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43604.1"
FT                   /translation="MKVRASVKKMCDDCKVVKRKGIVRVICKVKKHKQRQG"
FT   gene            327049..327411
FT                   /locus_tag="Suden_0324"
FT                   /old_locus_tag="Tmden_0324"
FT   CDS_pept        327049..327411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0324"
FT                   /old_locus_tag="Tmden_0324"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43605"
FT                   /db_xref="GOA:Q30TS6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43605.1"
FT                   /translation="MARISGVDLPKKKRIEYGLTYVYGIGLHASRKILDATGIDYNKRV
FT                   YELNEDDIAAITKEIRASHVVEGDLRKQVAMDIKALMDLGSYRGLRHRRGLPCRGQKTK
FT                   TNARTRKGKRKTVGAA"
FT   gene            327422..327814
FT                   /locus_tag="Suden_0325"
FT                   /old_locus_tag="Tmden_0325"
FT   CDS_pept        327422..327814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0325"
FT                   /old_locus_tag="Tmden_0325"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43606"
FT                   /db_xref="GOA:Q30TS5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43606.1"
FT                   /translation="MAKRKAVRKKVVKKNIARGICHISASFNNTLVTITDEMGNMIAWS
FT                   SAGSLGFKGSKKSTPFAAQAAVEDAVAKAQVHGVKELGIKVQGPGSGRETATKAVGGIE
FT                   GIRVTFMKDVTPLPHNGCRAPKRRRV"
FT   gene            327826..328452
FT                   /locus_tag="Suden_0326"
FT                   /old_locus_tag="Tmden_0326"
FT   CDS_pept        327826..328452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0326"
FT                   /old_locus_tag="Tmden_0326"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43607"
FT                   /db_xref="GOA:Q30TS4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43607.1"
FT                   /translation="MARYRGPVEKIERRFGVSLNLKGERRLAGKSALEKRPYAPGQHGQ
FT                   RRKKVSEYGLQLNEKQKAKFMYGVSEKQFRALFVEAKRREGNTGTNLVTLIEQRLDNVV
FT                   YRMGFATTRRFARQLVTHGHLLVDGAKLDIPSYRVRPGQKIEIRESSKNNSQIVRALEL
FT                   TNQTGLAPWVDIDADKKFGIFTRLPEREEVVIPVEERLIVELYSK"
FT   gene            328481..329473
FT                   /locus_tag="Suden_0327"
FT                   /old_locus_tag="Tmden_0327"
FT   CDS_pept        328481..329473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0327"
FT                   /old_locus_tag="Tmden_0327"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43608"
FT                   /db_xref="GOA:Q30TS3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43608.1"
FT                   /translation="MKKIKTTPLAPQEFEVEQISENEANIMAYPFETGFAISLAHPLRR
FT                   FLLSSSVGYAPIAIKIEGAKHEFDSVRGMLEDISDFILNLKETRFKLLGGATEAEINYN
FT                   FTGPCDIKGSNLSNSEVEIVTPNTHLATLNEDSTLNFSIRIAQGIGYVASEDTYDELQD
FT                   GYIALDAYFTPVRSATYKIENVLVEDNPNFERVILNIKTDGQITPLDAFRNSLEVMYAQ
FT                   LAVFNSEISVKAPATIERAEESPDLKKLTAHIDSLGLSARSFNCLDRSNIKLIGEIALM
FT                   STNDLKNVKNLGKKSYDEIVEKLQEFGYEVGGDLADDVVSALKKKIEAL"
FT   gene            329494..329844
FT                   /locus_tag="Suden_0328"
FT                   /old_locus_tag="Tmden_0328"
FT   CDS_pept        329494..329844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0328"
FT                   /old_locus_tag="Tmden_0328"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43609"
FT                   /db_xref="GOA:Q30TS2"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43609.1"
FT                   /translation="MRHRHGYRKLGRTSSHRAALLKNLSISLIEHGKIETTVEKAKELR
FT                   SYVEKLITVAGKNDSNAHKAVFAALQSKEATKKLVNEIAPKYVERAGGYTRIIRTRIRR
FT                   GDATTMAFIELV"
FT   gene            329976..331208
FT                   /locus_tag="Suden_0329"
FT                   /old_locus_tag="Tmden_0329"
FT   CDS_pept        329976..331208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0329"
FT                   /old_locus_tag="Tmden_0329"
FT                   /product="oxidoreductase-like protein protein"
FT                   /note="related to aryl-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43610"
FT                   /db_xref="GOA:Q30TS1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43610.1"
FT                   /translation="MSNFAFGTYRISDLNPQHVEALREAIESGVDLIDTSSNYMDGGAQ
FT                   RAIAAAMRAVESDKKNEVEIVSKFGYIQGSSLLEYRENFADKKYSKDVVKYSEDCYHCI
FT                   SKEFLHVELTESLKRLEVSSIGCYLIHNPEYYILDAINKNISKDDRLDEMYRRIENAFI
FT                   GLEEEIRDSRILSYGISSNSFSLLGSDDEFLPYEDLLTLAQNAATIVGNQKHSFTTIQL
FT                   PINILETEGLKCAAWAKQNGLRVLANRPLNAKYKNRMYRLADYKESREYYHYFNELIEF
FT                   CDRDELRALYNLLEEMEATKHKFDWIGSYDIFLFTQIIPHIKKSLERFESEEVEDIINT
FT                   IRLYLVEYRKMVEYECSVRTRDELKQFFKESHLLMQEIAIKFLMKCENVDYVIVGMRKP
FT                   LYVYEILSLRV"
FT   gene            331292..331567
FT                   /locus_tag="Suden_0330"
FT                   /old_locus_tag="Tmden_0330"
FT   CDS_pept        331292..331567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0330"
FT                   /old_locus_tag="Tmden_0330"
FT                   /product="Nitrogen-fixing NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43611"
FT                   /db_xref="GOA:Q30TS0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43611.1"
FT                   /translation="MIPFTDEELMNPVRNVIDKVRPSLALDSGDISFITVKNSKVYIQL
FT                   KGACVGCASSGTTLKYGVERQLKMDIHPEITVINVPVGMENDIDNL"
FT   gene            331584..332174
FT                   /locus_tag="Suden_0331"
FT                   /old_locus_tag="Tmden_0331"
FT   CDS_pept        331584..332174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0331"
FT                   /old_locus_tag="Tmden_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43612"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43612.1"
FT                   /translation="MAISKFKILSQAKDSFSKSDYKNALEKFASVLQNFPNSQEAYNGV
FT                   ILAEMALSGEGGAEALFDYYEVLREEDKEQADIIMSEILKNMDGSLEKLKEVFSEPLRD
FT                   RVELEDGILYKDFRTLVEEGGDFKEIFENIMFSTRVIITQKEDFVDFLDKLIEHDFTDM
FT                   ALTYLENALSVYPRDTSLRKLLKKLAKGKIVEN"
FT   gene            332164..333465
FT                   /locus_tag="Suden_0332"
FT                   /old_locus_tag="Tmden_0332"
FT   CDS_pept        332164..333465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0332"
FT                   /old_locus_tag="Tmden_0332"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43613"
FT                   /db_xref="GOA:Q30TR8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43613.1"
FT                   /translation="MKIEIPDEAFRYITENSQECDADTAFVLTPQNEKYLQNAKDNGAH
FT                   SIINIKDVAKLFGIEKIKIVGITGTNGKTTTASAIYSFLLDLGYRVAMQGTRGFFMNDR
FT                   VIEEKTLTTPSLLNTYKHIYQAVSEKCDFFIMEVSSHAIVQKRVEGLNFELKILTNITQ
FT                   DHLDFHKTLGEYIAVKNSFFQDDGRKLINKDETKSSFNFKNTFTYGIENSATYRLIAYS
FT                   LNNASSGIIQHFSEVVPFTSSLHGFFNLYNLMAAIAATHLLSGKKLEEVTAVVDNFAGV
FT                   SGRMEQVSESPNVIVDFAHTPDGIQQVLNALKEKELLVVFGAGGDRDRTKRPLMGRVAA
FT                   SLAKKLYITSDNPRTEDPQDIVNDILEGIQDKSIVQVELNRRKAIENALSEQKENEVVV
FT                   ILGKGDETYQIIYDQKFPFDDREVVREILKNKII"
FT   gene            333557..333931
FT                   /locus_tag="Suden_0333"
FT                   /old_locus_tag="Tmden_0333"
FT   CDS_pept        333557..333931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0333"
FT                   /old_locus_tag="Tmden_0333"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43614"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43614.1"
FT                   /translation="MGIPQPAFYIFKCEQSAPPGMPKPSCVTPQTQDLFQHLAQKLMKE
FT                   GVMGTIQPIRTSCLSRCSSGPVMLVEPGHFMYAALTKEKIDRIVEEHLIGGKVVEEYLI
FT                   SADVWDEPISPCEMKKQMGM"
FT   gene            333933..334298
FT                   /locus_tag="Suden_0334"
FT                   /old_locus_tag="Tmden_0334"
FT   CDS_pept        333933..334298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0334"
FT                   /old_locus_tag="Tmden_0334"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43615"
FT                   /db_xref="GOA:Q30TR6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43615.1"
FT                   /translation="MTIEMLYSKIHRATVTDANLNYVGSITVDEELLEASMLRVGQKVE
FT                   ILNINNGERFSTYIILGERGKRDICLNGAAARKVHKGDKIIIVAYATYDEKELQNYKPR
FT                   VVLVNDNNDIEEILESI"
FT   gene            334303..334611
FT                   /locus_tag="Suden_0335"
FT                   /old_locus_tag="Tmden_0335"
FT   CDS_pept        334303..334611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0335"
FT                   /old_locus_tag="Tmden_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43616"
FT                   /db_xref="GOA:Q30TR5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43616.1"
FT                   /translation="MFGNLSDMGKMLESMQESAKKLQSELESKVFNVKSGGGLVEITIN
FT                   GSGEVTDITIDNSLLGDKESLEILLIGAINDANKMVEQNRQNSALGMFGNVNPFGGR"
FT   gene            334613..335593
FT                   /locus_tag="Suden_0336"
FT                   /old_locus_tag="Tmden_0336"
FT   CDS_pept        334613..335593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0336"
FT                   /old_locus_tag="Tmden_0336"
FT                   /product="PDZ/DHR/GLGF"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43617"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43617.1"
FT                   /translation="MLRLLLALGLLFLNLHACKSSSESCRQKILDSGAILTQSLQIPIQ
FT                   KNYLLIFSQTPPKEKILKHDPFLSLYIIEDTKKFKYPFKINSHPSLGIIGVDNSRIINA
FT                   KIAKKQVGLDSFATFSHTLSTPSLLLNSCCDLEAIVTERGIIEKEYIDRFIKIKNVSYG
FT                   DIGIRVKDENSVVIVKESNPFVESNQLKVGDVILEFDTRKVKDSASFMRNILFSSIGST
FT                   HNVKIKRDNKIVTLRAITQKRLGGGFQRDVYLEFLGMQFDKKLFIVKVAKEAERFGLKV
FT                   GDRLLQANTKDIKGADDIFDKADKVKNSLNLLFEREHFQFFVKVN"
FT   gene            335606..336454
FT                   /locus_tag="Suden_0337"
FT                   /old_locus_tag="Tmden_0337"
FT   CDS_pept        335606..336454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0337"
FT                   /old_locus_tag="Tmden_0337"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43618"
FT                   /db_xref="GOA:Q30TR3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43618.1"
FT                   /translation="MQNFENFLLNHLPASKSIHPTYEEAVQKMLIAGGKRFRPALLLGV
FT                   VNAYNPLMIGGAYHAAYAIELLHTYSLIHDDLPAMDNSPLRRGEPTLHVLFDEVTAILA
FT                   GDALNTYAFEVLSNAPFSDFTRVELIRELATNGGLNGMVLGQAIDCYFENRVLSIDDVK
FT                   ILHTNKTAKLIAASLKMGAIIVGEEKLAETLYDFGIKLGLLFQIQDDILDVTQSSQEAG
FT                   KLTNNDENKNSFVTILGLDEAFLEAESLANTLLKEIDGFDEKLKSELSKLLVHYINRHK
FT                   N"
FT   gene            336472..338391
FT                   /locus_tag="Suden_0338"
FT                   /old_locus_tag="Tmden_0338"
FT   CDS_pept        336472..338391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0338"
FT                   /old_locus_tag="Tmden_0338"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43619"
FT                   /db_xref="GOA:Q30TR2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43619.1"
FT                   /translation="MSNKMRQKMADSIRFLAADMVQSANSGHPGAPMGLSDIAVVLSEH
FT                   LNHNPKNPSWLNRDRVVFSGGHATGLIYSLYYLWGYGLEIEDLKNFRQLDSKTPGHPEF
FT                   GHTAGVEITTGPLGQGIANAVGFSMASKFVGAQVNSETAKVIDHKVYCLCGDGDLEEGI
FT                   SYEACSIAGHNKLDNLILIYDSNRITIEGSTDLSISENIRMRFESQGWNVLECDGHNFD
FT                   EIDNVITAAKVNSKPTIIIANTLIAKGAGIMEGSHHAHGAPLGKDVIAQAKEDAGFPTN
FT                   KTFYVDEDVMARFRCAVEKGDLLEREWIHSLKTLPLMEQNEALSALQNPDFSKIQWPSF
FT                   DKADATRNTNGKILNAIAKALPNFLGGSADLSPSNKTELVDMGVYPKGRNIYFGIREHA
FT                   MASITNAIALYGPLMPFSATFFVFSDYLKPAARIAALTGIQQFFIWTHDSIGVGEDGPT
FT                   HQPIEHLSQFRALPNFYVWRPADGAENVEAWKTALEMKKSPSAFVCSRQNLSVLPLPVK
FT                   GIISNGGYLLASDENATITLMASGSEVELALKVKEALNEKKVHVNVVSVPCYDLFIEQD
FT                   KTYIDSIIKPNTKKIAIEAARGLEWYRFADEVIGMDTFGASAPADKLFAKFGFSVEGVL
FT                   SKII"
FT   gene            338582..338833
FT                   /locus_tag="Suden_0339"
FT                   /old_locus_tag="Tmden_0339"
FT   CDS_pept        338582..338833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0339"
FT                   /old_locus_tag="Tmden_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43620"
FT                   /db_xref="GOA:Q30TR1"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43620.1"
FT                   /translation="MKLLSVLLVGATLCFGAVDINKADKAQLMEIKGVGEAKANAILEY
FT                   RKEHKCFKTVEEIKNVKGFGVKFLEKNKSNLEASSCKK"
FT   gene            complement(338886..339560)
FT                   /locus_tag="Suden_0340"
FT                   /old_locus_tag="Tmden_0340"
FT   CDS_pept        complement(338886..339560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0340"
FT                   /old_locus_tag="Tmden_0340"
FT                   /product="DNA-3-methyladenine glycosylase III"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43621"
FT                   /db_xref="GOA:Q30TR0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43621.1"
FT                   /translation="MNRVYHIYKTLYEMYGPQGWWPILGHGYHKLDYTFPHNEDEIFEV
FT                   CLGSILTQNTTFTSVVKSLNNLHVKSALNVYGIENMNILELKEAIKPCGYFNQKTRYIL
FT                   EFIKFYKSLDGKVPTRDALLSVIGIGEESADSILLYGYNQLEFKVDAYTKRLLSELGMI
FT                   EPKTKYRDIKNLVETSLKECIKNEVELLKTYQEFHALLVAHGKSYYSKKPYGSGCVLKE
FT                   VI"
FT   gene            complement(339557..340465)
FT                   /locus_tag="Suden_0341"
FT                   /old_locus_tag="Tmden_0341"
FT   CDS_pept        complement(339557..340465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0341"
FT                   /old_locus_tag="Tmden_0341"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43622"
FT                   /db_xref="GOA:Q30TQ9"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43622.1"
FT                   /translation="MSSILFSILAIYIFIVIGFIAKMSFKERIDDKTITLINVYFLQVF
FT                   LTFWGLLIRPVDSTLLFAPSIYLFIVILVLFISALMAKRLFEDKKEYSIATVAAVIGNT
FT                   GNLGIPLNIAIFGEESIPYTTVINLMNVFIVYTVGVYYYSRGSFDVKSSFKNIAKLPIL
FT                   WAAALAITLSAYGYQPSVEIMKTLMMGAYASIVMQLFLFGIYLYGTKISEISKRLTLWV
FT                   ISVKFIILPALTFLVLFLIELDLMIKGIIFIELLVPLAIANVNFASLYDCKPKVVTALV
FT                   FISSVIFLGAIFIGIRLLNYL"
FT   gene            340518..340838
FT                   /locus_tag="Suden_0342"
FT                   /old_locus_tag="Tmden_0342"
FT   CDS_pept        340518..340838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0342"
FT                   /old_locus_tag="Tmden_0342"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43623"
FT                   /db_xref="GOA:Q30TQ8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43623.1"
FT                   /translation="MQNIEDINRVIKENLAVMLYFSAPTCNVCHALKPKLLEAIENNFQ
FT                   EFEVVSIDTSIEQEIAANFSVFAIPTVLVFLDGREFLRKSRHMSVDEVIREIKRPYEVM
FT                   TS"
FT   gene            complement(340842..341591)
FT                   /locus_tag="Suden_0343"
FT                   /old_locus_tag="Tmden_0343"
FT   CDS_pept        complement(340842..341591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0343"
FT                   /old_locus_tag="Tmden_0343"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43624"
FT                   /db_xref="GOA:Q30TQ7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43624.1"
FT                   /translation="MQDSQEYKDKKAYFEKIITLYGRNVIIEVLLDNTIEIHKLHLSNS
FT                   NKSDGAIETILSLAKKRDIQVTYHDKNALSRISKNSKQDQGVAIDIIANSYKNANEIKN
FT                   LKKFKLLALDGIQNPQNLGMIIRSCAAGYIDGVILPKKNSAKISPLVIKASAGTLFKLP
FT                   IYYCNTLDEVLKELKDTKIYLLSSHAKKSIYDLRQEDKSIFVLGNESDGVSREIEALCN
FT                   DSINIPMNRDVESLNVAVTASLIAFMR"
FT   gene            complement(341641..342366)
FT                   /locus_tag="Suden_0344"
FT                   /old_locus_tag="Tmden_0344"
FT   CDS_pept        complement(341641..342366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0344"
FT                   /old_locus_tag="Tmden_0344"
FT                   /product="Protein of unknown function DUF328"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43625"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43625.1"
FT                   /translation="MLKILFSPSENKKTGGTEEQKELFGSNSARETILNEYNSVVNSHN
FT                   EEVIKELFGFKKFSDCQPYINDIFKSPLMHSIERYDGIAYQYLNFETLNNSAKEYLMKN
FT                   SIIFSNLYGPIFGGDTIANYKVKQGNNIGNLIPDKFYKDRFSYQLDLFLSNADILDLRA
FT                   GYYDKFYEINKPYLTLKFLKDGKVVSHWAKAYRGLVLRAVAENSINSIEEFMKIQIDTL
FT                   SVKEIIKKKNRTEIVYEIR"
FT   gene            342504..342580
FT                   /gene="tRNA-Thr1"
FT                   /locus_tag="Suden_R0012"
FT                   /old_locus_tag="Tmden_R0012"
FT   tRNA            342504..342580
FT                   /gene="tRNA-Thr1"
FT                   /locus_tag="Suden_R0012"
FT                   /old_locus_tag="Tmden_R0012"
FT                   /product="tRNA-Thr"
FT   gene            342635..342719
FT                   /gene="tRNA-Tyr1"
FT                   /locus_tag="Suden_R0013"
FT                   /old_locus_tag="Tmden_R0013"
FT   tRNA            342635..342719
FT                   /gene="tRNA-Tyr1"
FT                   /locus_tag="Suden_R0013"
FT                   /old_locus_tag="Tmden_R0013"
FT                   /product="tRNA-Tyr"
FT   gene            342733..342809
FT                   /gene="tRNA-Gly1"
FT                   /locus_tag="Suden_R0014"
FT                   /old_locus_tag="Tmden_R0014"
FT   tRNA            342733..342809
FT                   /gene="tRNA-Gly1"
FT                   /locus_tag="Suden_R0014"
FT                   /old_locus_tag="Tmden_R0014"
FT                   /product="tRNA-Gly"
FT   gene            342965..343039
FT                   /gene="tRNA-Thr2"
FT                   /locus_tag="Suden_R0015"
FT                   /old_locus_tag="Tmden_R0015"
FT   tRNA            342965..343039
FT                   /gene="tRNA-Thr2"
FT                   /locus_tag="Suden_R0015"
FT                   /old_locus_tag="Tmden_R0015"
FT                   /product="tRNA-Thr"
FT   gene            343130..344329
FT                   /locus_tag="Suden_0345"
FT                   /old_locus_tag="Tmden_0345"
FT   CDS_pept        343130..344329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0345"
FT                   /old_locus_tag="Tmden_0345"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43626"
FT                   /db_xref="GOA:Q30TQ5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43626.1"
FT                   /translation="MAKEKFARNKPHVNIGTIGHVDHGKTTLTAAITAVLAVTNGAKMM
FT                   DYDAIDNAPEERERGITIATSHVEYETNNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSKQVGVPYIVVFMNKEDMVDDEELLELVEMEIRELLDMYDF
FT                   PGDDTPIVAGSAKEALDEAKTGTLGPWSAKIQKLMAAVDEYIPEPTREVDRDFLMPVED
FT                   VFSISGRGTVVTGRIERGTVKIGDAIEIVGIRDTQKTTVTGIEMFRKEMDQGLAGDNCG
FT                   VLVRGIGKDDVERGQVLCKPGTINPHTKFTAEIYVLSKEEGGRHTPFFTNYRPQFYVRT
FT                   TDVTGAIYLPEGTEMVMPGDNVSITVELIHPIAMEKGTKFAIREGGRTVGAGVVAEILA
FT                   "
FT   gene            344373..344525
FT                   /locus_tag="Suden_0346"
FT                   /old_locus_tag="Tmden_0346"
FT   CDS_pept        344373..344525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0346"
FT                   /old_locus_tag="Tmden_0346"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43627"
FT                   /db_xref="GOA:Q30TQ4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43627.1"
FT                   /translation="MREAIHLGCEKCTRRNYHTTKNKKTHTEKFSVKKYCKFCREHTLH
FT                   KEMKL"
FT   gene            344581..344657
FT                   /gene="tRNA-Trp1"
FT                   /locus_tag="Suden_R0016"
FT                   /old_locus_tag="Tmden_R0016"
FT   tRNA            344581..344657
FT                   /gene="tRNA-Trp1"
FT                   /locus_tag="Suden_R0016"
FT                   /old_locus_tag="Tmden_R0016"
FT                   /product="tRNA-Trp"
FT   gene            344721..344900
FT                   /locus_tag="Suden_0347"
FT                   /old_locus_tag="Tmden_0347"
FT   CDS_pept        344721..344900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0347"
FT                   /old_locus_tag="Tmden_0347"
FT                   /product="SecE subunit of protein translocation complex"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43628"
FT                   /db_xref="GOA:Q30TQ3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43628.1"
FT                   /translation="MNLGVHIKNARIELSKVIFPTKGQVKQAYISVLIVVTVITAFLAL
FT                   VDLLMSSIMSAILG"
FT   gene            344910..345449
FT                   /locus_tag="Suden_0348"
FT                   /old_locus_tag="Tmden_0348"
FT   CDS_pept        344910..345449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0348"
FT                   /old_locus_tag="Tmden_0348"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43629"
FT                   /db_xref="GOA:Q30TQ2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43629.1"
FT                   /translation="MEKKNSHQWYSIQTYGNERTVRLAILNLIEEMRLQDFITDVIVPT
FT                   EDVIEVKDGKKKISERSLYSGYVFARIELNTEIQHIIQSIPKVSGFIGEANIPTPLSEH
FT                   DINVILDRVQNRAAPKPKVFFDNGETVRITDGPFANFTATVDEYDLEHGTLKLNVSIFG
FT                   RATPVDISYTQVEKII"
FT   gene            345614..346039
FT                   /locus_tag="Suden_0349"
FT                   /old_locus_tag="Tmden_0349"
FT   CDS_pept        345614..346039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0349"
FT                   /old_locus_tag="Tmden_0349"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43630"
FT                   /db_xref="GOA:Q30TQ1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43630.1"
FT                   /translation="MAKKIMGYIKLQIEAGKATPAPPVGPALGQRGVNIMEFTKAFNEK
FT                   TKDKMGFKVPVVITVFTDKSFTFVVKQPPASALLMHAAGLKGGSSNPLKNKVAKLTQAQ
FT                   LMEIVNRKIEDLNTDDKEAAAKTIAGSARSIGIEIVD"
FT   gene            346110..346802
FT                   /locus_tag="Suden_0350"
FT                   /old_locus_tag="Tmden_0350"
FT   CDS_pept        346110..346802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0350"
FT                   /old_locus_tag="Tmden_0350"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43631"
FT                   /db_xref="GOA:Q30TQ0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43631.1"
FT                   /translation="MSKRYKQLTEKIDVTKAYSVDEASLLVKNLVSAKFDETVEVAFNL
FT                   NVDPRHADQMIRGAIVLPHGTGKTVRVAVFAKGAKADEAKAAGADIVGTDDLVQQIKDG
FT                   IFNFDIVVAAPDCMGLVGQIGRILGPKGMMPNPKTGTVTPDVATAVKNVKGGQVNFRVD
FT                   KKGNIHAGIGKASFNADKISENLITFVKAINRHKPSSAKGRYIKNCALSLTMSPAIKLD
FT                   VMQLADMK"
FT   gene            346955..347434
FT                   /locus_tag="Suden_0351"
FT                   /old_locus_tag="Tmden_0351"
FT   CDS_pept        346955..347434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0351"
FT                   /old_locus_tag="Tmden_0351"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43632"
FT                   /db_xref="GOA:Q30TP9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43632.1"
FT                   /translation="MTKTQKAEIIEVLSNEFKDAQSVIFCDYKGLSVSKLENLRKMARA
FT                   KDTKVQVVKNTLATIALSNASLTGVELKDTNILVWGADSVATSKVCADFAKDNEKFVIK
FT                   SAYVDREAADAAKVEAFAKLPGREELLAMLAATWMAPVTCFTIGLDALRQKKEEA"
FT   gene            347494..347862
FT                   /locus_tag="Suden_0352"
FT                   /old_locus_tag="Tmden_0352"
FT   CDS_pept        347494..347862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0352"
FT                   /old_locus_tag="Tmden_0352"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43633"
FT                   /db_xref="GOA:Q30TP8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43633.1"
FT                   /translation="MAITKQDVLEFISGLSVLELSELVKEFEEKFGVSAQPVAVAGGAV
FT                   AAVAVEEQTEFNVIITDAGDKKINVIKVVRALTGLGLKEAKDATENVPSTIKEGVDKET
FT                   AMNAKKELEEAGAKVEVK"
FT   gene            348090..352235
FT                   /locus_tag="Suden_0353"
FT                   /old_locus_tag="Tmden_0353"
FT   CDS_pept        348090..352235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0353"
FT                   /old_locus_tag="Tmden_0353"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43634"
FT                   /db_xref="GOA:Q30TP7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43634.1"
FT                   /translation="MLNTLYSGNRLRVDFSKTPQQIEVPNLLQLQQSSYNKFLMLEEKD
FT                   RSQSGVETVFQSVFPIHDTQNRLTVEYIDSEVGKPKYTVRECMERGLTYAVSLRMKTRL
FT                   ILWDRDENTKEKLGVKDIKEQSIFVRDIPLMTERTSFIINGVERVVVNQLHRSPGVIFK
FT                   EEESTTSGNKLIYTGQIIPDRGSWLYFEYDPKDILYMRINKRRKVPVTIMFRALGYSKQ
FT                   DILKLFYPIQHINIVDNKFLMSFNPNDYSSRLTYDLVDKNGKILLASGKRLSAKKAQNF
FT                   IDEGLSEVEYPLEVLLDRYLAKPIVDPETGEILFDAMTRIDETKLKKLSEIGVKNFSIA
FT                   NDLAEGVDGSIINAFNADADSLKLLKQTEDIEDENHLSAIRIYKVMRPGEPVTKEAAKV
FT                   FVNQLFFDPERYDLTKVGRMKMNHKLGLNIPEYITVLTHEDIIESVKYVIKVKNGQGHI
FT                   DDRDHLGNRRIRSIGELLGNELHNGLIKMQKAIRDKLSTMSGPMNELMPHDLINSKMIT
FT                   STIMEFFSGGQLSQFMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHPTHYGRI
FT                   CPIETPEGQNIGLINTLATYSKVNEHGFIEAPYKVMKEGKVTDEIVYLTATQEEGKKIA
FT                   AASNKLDKDGQFIDKMVVTRVDGEILHRPVTECNYADLSSHMVVGVAASLIPFLEHDDA
FT                   NRALMGANMQRQAVPLIKHEAPIVGTGVEKLVARDSWECVKARRSGIVEKVDGKHIYVM
FT                   GDDDGEIYIDYYPLQKNLRTNQNTAFGQKPIVNIGQRVEIGQVIADGPNMDQGELALGV
FT                   NAMVAFMPWNGYNFEDAIVISERLIRKDAFTSVHIYEKEVEARELKHGVEEITRDIPNV
FT                   RDDELSHLDESGIIKIGTNVTGGMILVGKVSPKGEVKPTPEERLLRAIFGEKAGHVINK
FT                   SLYCPPSMEGVVVDVKIFTKKGYDKDARTLELEKEERDYLEREHYDRLLMIDKEEMLRV
FT                   TKLLTKEPLINDIKIGNTSYKAGDIINGEDLVEVNRFAMNAIIKSFSEEIQSEYNKTKN
FT                   YFQKEKRLFRDEHEEKLNILEKDDILPNGVVKHVKIYIATKRQLKVGDKMAGRHGNKGI
FT                   VSTIVPEVDMPYMEDGRGVDVCLNPLGVPSRMNIGQILEMHLGMAGRELGHQITKEFES
FT                   KQKDFIKNLRAKMIEIADVAQMMNAAKTLGDMSDELLLHHARDWSRGVKFASPIFEGVN
FT                   AVEFEKLFALAKMDTDGKTVLYNGLTGEKIKERVNVGYMYILKLHHLVDEKIHARSTGP
FT                   YSLVTQQPVGGKALFGGQRFGEMEVWALEAYGASAVLKEMLTIKSDDVDGRVRAYKAIT
FT                   KGELVPESGIPETLFVLTKELQSLALDVEIFDEVEDNE"
FT   gene            352228..356739
FT                   /locus_tag="Suden_0354"
FT                   /old_locus_tag="Tmden_0354"
FT   CDS_pept        352228..356739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0354"
FT                   /old_locus_tag="Tmden_0354"
FT                   /product="DNA-directed RNA polymerase, subunit beta-prime"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43635"
FT                   /db_xref="GOA:Q30TP6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43635.1"
FT                   /translation="MSKLVPIEVTEDRRPTDIKQIQFRLASPEKVMSWSHGEVKKPETI
FT                   NYRTLKPERDGLFCAKIFGPVRDYECLCGKYKKMRYKGVVCEKCGVEVTSTKVRRIRMG
FT                   HIELVTPVAHIWYVSSLPSRIGTLLGIKMKDLERVLYYEAYIVESGGEAYYDAEAKTPV
FT                   LKYDVLNEEQYRTLVSRFGELGFKARMGGEVVRDLLDSIDLVDLFTQLKEDIELTKSEA
FT                   KTKTIAKRLKVIESFLNSGNNPAWMMLTVLPVLPPDLRPLVSLDGGKFAVSDVNDLYRR
FT                   VINRNQRLKRLVELEAPEIIVRNEKRMLQESVDALFDNGRRANAVKGANKRPLKSLSEI
FT                   IKGKQGRFRQNLLGKRVDFSGRTVIVVGPSLSMDECGLPKKMALELFKPHLIAKLEDKG
FT                   YATTVKAAKKMIEDKTNEVWECLAEIVDGYPVLLNRAPTLHKLSIQAFHPKLIDGKAIQ
FT                   LHPLVCAAFNADFDGDQMAVHIPLSSAAIAEAKVLMLASMNILLPASGKAIATPSQDMV
FT                   LGIYYITLEKNGVKGSNKLFANVDEVRIAIEHDALDIHAKVRTRDDGRIIHTTAGRMLL
FT                   KAILPNFVPSELWNRVMKKKAINEVVDYVQKHGGIGVTAGFLDRLKNLGFKHATEAGIS
FT                   ISIDDIKIPAGKEAKIAESKNRVFEIQKQFEAGLLTEQERYNKIIDVWTDTNNTLATQM
FT                   MDLVQTDKAGFNSIHMMADSGARGSAAQIRQLAGMRGLMAKPSGEIIETPIISNFKEGL
FT                   NVVEYFISTHGARKGLADTALKTANAGYLTRKLVDVAQNVKIVEHDCHTHEGIEISDIS
FT                   DQNTLIESLEDRLNGRVLADDVIDPISNEILFAEGTLLDEVSAKVIAEAGIKTAYIRTP
FT                   TTCKSENGICALCYGVNLATGQIVRRGEAVGIIAAQSIGEPGTQLTLRTFHVGGTASST
FT                   AQERQVVAEKEGFIRYYNLKTYVSKEGRNIVANRRNAAVLLVEPKIKAPFSGRVEIQTV
FT                   HDEVIISVSSKTDTIRYVLRKNEIAKPNELAGVGGQIEGKYYFPYESGAEVQEYESIVE
FT                   TIKDGWNVPSRIPYASEVLVANGAPVTQKIFAKEDGVVKYFLLRGDYLERFEGLKAGYE
FT                   VIEKGLFATVVDSNNREAVRHYIARGSIIVAEDDAVVDPKTLIAKPKNDESTVIAEWDP
FT                   YSNPIISETSGTVKFEDIIIGTTATEQYDELTGKTRLMISDHVPAEYKPTIVLASEDGE
FT                   LLRYQVQSKTSIYVEDGAKVKVADIIAKTPKALQKSSDITGGLPRVSELFEGRRPKATA
FT                   LISEIDGVVSFGKSLRGKIRIIVASDNGILKEYFVDKSHTPVVNSGDFVHAGERLTSGI
FT                   ISSHELLRIMGVKTLYNYLVSEVQQVYRSQGVNISDKHIEVIFTQMLRQVKILKSGDTK
FT                   FIEGDLISKVKFAQENEKIIKLGGRPAIAEPFLVGITRAAVSADSIISAASFQDTTKVL
FT                   TEAAVSAKVDDLNDLKENVIIGRTIPVGTGIYKDQEIMFGYN"
FT   gene            356938..357318
FT                   /locus_tag="Suden_0355"
FT                   /old_locus_tag="Tmden_0355"
FT   CDS_pept        356938..357318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0355"
FT                   /old_locus_tag="Tmden_0355"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43636"
FT                   /db_xref="GOA:Q30TP5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43636.1"
FT                   /translation="MPTINQLIRKERQKVVKKSKSPALVSCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTSGFEVISYIMGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDT
FT                   AGVANRTVSRSKYGTKRPKVKK"
FT   gene            357420..357887
FT                   /locus_tag="Suden_0356"
FT                   /old_locus_tag="Tmden_0356"
FT   CDS_pept        357420..357887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0356"
FT                   /old_locus_tag="Tmden_0356"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43637"
FT                   /db_xref="GOA:Q30TP4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43637.1"
FT                   /translation="MRRRKAPVREIMPDPVYGSKVLTKFINKIMFDGKKSTAEKIIYSA
FT                   MDIISSRGEKTGIDTFNEAIENIKPIIEVKSRRVGGATYQVPVEVRPVRQLSLAIRWLV
FT                   DASRKRNERTMAERLANELMDASSDKGNAFKKKEDTYRMAEANKAFAHYRW"
FT   gene            357900..359990
FT                   /locus_tag="Suden_0357"
FT                   /old_locus_tag="Tmden_0357"
FT   CDS_pept        357900..359990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0357"
FT                   /old_locus_tag="Tmden_0357"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43638"
FT                   /db_xref="GOA:Q30TP3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43638.1"
FT                   /translation="MARSHKLEDVRNIGIAAHIDAGKTTTTERILFYTGREHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCEWAGKQINIIDTPGHVDFTIEVERSMRVLDGAVS
FT                   VFCAVGGVQPQSETVWRQRNRYGVPSIVFVNKMDRTGANFYAVEEQIRTRLKGNPVPIQ
FT                   IPIGEEDNFLGVIDLVKMKAIVWDVDAAMGSNYHVEEIPANLLQKAQEYREKMIESISE
FT                   VDGNEHLAEKYLEGEELSEDEIIAGIKAATIGMHIVPMTAGTSFKNKGVQTLLDAVVAY
FT                   LPAPTECAPIKGTMMDDEDEEVIVPSTDSGEFASLAFKIMTDPFVGTLTFIRVYRGSLE
FT                   AGSFVHNSTKDKKERIGRIVKMHAVKREDIKEIYAGEIGAVVGLKYTTTGDTLCSEADK
FT                   VILERMTFPEPVISVAVEPKTKADQEKMGLALAKLAAEDPSFKVHTDEETGQTIISGMG
FT                   ELHLEILVDRMKREFKVEAEVGAPQVSYRETIRDTVNQEYKYAKQSGGRGAFGHVYLTI
FT                   KPGDAGTGFVFHNEIKGGVIPKEYIPAVEKGCAETMSNGVLAGYPMEDIDITLYDGSYH
FT                   EVDSNEMAFKLAASMGFKEGCRKARPAILEPLMKVEVEVPEDYMGDVIGDLNRRRGQVT
FT                   NMGDRSGNKIVDAFVPLAEMFGYSTDLRSATQGRATYSMEFDHYEEVPKNVSEEIIKKR
FT                   NG"
FT   gene            complement(360339..361052)
FT                   /locus_tag="Suden_0358"
FT                   /old_locus_tag="Tmden_0358"
FT   CDS_pept        complement(360339..361052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0358"
FT                   /old_locus_tag="Tmden_0358"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43639"
FT                   /db_xref="GOA:Q30TP2"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43639.1"
FT                   /translation="MNILKEFETNDSCSYLKSKNQTTHYKIVDECSVLFSQELIERGYR
FT                   RFGKVYFRPVCSNCDECKSIKIDVDNFIFSSSQKRVLKKASKIKSYIQKPSLSRAHLEL
FT                   FDKYHLYMREKKGWDYTPSSAQSYHSSFVDGHHDFGYEILYYYEDKLIGVDLIDVLNDG
FT                   ISSIYFYYDPAYSHYSLGRLSLYNQILFAKNSNKSWIYLGYYVKECPSLAYKAHYTPYL
FT                   TLQDRPELFEEALWL"
FT   gene            361094..361438
FT                   /locus_tag="Suden_0359"
FT                   /old_locus_tag="Tmden_0359"
FT   CDS_pept        361094..361438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0359"
FT                   /old_locus_tag="Tmden_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43640"
FT                   /db_xref="GOA:Q30TP1"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43640.1"
FT                   /translation="MREIFIRYKIVIFRVLGIMMLLIGFILFFWMSPKEGFSENEVALA
FT                   NLARMEASVKGGSATTSKQSQKPDASKFVQELQNAQQQQVQYLLIATMIFGVLFLLYSF
FT                   ISKPKNDSEI"
FT   gene            complement(361416..362513)
FT                   /locus_tag="Suden_0360"
FT                   /old_locus_tag="Tmden_0360"
FT   CDS_pept        complement(361416..362513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0360"
FT                   /old_locus_tag="Tmden_0360"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43641"
FT                   /db_xref="GOA:Q30TP0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43641.1"
FT                   /translation="MDNYEYTELLKNLSKKMSNITGVVEPDKLYKRVAQIDELENSQDF
FT                   WNDSSNAALVQKDKTQCERKLKKYNLAKNAIDDAKELYEMAKEENDEDLIAECFNGAQH
FT                   IEDLIRTMEIEVLLSEETDGNNAILSIHPGAGGTESQDWASILLRMYKRFAERRGWSVE
FT                   VLDYQAGDEAGIKDVSLLISGENAYGYLKVENGIHRLVRISPFDSNAKRHTSFSSVMVS
FT                   PEVDDDINIVIEDRDIRVDTYRSSGAGGQHVNKTESAIRITHIATGVVVQCQNDRSQHK
FT                   NRATAMKMLKSRLYELELENQKAEIAGIAKSEIGWGHQIRSYVMQPYQQIKDTRSNIAY
FT                   SNVSAILDGDIDKMIEDVLISQNRS"
FT   gene            362567..363388
FT                   /locus_tag="Suden_0361"
FT                   /old_locus_tag="Tmden_0361"
FT   CDS_pept        362567..363388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0361"
FT                   /old_locus_tag="Tmden_0361"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43642"
FT                   /db_xref="GOA:Q30TN9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43642.1"
FT                   /translation="MKIISNPLELKEYLKDEKRSIGFIPTMGALHEGHIALIKKAKEQN
FT                   ELVVVSIFLNPTQFLKGEDLDKYPKKDEADRQICKLCGVDILFFPHVDGIYGSDEVSLL
FT                   APKIRGFVLEGQSRPSHFNGVLTVVMKLLNIVRPKRAYFGKKDAQQLNLISLMVKQLFM
FT                   SVEIVAVDTVREKDGLALSSRNAYLTPAQRQEALKIATSLRSATAMVMRGIFDSELIIA
FT                   NMREILSPLDISYVAIVNREFTELKRVEIGNSVILVEASLGSTRLLDNIWL"
FT   gene            complement(363335..365122)
FT                   /locus_tag="Suden_0362"
FT                   /old_locus_tag="Tmden_0362"
FT   CDS_pept        complement(363335..365122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0362"
FT                   /old_locus_tag="Tmden_0362"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43643"
FT                   /db_xref="GOA:Q30TN8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43643.1"
FT                   /translation="MNSQNKSKKIFILYALLVGGFLLFLAVMLINTLKARDLPSLYTKN
FT                   TSKATRGSIISADGFHIATTVKLYKAIVNTHYIDSKKADLFVKLFSIYSEIPPLEIEKK
FT                   LRQKGVVVLSYNIPQKQAQYLKQLSYELRRLKVFIERKNPITGKTSLHALNIIESGESR
FT                   EYSYGNLLTPIIGYPHKAEDDGYTYIKGVKGLEKRFENELQAKQDELSQGLRDVNSYII
FT                   FNKNSFTKQEINGLDVKLNIPVSLQIRVEKMLDVMQEDLRAKEIMLAVMNSTNGEILAM
FT                   ASSNRFLPKEIKTSDYPSLNSSMIEYSFEPGSVIKTITFSLLLDKGLVNPYDMVNGHNG
FT                   RFVIGNKTITDEHRFDWLSAENTIVHSSNVGIAQLAQKLSGGEFNQGLIDFGFSKPSTP
FT                   DLVYERVGSIPSATQLNSEIYKATCSYGYGIRVNLMQLIRAYSAYSNNGKMVTPKIVHS
FT                   FIDNYKRELLIPNEEQVQVIKSTTAQRMKDILIKTVNEGTGTKAKTEGLEVGGKTGTAH
FT                   IVEDGKYVNEYNTAFVGFANDEKSKYTIGVIVIKPKKSQFAAQTAVPVFKKIIDLLVEE
FT                   SYLKPNIIEQPSTPEASLN"
FT   gene            complement(365154..365453)
FT                   /locus_tag="Suden_0363"
FT                   /old_locus_tag="Tmden_0363"
FT   CDS_pept        complement(365154..365453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0363"
FT                   /old_locus_tag="Tmden_0363"
FT                   /product="Flagellar hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43644"
FT                   /db_xref="GOA:Q30TN7"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43644.1"
FT                   /translation="MSPIDGISGISSAELLKQKSKVEGAGGEDFANHLKSAINEVNELQ
FT                   QNSELALGDMATGQVKDLHQAALAIGKAETSMKLMLEIRNKALSAYKELSRTQL"
FT   gene            complement(365469..365963)
FT                   /locus_tag="Suden_0364"
FT                   /old_locus_tag="Tmden_0364"
FT   CDS_pept        complement(365469..365963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0364"
FT                   /old_locus_tag="Tmden_0364"
FT                   /product="Flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43645"
FT                   /db_xref="GOA:Q30TN6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43645.1"
FT                   /translation="MSNFLNSFDISGYGLSAQRVRVNTISQNIANAQTTRTDEGGPYRR
FT                   KEVVFKAIDFNQEFNKALNGMTESAKYEDPLDEGDFGKRVNPAIMSVVVDKISRDDKEP
FT                   QKKYDPAHPDADANGYVAYPNINPVIEMADLVEATRSYQANVAAFESSKSIANSAISLL
FT                   Q"
FT   gene            complement(365974..366405)
FT                   /locus_tag="Suden_0365"
FT                   /old_locus_tag="Tmden_0365"
FT   CDS_pept        complement(365974..366405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0365"
FT                   /old_locus_tag="Tmden_0365"
FT                   /product="Flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43646"
FT                   /db_xref="GOA:Q30TN5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43646.1"
FT                   /translation="MSIQVSATHALAAKALDYRAIRQDMISSNIANADTPFYRPRDVRF
FT                   EDTLAEQKAKILNLSIPKLSLAQTDSAHIPLKDEPDNSKAKTFFRDGHMARNDGNSVDL
FT                   DVETTEMSKNSIMFNALVGAMKKDSGIFKGVIDASSKLS"
FT   gene            366558..366956
FT                   /locus_tag="Suden_0366"
FT                   /old_locus_tag="Tmden_0366"
FT   CDS_pept        366558..366956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0366"
FT                   /old_locus_tag="Tmden_0366"
FT                   /product="N-terminal methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43647"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43647.1"
FT                   /translation="MKKAGFTMIELIFVIVILGILSAVALPKFIGVSQQAHDQKIRAFI
FT                   GTLNRTVGPSMWAVSIADGTHFGSVTTMCDTTKNLEVYLDKIPEEVTLNACKFNAVSAA
FT                   GGTFGINFQDGNATNAPTWIESNTTTGS"
FT   gene            367064..367501
FT                   /locus_tag="Suden_0367"
FT                   /old_locus_tag="Tmden_0367"
FT   CDS_pept        367064..367501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0367"
FT                   /old_locus_tag="Tmden_0367"
FT                   /product="N-terminal methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43648"
FT                   /db_xref="GOA:Q30TN3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43648.1"
FT                   /translation="MKLSSAFTLIELIFVIIVLSILASIALPKFANIKEMTDLAKGRAD
FT                   LATIRAAIANERSQQVIKGTYTYMLKLSSGTMLFNGDGTRTLLKYPMRAGTSSGEWYRD
FT                   NDTTYRFKIGAKTTLFTYNPANGMFNCNTSDSGTDCKALAN"
FT   gene            367533..369377
FT                   /locus_tag="Suden_0368"
FT                   /old_locus_tag="Tmden_0368"
FT   CDS_pept        367533..369377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0368"
FT                   /old_locus_tag="Tmden_0368"
FT                   /product="Primosomal protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43649"
FT                   /db_xref="GOA:Q30TN2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43649.1"
FT                   /translation="MHYYNIALINSPLEPFSYESSRMLEIGKKVKVKVKSRELFGVVIA
FT                   TCEKPEFKTSEILELCDSFYSQQQLQLANFISSYYFCSIGEALGVMLPYSDKEWINLST
FT                   CKSISKNIELSSKQQEALEFSKTHKVSLLFGDTGSGKTEIYMRYFQEMLLLEKRSIFLM
FT                   PEISLTPQMGKRLKVHFGDNVVMWHSKLTPLQKRKALESIYNGEAKIIAGPRSALFLPI
FT                   KDLGLIVVDEEHDDSYKSSSRPRYSARDIAIYMGKLYGVNVVLGSATPSVGSYVKFPHF
FT                   RLRGGYFTSQKKFIYERSAESLSPLVIDNLEKSLEKKEQAILFLPTRANFKYLICQDCG
FT                   YTHKCTFCSVGMSVHQKTRSLRCHYCNFAQAIPNICSECKSTNLTSSRLGTSEALSQLQ
FT                   EKFSEHKVGQLDRDVVTTSKKLSHVLKSFNDREIDILVGTQMLSKGHDYHGVTLAVVLG
FT                   LDNILNQSDYRAREKALSTLIQVAGRSGRKESAKVLVQTFNEEFFSAYIDRYEDFLEDE
FT                   KSFRAELYPPYKKLCRILFSHKNGIKAGDAMNEMQERLRSFANVEIVGYKKCAIERVAD
FT                   KYRFEILLRSDKSTDIIKAVLACRNSLAEIDMDPIEFG"
FT   gene            complement(369361..369930)
FT                   /locus_tag="Suden_0369"
FT                   /old_locus_tag="Tmden_0369"
FT   CDS_pept        complement(369361..369930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0369"
FT                   /old_locus_tag="Tmden_0369"
FT                   /product="Nucleoside diphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43650"
FT                   /db_xref="GOA:Q30TN1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43650.1"
FT                   /translation="MYKINSVQTLENPRFIKPILICYSILNIERKWEAVVTHDSVAILL
FT                   WHRTRDAFILVKQLRATVLNKNQNDGMMYELCAGIVDKATSLEQIAKEEVLEECGFNIT
FT                   VESLQKISSFYTSVGISGTHQTLYYAECDDSMKIDEGGGLEDENIEVVYIPTKEAKEFM
FT                   FNESYQKTTGVMLAFYWFFDNINQIQ"
FT   gene            complement(369899..371107)
FT                   /locus_tag="Suden_0370"
FT                   /old_locus_tag="Tmden_0370"
FT   CDS_pept        complement(369899..371107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0370"
FT                   /old_locus_tag="Tmden_0370"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43651"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR040653"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43651.1"
FT                   /translation="MAKFFIFLFLVTSLFGARVETFRWDNGETYLSFLEKNNLPLKTLY
FT                   YNLDEDEKQLSEEILTGVHFKISRNQDGTISQAFIPLNDELQIHIYKQSDEYFFETIPI
FT                   ISETKIEAFVIKIENSPYLDILRETGSNKLAKIFVSSFQNSLNFKRDLKKGDTLAMIYE
FT                   QKYRLGKPFSMPTLKASMIEMGGKKNYIYLNSDERYYNQDGNELQGFFLATPVKSARIS
FT                   STFTKRRFHPILKKYRAHLGVDYAAGRGTPIIAAGDGRVVFLGTTNGYGNLTKIQHSDG
FT                   YLSLYAHQNSFRKGLSNGSSVKKGQVIGYVGSTGLSTGPHLHFGLYKDGEAIDPLRVVQ
FT                   IATRKISAKERTAFLKLKSNYDESINLHVANDTKYIRNSMPENTCYFFDGGSCVQNKLS
FT                   PNS"
FT   gene            371221..372027
FT                   /locus_tag="Suden_0371"
FT                   /old_locus_tag="Tmden_0371"
FT   CDS_pept        371221..372027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0371"
FT                   /old_locus_tag="Tmden_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43652"
FT                   /db_xref="InterPro:IPR029276"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43652.1"
FT                   /translation="MKHIFLVFIAVLQLFGGVVKSQIVGVNKEFSEASIKVEKIDVGVS
FT                   GFVVHEISKGKKTILANAIVKSFDPSSKIAKIEVSEFTSLSSSALPNGKWSIKVGDEVV
FT                   LAFGYTRGVLIAPSEEIYYRITKNSVLGWVHPDLFAVMLSYNGHPTPLRSDFLQMSNDN
FT                   SVGLVFIFLQNRVYTLDAKSFKILTITDAALEQEEVKLPFYTRVEEINSPWWKWFDEGA
FT                   KKLDEYEPHYYELIIEANRDNKELYEIVKKGGEKLKDLLEEFEIKG"
FT   gene            372031..373416
FT                   /locus_tag="Suden_0372"
FT                   /old_locus_tag="Tmden_0372"
FT   CDS_pept        372031..373416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0372"
FT                   /old_locus_tag="Tmden_0372"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43653"
FT                   /db_xref="GOA:Q30TM8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43653.1"
FT                   /translation="MIDSKHLTHFSEIVGSENIYSDKAHLIAYSYDATREHFEPDAVIF
FT                   PRDEDDISKILKYCNEHKIVIVPRGAGSGFTGGALPSSGGIVLAFEKHMNKILEIDMKN
FT                   MVAVVQPGVINMDLQRAVEEVGLFYPPDPASQEYSSIGGNVSENAGGMRAAKYGITKDY
FT                   VMATRAVLPNGDIIKAGKRTIKDVAGYNISGILIASEGTLAVLSEITLRLIPKPKMTKT
FT                   AMGVFKTVNEAMNAVYKTMASGITPVAMEFLDNLTIRAVEQTYKKGLPVDAGALLVTDV
FT                   DGNLEDDLDFQLGEIQRVFMENGCYEFKIAKDKKEASDLWFARRNASPSLSVYGSKKLN
FT                   EDVTVPRSALPELLERFYAIADKYNVKIPCFGHTGDGNVHTNVMVDGKDPEQVKIAYQA
FT                   IEEVFQATIDLGGTLSGEHGIGLAKAPYMSMAFTPEEMALFKAIKMAFDPNNILNPAKM
FT                   GLS"
FT   gene            373423..374256
FT                   /locus_tag="Suden_0373"
FT                   /old_locus_tag="Tmden_0373"
FT   CDS_pept        373423..374256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0373"
FT                   /old_locus_tag="Tmden_0373"
FT                   /product="tRNA-processing RNAse BN"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43654"
FT                   /db_xref="GOA:Q30TM7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43654.1"
FT                   /translation="MIDIKGKFLKIYEYVKLFVTSFIDKDLTFYAASLSFYTIFTLIPL
FT                   LLITLTLFTSMPNFADSYEKLQEFIFSNIMPVNSEAVMGHINGFLQNSLEMSMISFVAV
FT                   IISSLLFFQNFEYIANKIFHVKKRGIWESITTFWTLLTLTPIGLGASFYITGYVASLMA
FT                   ENEYIPNINILPYIPYLIIWVLFFLIFQISANTKIDAKASLISSFITAIIFSIAKNGFI
FT                   YYIFYNKSYATMYGSFSIVMILFLWIYASWIVFIYGLKLCYLINRVYENRTTKEK"
FT   gene            complement(374203..375465)
FT                   /locus_tag="Suden_0374"
FT                   /old_locus_tag="Tmden_0374"
FT   CDS_pept        complement(374203..375465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0374"
FT                   /old_locus_tag="Tmden_0374"
FT                   /product="ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43655"
FT                   /db_xref="GOA:Q30TM6"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43655.1"
FT                   /translation="MIERVSLFTKKQDIFISLALAFFILTITLLFEYKNYYEFNRFDSI
FT                   TQEATVLKQYLKSKNNRAYQVLKLRSDDGVTFYTTAKKSLEDIREKKIKILIWPKELTF
FT                   LSYLSSFYANSKILNIYEQKTVKQQLNDYISDVHVDKSIANIYHALYSATPLEKESQSI
FT                   FSNLGISHLLAISGFHLGVLSALLYFFIRPIYSFFQNRFFPYTNAWRDTFFIVALILFA
FT                   YTLFLGSPPSLVRALGMLIVGFFLYERGIEVISMQTLFITILLLLAFFPRLFFSLGFWL
FT                   SSSGVFYIFLFFIYFKNLSKAWQFLLLPIWVYLLMLPYSLAIFENFSSLHPLSIIWTTL
FT                   FTLFYPLSIFAHLVGYGSIFDSSLLWLLDLGRTGEVVGIGIYTFLLYLLLSLGAIFYKK
FT                   VMWSLLLFSCAIFIYSIYQIA"
FT   gene            complement(375468..376919)
FT                   /locus_tag="Suden_0375"
FT                   /old_locus_tag="Tmden_0375"
FT   CDS_pept        complement(375468..376919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0375"
FT                   /old_locus_tag="Tmden_0375"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43656"
FT                   /db_xref="GOA:Q30TM5"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43656.1"
FT                   /translation="MQDNLYNLAFERSILSSIVFEPSQFDELSSQLKKDDFYLPAHQDI
FT                   FGVMTLLFQKDQPIDEEFIKKELIKIKKFDENVMLEILSANPISNTKAYVEEIRDKSLK
FT                   RHLLTLTTEIKRVTVEEELSSQEVIDIVEKKLYEITQNNQTSDFKDSPKMTFDTMTYIK
FT                   EMKARGNTVLVGVDTGFHELNKMTTGFGKGDLVIVAARPAMGKTSFILNTVNTLIMQGK
FT                   GVAFFSLEMPAEQLMLRLLSIQTAIPLQKLRVGDMSNDQWGSLNGAIDKMNSAKLYVDD
FT                   HGSININQLRSKLRKLKNQHPEIEIAVIDYLQIMSGVGNQDRHLQVSEISRGLKMLARE
FT                   LNMPIVALSQLNRGLESRNDKRPMLSDIRESGSIEQDADIILFVYRDDVYLYKEEKERE
FT                   KEAKAKGHEFVSTYVEREEEDAEIIIGKQRNGPTGHVKLIFQKKLTKFIDSHNHIKSIE
FT                   TVYENVDTRSAHISISNDTISMPPL"
FT   gene            complement(376919..377977)
FT                   /locus_tag="Suden_0376"
FT                   /old_locus_tag="Tmden_0376"
FT   CDS_pept        complement(376919..377977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0376"
FT                   /old_locus_tag="Tmden_0376"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43657"
FT                   /db_xref="GOA:Q30TM4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43657.1"
FT                   /translation="MINRVKTKQIFVGNVAVGGDSPISVQSMTFSKTSDVFSTVEQIKR
FT                   LHFAGCDIVRVAVPEMEDALALRAIKEQISLPLVADIHFNYRLALIAAEVVDCIRINPG
FT                   NIGSRERVKEVVKACQERNIPIRIGVNAGSLEKEFLNKYGQTSEGMVASAEYNIKFLED
FT                   LGFDDIKISLKASDVQRTVDAYRMLRPKNNYPFHLGVTEAGTLFHATVKSSIGLGALLL
FT                   DGIGDTMRVSITGELEEEINVARAILKDSGAAKDGLNIISCPTCGRIEADLVSAVGEIE
FT                   RRTTHIKAPLNVSVMGCVVNAIGEAAHADIAIAYGKGKGLVMVKGEVVANLDEHELVDR
FT                   FVQEVEKMAKEF"
FT   gene            complement(378139..380124)
FT                   /locus_tag="Suden_0377"
FT                   /old_locus_tag="Tmden_0377"
FT   CDS_pept        complement(378139..380124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0377"
FT                   /old_locus_tag="Tmden_0377"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43658"
FT                   /db_xref="GOA:Q30TM3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43658.1"
FT                   /translation="MLSKKIIPLSLVAVTILGANEVALPSVNVESTTITEVSQNAQVSA
FT                   DLAQALSSSVPSIDMNRRSGIANDIFIRGQKRDNISVEVDGTKVCGACPNRMDPPVSHI
FT                   LANQIDKVEVIEGPYDVETFGTMSGGLKITTKKPTKDMHGEVNFGLGSWGYKKLGVTGS
FT                   GGTDTIRALISASYETSDQYKDGNGDTLSEQVDKAITNGSAPAMTRFQTQYKDIEAYTK
FT                   KSIMSKVFVKTLEDQELRLSYTGNRSDDVLYANSKMDAAYDDSNIYSVEYNIDNVTNKY
FT                   KNINIQYYYSDVDHPMDTKYRVSGATSYMTNHLKTSMQGVKLKNSFDLDEYKILFGLDG
FT                   SRRTWEGRSYGTNATTGVVGASSVSLTHTQTDNRALFAKVEKSFGDLKIESGARFDSTT
FT                   IKPDDVTKQDNDYSALNANIIATYSLDAQNSIFLGVGSSARVPDARELYIGGLGTQNLK
FT                   QTKNREIDLGYEASYDSFMFKAKTFYSMLEDYIYLKHTSPTAYAFENIDAKVYGLELSG
FT                   SYFITDALTMDASASYKKGRKTSTPTQKDRDLSDIAPLRGNVALNYEYMNNSKATLEMQ
FT                   ASDRWDTIDSDNGEQELAGWSIYNAKVKHAINKYTDLSVGVNNIFDKTYKQSNSYVDLT
FT                   LLTLADNTMLLNEPGRYFYTNLTFKF"
FT   gene            complement(380345..381340)
FT                   /locus_tag="Suden_0378"
FT                   /old_locus_tag="Tmden_0378"
FT   CDS_pept        complement(380345..381340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0378"
FT                   /old_locus_tag="Tmden_0378"
FT                   /product="Porphyromonas-type peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43659"
FT                   /db_xref="GOA:Q30TM2"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43659.1"
FT                   /translation="MKRFIAEFEEQSFTQIIFPHVNSDWVEYLSEAEETFENIIKEIIK
FT                   YQKCLVVSADVQDVKRRFEPNKNLYFVEYETNDTWARDCSALCIENGSNVELLDFTFTG
FT                   WGGKFEASKDNVMSKEIAHSYSKKLKTIDLILEGGGVESNGVNTILTTSECMLNKNRNS
FT                   SLKKEQMTQILKDEFGMSKILYLNHGYLAGDDTDSHVDTLARFVDEKTIMYVKCEDKND
FT                   EHYKELKLMEDELKVFAKDEGFKLIALPMSEACYFDNERLPATYANFLFVNGAVLVPIY
FT                   GVKEDEEALKIFKDTFPTKDIVPINCFTLIKQHGSLHCVTMNFAKGVELI"
FT   gene            381357..382373
FT                   /locus_tag="Suden_0379"
FT                   /old_locus_tag="Tmden_0379"
FT   CDS_pept        381357..382373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0379"
FT                   /old_locus_tag="Tmden_0379"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43660"
FT                   /db_xref="GOA:Q30TM1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43660.1"
FT                   /translation="MATIILNKNNFFNNLDIIAKYSKSVDKIALVLKDNAYGHGLVEMS
FT                   SMAKEYGIKRAVVRTHREAEIAESFFSYILVLGDIPTMVSKTIRYTINDLESIDKFPKE
FT                   TRVELKIDSGMHRNGIAIDEIEEAFIKIKARGLLLEGLFTHHRSADELTSEWFWQKKNF
FT                   EDAKRIAKELAIKYGFAPLRFHSSNSAALFRNASFDEDMARVGIAAYGCMTLPKPLHVD
FT                   GFKPVLSLWAKKLSSRKLKSHQRVGYGGDGEILSDGVVSNYDFGYGEGFLRVCANGYKT
FT                   PEGIELIGRISMDNSSFLSSKDKLLIFDSALHVATYASTISYEVLTSLKPEIKREIF"
FT   gene            complement(382370..384340)
FT                   /locus_tag="Suden_0380"
FT                   /old_locus_tag="Tmden_0380"
FT   CDS_pept        complement(382370..384340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0380"
FT                   /old_locus_tag="Tmden_0380"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43661"
FT                   /db_xref="GOA:Q30TM0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43661.1"
FT                   /translation="MYSLNSKFLKIIPILFLIIGTGKIIYIYFETKEKEADFAKKEAEV
FT                   LNSYVIENRNYYQNLFLNGTIDINQKTLSALPAYSSYHISKAFSQNNPLKITLSTVSDR
FT                   ARNSKNSADRDELEAINFFKANSNEDYYFNSKNPNFYQYATVLKITPVCLKCHGAKNDA
FT                   PSYIQQSYENSYDYNLGEVRGIVSIKIPKKELSNYFFKGFFKSALYDLILFLLLFIAII
FT                   YLIRFSKKVNETLEKKIEQKTLEFKSSLFQDRLTKLPNRLKLIEDIELSMDKKHRHLAL
FT                   VNIDAFKDINDLYGYAIGDEILIQVSQRIRNFCTDLGSIYKLPNDEFAIFVTDKFDEDN
FT                   FHKTIKTLLETINETKFSIDEQSIFISFSCGISSNKDPLLIKANTALQAAKSTAKSVVI
FT                   YKDSLNAKEQITKNMDALLILKEAIAKNQITPYFQPIYNTRSKKIEKYEALARIVREDG
FT                   SVIAPFAFLDIAIKSKLYPEITKAMILKSFEFFKDKEYEFSINLSILDIQNQEVLKFIL
FT                   SKLREFPEPQRVVFEILESHKIENYQEMKSFIKEVKKYGSKIAIDDFGSGYSNFSQVFE
FT                   LNVDCLKIDASLVKYITTDESSRVIIKTIVNFASNLGLKTIAEFVEDRESLEILEKMGI
FT                   DFIQGYYIGKPSNKLCENFSV"
FT   gene            complement(384420..384812)
FT                   /locus_tag="Suden_0381"
FT                   /old_locus_tag="Tmden_0381"
FT   CDS_pept        complement(384420..384812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0381"
FT                   /old_locus_tag="Tmden_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43662"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43662.1"
FT                   /translation="MIFFGHRFIQSQSFYHINSIESIDNTPPSSTIYLEFSEKNLDIIS
FT                   FASSTLIPMALHVRNITELLYASSFGVLYIVVEKELAKTAQNIAENYLFDAKILVFVTS
FT                   EAEIEELGLLGVDGVIFPNAIIKITS"
FT   gene            complement(384809..385033)
FT                   /locus_tag="Suden_0382"
FT                   /old_locus_tag="Tmden_0382"
FT   CDS_pept        complement(384809..385033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0382"
FT                   /old_locus_tag="Tmden_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43663"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43663.1"
FT                   /translation="MILKILLVVGVIAFIYFKFIKKKPQVEKSANKKDEQKSNDMVECA
FT                   TCKIYCSLEDSLISGGKYYCSRECLESIK"
FT   gene            complement(385030..385611)
FT                   /locus_tag="Suden_0383"
FT                   /old_locus_tag="Tmden_0383"
FT   CDS_pept        complement(385030..385611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0383"
FT                   /old_locus_tag="Tmden_0383"
FT                   /product="Glucose inhibited division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43664"
FT                   /db_xref="GOA:Q30TL7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43664.1"
FT                   /translation="MNLKTALLELDTELPDTFFHHIQKFKEHLFKWNKIHNLTGAKDEN
FT                   TIDEFIYDAIYPITFLPKCKNLLDIGTGAGFPGLILAMGLPETEVTLVEPLAKRASFLQ
FT                   FIKADLGLSNVKVVQKRVQDMPSEIFEIVTSRAVIDTNMLLELSKGFRNKDSKLLFFKG
FT                   ERVYDEVNKDLKYKIIKRENRHYLLIGETL"
FT   gene            complement(385645..386208)
FT                   /locus_tag="Suden_0384"
FT                   /old_locus_tag="Tmden_0384"
FT   CDS_pept        complement(385645..386208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0384"
FT                   /old_locus_tag="Tmden_0384"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43665"
FT                   /db_xref="GOA:Q30TL6"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43665.1"
FT                   /translation="MNIEISEVANLPSRFGDFKVKVFKVGCKEHLVIFKEPIDEIPIVR
FT                   VHSECLTGDAMGSLKCDCRDQLEHALMLASKTNGMVIYLRQEGRNIGLLNKINAYALQD
FT                   QGLNTIEANHQLGFDADERTYEIVPFILEHFGIKRIKLLTNNPKKVLSLSGIDIVERVP
FT                   IIMKSNPHNEGYLNVKKESMGHLL"
FT   gene            386282..387253
FT                   /locus_tag="Suden_0385"
FT                   /old_locus_tag="Tmden_0385"
FT   CDS_pept        386282..387253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0385"
FT                   /old_locus_tag="Tmden_0385"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43666"
FT                   /db_xref="GOA:Q30TL5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43666.1"
FT                   /translation="MFQRFRRTRLNSHLRSLVRETNVSVDDFIYPLFVRSGEGIKTEVS
FT                   SMPGVFQMSIDEVLKECEDLKKLGLYSIILFGIPDVKDSIGSDSLCEHGIIAKAIRAIK
FT                   KAHPEMFVVTDLCFCEYTDHGHCGIIDEKKQTVNNDATLEISAQQAIVHAKAGADMIAP
FT                   SGMMDGIIITLREALDGAGYENLPIMSYSTKFASGYYGPFREVAESTPSFGDRASYQMD
FT                   PANRREAIAESISDEAQGADILMVKPALAYLDIVREIKDATSLPMAVYNVSGEYAMIKF
FT                   AGMQGLIDYDRVVMETMVSFKRAGADIIISYHAKEVARMLQK"
FT   gene            387342..388280
FT                   /locus_tag="Suden_0386"
FT                   /old_locus_tag="Tmden_0386"
FT   CDS_pept        387342..388280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0386"
FT                   /old_locus_tag="Tmden_0386"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43667"
FT                   /db_xref="GOA:Q30TL4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43667.1"
FT                   /translation="MGKLLRHFLTLRDFSKDEILEIINIGLEIKKSLKSAVCKHELKNQ
FT                   TLAMIFEKSSTRTRVSFETGMFQLGGHALFLSNRDIHLGRGEPVKDTARVISGMCDMIM
FT                   IRTFEHSRIEEFASYSKVPVINGLTDSYHPVQLLADYMTLVEYGMEKNIIAAYVGDGNN
FT                   MTHSWMMLAAKLGFELRVATPKGYEVDEKILQEALLIAKESGAVIKVTNDPSEAVKGAT
FT                   VVTTDTWTSMGQEEEKEARIRIFNGFMVDEKMMSQAASNAKFLHCLPAYRGLEVSEEVF
FT                   EKHSEIIFNEAENRLHAQKGLMVWLDKQRNI"
FT   gene            complement(388310..388564)
FT                   /locus_tag="Suden_0387"
FT                   /old_locus_tag="Tmden_0387"
FT   CDS_pept        complement(388310..388564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0387"
FT                   /old_locus_tag="Tmden_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43668"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43668.1"
FT                   /translation="MMYSIAFDKDAEREFLKLERQIQLLVSSKILDLQSGNFTNDKQLK
FT                   GKHKGKFRKRAGNYHIIYLKENNLLVISIIRIAHRKEAY"
FT   gene            complement(389163..389792)
FT                   /locus_tag="Suden_0388"
FT                   /old_locus_tag="Tmden_0388"
FT   CDS_pept        complement(389163..389792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0388"
FT                   /old_locus_tag="Tmden_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43669"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43669.1"
FT                   /translation="MTINNTANAYTTYSTTKQLFSQENSATALSGFNNTTDIVTISDEA
FT                   KAIAKEQEIKTRLDAIKIKPAVERTREEIEFVNSNDKRLSQISSKDYQTLTAEELDYQQ
FT                   KAGGFVNTMATLTSSEKALYNELVAKGDYEAASGMNLIALSRTGMEGQEVQLPNGQSFN
FT                   PMNTEITAGNIRNFFQHMFVDPTGEMNRRFEALATYLEQSPTNKQS"
FT   gene            complement(389848..390807)
FT                   /locus_tag="Suden_0389"
FT                   /old_locus_tag="Tmden_0389"
FT   CDS_pept        complement(389848..390807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0389"
FT                   /old_locus_tag="Tmden_0389"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43670"
FT                   /db_xref="GOA:Q30TL1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43670.1"
FT                   /translation="MRVLTGIQPSGDLHIGNYFGSIKQMVDAQESSQTFAFIANYHAMT
FT                   SGGKDLARLTMQCATDFLALGIDPKKSIFWVQSDVKEVLELYWILSSFTPMGLLERAHS
FT                   YKDKTAKGIGANHSLFSYPVLMAADILIFGSEVVPVGKDQIQHVEIARDIAIRFNNQYG
FT                   DILTIPEFRVQEEVQTVLGTDGQKMSKSYGNIINIFGEEKAQLKTIKKIVTENVAVEEP
FT                   KEFESCNVYNMAKLFLEGDNLIALQDRYKKGGEGHGHFKMYLAEVIWEYFKDFRQKREY
FT                   FEAHQDEVRGILKVGADKAREIALPTIEKIRSATGISY"
FT   gene            390950..391279
FT                   /locus_tag="Suden_0390"
FT                   /old_locus_tag="Tmden_0390"
FT   CDS_pept        390950..391279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0390"
FT                   /old_locus_tag="Tmden_0390"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43671"
FT                   /db_xref="GOA:Q30TL0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43671.1"
FT                   /translation="MNVQVHAKDITLSANAKGHIETAIAAFKKYSLDITTVNVNLKKEK
FT                   KGVLVEFDIHIAHSEPVVINQADEDLDTAIDLAIDRASKALRRLHDRVVSHKATSLKEI
FT                   EVVEE"
FT   gene            391281..391703
FT                   /locus_tag="Suden_0391"
FT                   /old_locus_tag="Tmden_0391"
FT   CDS_pept        391281..391703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0391"
FT                   /old_locus_tag="Tmden_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43672"
FT                   /db_xref="GOA:Q30TK9"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43672.1"
FT                   /translation="MYSWIVWFHILSFISWYAVLFYLPRLFVYHAENADNEGFVKVVKV
FT                   MEMKIYKYIGVPAMWATLLSGTYLAIELGFSGNAWLHAKILFVVILVAYFFSLGYFREK
FT                   FLNDECKKSGKFFRAYNEVPTILLLVIVAMVIIKPF"
FT   gene            complement(391778..393262)
FT                   /locus_tag="Suden_0392"
FT                   /old_locus_tag="Tmden_0392"
FT   CDS_pept        complement(391778..393262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0392"
FT                   /old_locus_tag="Tmden_0392"
FT                   /product="GTPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43673"
FT                   /db_xref="GOA:Q30TK8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43673.1"
FT                   /translation="MKKIAIIGRPNVGKSSLFNRLMKKRDAITSDVAGTTRDVKRRHVV
FT                   IINKEALLLDTGGLDQGCELFDKIKEKSLEAAKKADIILYMVDGKSIPEDADKKLFYEL
FT                   QTLGKEVALVVNKIDNDKLKDNLWDFYEFGTDAIFGISVSHNRSVNALLEWIYDRLPEE
FT                   DIIKDEDEEDDVNIVEEDDEEFEFDDKEYNEEEEDDNFFYPEDDEDEEFEDDSIFAQND
FT                   RIKEFDETDANHIKISIIGRTNVGKSSLLNALLGEERSVVSSVAGTTIDPIDESMEYKD
FT                   KQLTFVDTAGLRRRGKIVGIEKFALMRTKEMLENSNMALVVLDASEPFLDLDEKIAGLV
FT                   DSNRLACIIVLNKWDIANRDEYDKIIQEVRDRFKFLAYAPIVTLSAKSHRRVDKLFDMI
FT                   LEIDKNYSQHIKTSELNVVLEKALRRHQLPSMRGQIIRIYYATQYETRPPKIAIVMNKP
FT                   RGLHFTYRRYLTNKLREAFSFSGTPVLFKAKKRGEK"
FT   gene            complement(393323..394012)
FT                   /locus_tag="Suden_0393"
FT                   /old_locus_tag="Tmden_0393"
FT   CDS_pept        complement(393323..394012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0393"
FT                   /old_locus_tag="Tmden_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43674"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43674.1"
FT                   /translation="MRSVILGLVVVLLLFLTGCSQKEVAIVEPEAQIITLPIIEVKPQE
FT                   DKELIIRRVIVENALKHLNKSSGQDCSGFVDLVNSDTNESFYKAEMLYKYYDNSRRSRA
FT                   IFNMMQDEDKLVSEPLPKVGDIVFFSDTLQKTKRRVGSLNITHMGIVTAVDEDETVHFI
FT                   HNIQGKNKIDQLNRKYSDHHMLSDKHVNSFLKRCSKNRQKSKCLTSFFFSSYASPVPKE
FT                   KIELSKN"
FT   gene            complement(394009..394587)
FT                   /locus_tag="Suden_0394"
FT                   /old_locus_tag="Tmden_0394"
FT   CDS_pept        complement(394009..394587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0394"
FT                   /old_locus_tag="Tmden_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43675"
FT                   /db_xref="InterPro:IPR024952"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43675.1"
FT                   /translation="MIKTISNITLTILLSVIIIGCSKDVEPEKRSVDFSCKQENVDAPK
FT                   WTCIPEVPGHYSGVGIAEKSAAGMDHMRRVAMANGRSDLAQQIQTLVKDKVSLYTGTTG
FT                   IASSETVDKTTESVTKQVAKVNLNGSKAIDMWSAPSGALYMLVTVSKESTNEQIRNNIK
FT                   TSFNNDNALWQQFKAKNALEELEKEFSGE"
FT   gene            394727..395185
FT                   /locus_tag="Suden_0395"
FT                   /old_locus_tag="Tmden_0395"
FT   CDS_pept        394727..395185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0395"
FT                   /old_locus_tag="Tmden_0395"
FT                   /product="Phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43676"
FT                   /db_xref="GOA:Q30TK5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43676.1"
FT                   /translation="MKYYNYETFKNDTNKLLLLLREHDFEAIVTVARGGFTLAHAVSQG
FT                   LNIRDVQSIRTELYDKDKKREKIKLFQKCDFRNLKRVLLLDDISDSGETLSAVMGYLKE
FT                   EFKEIEFKSATLFYKKTSMYEPDFWINEVDDWIDFFWERDFLEDKTIS"
FT   gene            complement(395175..395483)
FT                   /locus_tag="Suden_0396"
FT                   /old_locus_tag="Tmden_0396"
FT   CDS_pept        complement(395175..395483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0396"
FT                   /old_locus_tag="Tmden_0396"
FT                   /product="C-type cytochrome, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43677"
FT                   /db_xref="GOA:Q30TK4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43677.1"
FT                   /translation="MGSLLFHGNCVTCHHETKTISAPSATEFRQRYRDAFSSKEEFVSY
FT                   MSSWVKKPSHEGSLMHDAIKKHELMPELGFDEDALKIICAYIYDTNFVEEEKTHPKR"
FT   gene            complement(395541..396293)
FT                   /locus_tag="Suden_0397"
FT                   /old_locus_tag="Tmden_0397"
FT   CDS_pept        complement(395541..396293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0397"
FT                   /old_locus_tag="Tmden_0397"
FT                   /product="Heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43678"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43678.1"
FT                   /translation="MGNIIIFAILGWFFYWIFKSYSKYSAYSKESFKNFSISKESLQRS
FT                   ELGLFIALVAKVAKADGKVDALEAELIGIMFDDISAIFPEPQKTKDILKEIFNEEKDKK
FT                   ENLHSIAQTLSHAIKRDRAKQQQFMGFLIQLAFVDGELSKSEEEILSQIAEALEFDPNI
FT                   YHAMFDKFEQMMKNITPKANISDAYKLLGVSEGDDMDTIKKAYRKLVREFHPDIIKSQG
FT                   KNEAYMQEATAKTQEINQAYEMIKERRK"
FT   gene            complement(396369..397160)
FT                   /locus_tag="Suden_0398"
FT                   /old_locus_tag="Tmden_0398"
FT   CDS_pept        complement(396369..397160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0398"
FT                   /old_locus_tag="Tmden_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43679"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43679.1"
FT                   /translation="MEIRFFLIFFLVVSTLFAKEISSRYEIEVTLFKKVGYADIIFKED
FT                   GKNYETTLTVTAVGMAATLLRNRFETFTSRGKIVDGRYVPDIFIKTKEDNKRSRTQTYY
FT                   FDHHKNEIKLIEEKTKLVNKASFNSSNLCITYRDVNESSREEKIEEQYFKNDSLTIYLN
FT                   AIKNCNARSREYPLYAIGAHNDENSVLLSYLDKKKDTKINSLQDSDYLYNLNVEPFDKS
FT                   DTIVDVLIALDSDGTLKEAFMGEVFWIGKITAKRIYHNVIQ"
FT   gene            complement(397177..398163)
FT                   /locus_tag="Suden_0399"
FT                   /old_locus_tag="Tmden_0399"
FT   CDS_pept        complement(397177..398163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0399"
FT                   /old_locus_tag="Tmden_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43680"
FT                   /db_xref="GOA:Q30TK1"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43680.1"
FT                   /translation="MLFRIIIFLFCFFYANAQTLQQKLDEKQEKISNYVIEVFDDIDKK
FT                   IAYWVHSEDGNITTQSQTKNSVDEFFKGEKYIKETNKSYLQFRLKSLLQSKGDSSITPY
FT                   IKAQIPLQRSQKNFQIFFSEIKKDALSQSVSQIEDEKSAQVGVSYFTPMQYDIKSKYSV
FT                   GLRSLSTYASARYSKEFEFNKWLIEPTQEFKYSTKYNFSEETNIYFDRALDESSLFRTT
FT                   LHRKTQENTRGYDYALSLSYYLTPSYKKGFGVSQIFWGNSKYSCDMYPEEYSGISNYAT
FT                   QFSWRQNILRKWIAYEVQPIVSFHREHNYEANYMLRFYLDFYFGNID"
FT   gene            398227..399114
FT                   /locus_tag="Suden_0400"
FT                   /old_locus_tag="Tmden_0400"
FT   CDS_pept        398227..399114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0400"
FT                   /old_locus_tag="Tmden_0400"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43681"
FT                   /db_xref="GOA:Q30TK0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43681.1"
FT                   /translation="MKHIKELNSGVKYMLIASLLFAVMGAFAKLASEHMSSLEVVFFRN
FT                   IFGVIFIGYALYKSPMKSRGGKPYLLFFRGLMGFLSLLAYFYNIANISLGDAVTYSKTA
FT                   PIFTAIFAWFFLNEKLSLNAWIAVFIGFCGIVLIAQPSGIGFSKYDMLGIFSGVGAALA
FT                   YTSIRELKEYYDTRMIVLSFTFVGTVAPILLFIISKYFYISALDFMLGEFVLPSGVVWV
FT                   YIVGLGTLGTLSQYFMTKAYGETKAGIVGAVSYTNIVFAIFIGVVLGDAYPSVVSACGI
FT                   ALIVSAGIMVAKSK"
FT   gene            399171..399962
FT                   /locus_tag="Suden_0401"
FT                   /old_locus_tag="Tmden_0401"
FT   CDS_pept        399171..399962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0401"
FT                   /old_locus_tag="Tmden_0401"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43682"
FT                   /db_xref="GOA:Q30TJ9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43682.1"
FT                   /translation="MKLLAGPCVIESEENIFKIAKSLETYQNDKTIDFYFKSSFDKANR
FT                   TSLDSFRGLGIDEGLRILQKVKDDFGYKVVTDVHESCQVAQVAEVVDMLQIPAFLCRQT
FT                   DLLVACAKTNREVNIKKGQFINPPDMRYSVAKVLKTRGCDEVSYEASKKHGVFLCERGS
FT                   SFGYGNIIVDMRSLVIMREFAPTIFDATHSVQAPGALGGKTGGDRTMVPYLSSAAAAVG
FT                   VDGFFFETHFDPSIALSDGPNMIKLDELETIINKIKKIQEI"
FT   gene            399966..400430
FT                   /locus_tag="Suden_0402"
FT                   /old_locus_tag="Tmden_0402"
FT   CDS_pept        399966..400430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0402"
FT                   /old_locus_tag="Tmden_0402"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43683"
FT                   /db_xref="GOA:Q30TJ8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43683.1"
FT                   /translation="MKLIEGQLKVVNGKKVAIVSTRWNHFIVDRLVEGAKDAFARHGGD
FT                   EADLTHVLVPGAFELPMIIDKLLASGKYDAICALGAVIRGATPHFDYVSAEATKGIAMM
FT                   SLKHQKPVSFGLLTTDNIEQSIERAGTKAGNKGFEAMTVVIEMLDLYENL"
FT   gene            400433..400831
FT                   /locus_tag="Suden_0403"
FT                   /old_locus_tag="Tmden_0403"
FT   CDS_pept        400433..400831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0403"
FT                   /old_locus_tag="Tmden_0403"
FT                   /product="NusB antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43684"
FT                   /db_xref="GOA:Q30TJ7"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43684.1"
FT                   /translation="MATRHQARMAVVSLLYAFDLGNGNIAEHTDEILEEKKIRNKQKDF
FT                   ALTLYEGVMANITPVDEAIVKHLKDWDFERLGAIERATLRLATYEILFGELDSAVVINE
FT                   AVEITKAFGTEQSPKFINGVLDAISKDK"
FT   gene            400834..401883
FT                   /locus_tag="Suden_0404"
FT                   /old_locus_tag="Tmden_0404"
FT   CDS_pept        400834..401883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0404"
FT                   /old_locus_tag="Tmden_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43685"
FT                   /db_xref="GOA:Q30TJ6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43685.1"
FT                   /translation="MKRLTKQEALELIKSADFKELGRMATARKKELHPEGITTFVVDRN
FT                   INYTNICWVDCKFCAFYRHEKDADAYVLTFDEIDKKIDELLEIGGTQILFQGGVHPKLK
FT                   IEWYEDLVEHIHTKYPTITIHGFSSIEIDFIAKVSHISVEEVLERLHVKGLASIPGAGA
FT                   EILSDKVRDIIAPKKIDSEVWVDVHRKAHKLGIMSTATMMYGTVESDEDIIEHFDMIRR
FT                   LQDETHGFRAFIMWSFQGQNTELLRLIPDMEKPSSNRYLRLLAVARLYLDNVPNIQSSW
FT                   VTQGPYIGQMALRFGANDLGSTMMEENVVSSAGAAYTMAKSEMVHLIKDIGEIPAVRNT
FT                   AYEILEKFA"
FT   gene            401884..403167
FT                   /locus_tag="Suden_0405"
FT                   /old_locus_tag="Tmden_0405"
FT   CDS_pept        401884..403167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0405"
FT                   /old_locus_tag="Tmden_0405"
FT                   /product="Peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43686"
FT                   /db_xref="GOA:Q30TJ5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43686.1"
FT                   /translation="MKRIILTLLILGNIIMAATIDEIKAKDVNVPLIFEQDTRLPLITM
FT                   QLVFKNSGSISDKTKAGLSKFSAKMINEGTKELGSSAFAEALESRAIHISATSGKETFV
FT                   IELGCLKEEFDEGLKYLQMLLRDPNLTPEVIKKIKTATLGSLANKESDFDYIASNELKK
FT                   LLFEGSVLAQPSLGSIESVKSIELDDVQNFIKENIVSSKLIVVVGGDTDVEEVKSKALK
FT                   IINSLSIGSDSKVEKCEIVAEPRESVIKKDTQQAYVYFGSPYNISIDSDDYYKARVATF
FT                   ILGAGGFGSRLMEEIRVKRGLAYSAYARIDVSKSSSSMNGHLQTKLESLEEAKKSVKAI
FT                   VEDFVKNGVKKSELEQTKKFLLGSEPLRVETMSQRLNRTFMEYYNGQKLGHSDEELERI
FT                   KNLELKDLNKFIKEHREILDMSFAIVTK"
FT   gene            403259..405073
FT                   /locus_tag="Suden_0406"
FT                   /old_locus_tag="Tmden_0406"
FT   CDS_pept        403259..405073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0406"
FT                   /old_locus_tag="Tmden_0406"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43687"
FT                   /db_xref="GOA:Q30TJ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43687.1"
FT                   /translation="MNVTKEQKEKFKKLGISSCSELSLIIPSLYEDLRLSNKLSPHSMQ
FT                   LIDATVEAIYRAPNSLQITFFVHNFSHTVTGVIFRPKPYLLHQFKVGQRDYYYGMMECK
FT                   GGTCSINMPKKITIIGAITPKYKSALRSDVMLRFVQNLLTKENLLLDGLREDVACELLK
FT                   LHFPQSVIPNIKELDEKILRALKYTELFVYMRELAKKRRYYPSLSLTCKSYDEWLQTLP
FT                   FRLTNEQIKAIEDIRADFQKGLSARRMIVGDVGSGKTMVILASALMNSPNRSILMAPTT
FT                   ILANQIYEEAKKYLPMMNIALVSSKNKNMDLSEYDFIIGTHALLYRELPIATLVMVDEQ
FT                   HRFGTAQRNLLEKLVSSQNSSSKISDAKSHFLQFSATPIPRTQAMIEMAHIDVSLITST
FT                   PFKKEIKSRVIHKSDFKELLEHIKVEIALGNQVLLVYPLVEQSEVLEYQSIDEARSFWE
FT                   ARFTNVHVTHGKDKDKEEVLREFDKQGDILIATTVVEVGISLSRLSTVVIVGAERLGLS
FT                   TLHQLRGRVSRTGLKGYCFLYTNQNKSERLDKFVDTTSGFDIANLDLKFRKSGDLLRGH
FT                   NQSGNQFRWVDLAEDEEIVKLVKDDLLK"
FT   gene            complement(405128..405670)
FT                   /locus_tag="Suden_0407"
FT                   /old_locus_tag="Tmden_0407"
FT   CDS_pept        complement(405128..405670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0407"
FT                   /old_locus_tag="Tmden_0407"
FT                   /product="SSU ribosomal protein S30P / sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43688"
FT                   /db_xref="GOA:Q30TJ3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43688.1"
FT                   /translation="MNISLTGRHVELTDAIKAHMNASIQTLSKYNLDIISVNVIASTQT
FT                   KKGKDHSVVEFVINLAHKNSIVIEQNDQDLYAAIDLATTRAQKAMRRIHDRDSGHHKDG
FT                   INEAKIQANTTINLNEASEAMEDEIVPVELALYKPREVEDVLNDIKENKKLFEIFIDND
FT                   GKTRVLYKRNDGKFGLY"
FT   gene            complement(405736..406155)
FT                   /locus_tag="Suden_0408"
FT                   /old_locus_tag="Tmden_0408"
FT   CDS_pept        complement(405736..406155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0408"
FT                   /old_locus_tag="Tmden_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43689"
FT                   /db_xref="GOA:Q30TJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43689.1"
FT                   /translation="MKRSGFAMIMAIVIIIIIATTMTLSLSLSTQTNKRTLDIYLHEQV
FT                   ELYAKSATELAMLYIAKNGCTDDNFNTTLNEIYTINVVMRYVYPAQAPTGCTSYFNTSS
FT                   LEQGASVLMDVTVSVNNPNIVSEPIRYFRRTIQKL"
FT   gene            complement(406182..407084)
FT                   /locus_tag="Suden_0409"
FT                   /old_locus_tag="Tmden_0409"
FT   CDS_pept        complement(406182..407084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0409"
FT                   /old_locus_tag="Tmden_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43690"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43690.1"
FT                   /translation="MSRAAFTMLELLFVILIMGLLANYGVELLSKAYKNFIFTSINNSL
FT                   QANSAMAVENIAARLQYRIKDSVIARGTDGTFQGLEANSDSTAPILEWVGYDAEGFRGN
FT                   TTPMPHWSGIIDIGLSTSTALVSPATDTAKVETLINTLSNGTSGVSSAALYFIGSDSDI
FT                   QTGYGWNGAISTQNKAMHPIRRDVAAPQNFIPINGATGADNNFTGVDVYEYYQLAWSAY
FT                   AVGISDYNVITKTGTLMLYYNYQPWRGQTYLRDATAVMLMQNVSTFRFMAAGSVLKIEV
FT                   CVKADLMEDYSLCKEKTLF"
FT   gene            complement(407084..407710)
FT                   /locus_tag="Suden_0410"
FT                   /old_locus_tag="Tmden_0410"
FT   CDS_pept        complement(407084..407710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0410"
FT                   /old_locus_tag="Tmden_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43691"
FT                   /db_xref="GOA:Q30TJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43691.1"
FT                   /translation="MVKTKKVLNKAAFTLMELIFAIIIISIAIVSLPLMIQINADGVEK
FT                   SIVQEAIFAASAELMGATSYYWDARSIEESAISHLSRVIDVGGDCNPITRQRVGHVGRR
FT                   CLDSSVAAGVNYYSANATLGLNSTVHTAQNMFDNSAAQAAGYKQQYQSIMEINIATFTD
FT                   IAALNNDVKELTLSVIDPNDATKTLTSLRIYCANIGEVEYYKRRF"
FT   gene            complement(407704..409677)
FT                   /locus_tag="Suden_0411"
FT                   /old_locus_tag="Tmden_0411"
FT   CDS_pept        complement(407704..409677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0411"
FT                   /old_locus_tag="Tmden_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43692"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43692.1"
FT                   /translation="MKYVEKISKFIALFIMAGLFTLPSLGATFREIQASRHVDYNNSFG
FT                   IYTPVIGNYNSVRAGAVDVDYGDSDPLEPEHAKNALYTQIVAKAFNVDIISFDNDNKTP
FT                   IAWSGDLTLSIVELSSSGDCSESTSLLSDLVVLNFSNEKYKSVTVTPTKASRNALFKMQ
FT                   TATASICSRDTFAIRPATFNIDSNEAGLLVGNHLYNFTFTAAHEGAPNTPSSNYTQEIG
FT                   NSIDKLASMQLKVPAGCTLPIHVEDINLSVPFVDGEVSVEVLYPNVGSVEFKLSDNEWT
FT                   VVSADQSKGDCIDGSAQNSSDDSGRVGCLIQGSKSFHFFPEKFTSTLSLENGSNDKSFT
FT                   YLSNQREMSAPLKLNITATLYGGGVATNYTAGCFSRNIYTTLSLIVDKTLSNGTSQTRI
FT                   NFFDDLDVTSHLNNQILNSATFLTTENKFINGSSNVKVSINFQRNQTAAENPFTIAKND
FT                   FNITQVIDTNGVQGSDFNRTNDVNATFVYGRTNASRQRYGCAGLSCHENNANIYFESFC
FT                   FGATCNRALLPNGASSRKINDARWYINDNHTSATDGNVTIVVQKDGTNIDANDTVDADD
FT                   NPTGNPSTTRIRYDMSKGYPYKTTIQNEASPWLIYNESDPAATRNEFQVEFNNAGVWSG
FT                   KYDTETTTKNSSAKDTNRRIIW"
FT   gene            complement(409777..410157)
FT                   /locus_tag="Suden_0412"
FT                   /old_locus_tag="Tmden_0412"
FT   CDS_pept        complement(409777..410157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0412"
FT                   /old_locus_tag="Tmden_0412"
FT                   /product="Protein of unknown function DUF180"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43693"
FT                   /db_xref="GOA:Q30TI8"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43693.1"
FT                   /translation="MKFDVCVPILGFENVKEVTLEKIDDAFMRMESSNDEHISFTLINP
FT                   FALREYDFEIPDATQKLLEIDEKSNILILNIAIIQTPVEDTVVNFIGPMIFNTDNNKAA
FT                   QLVLSESTKYGVAEKISLYLKK"
FT   gene            410278..411138
FT                   /locus_tag="Suden_0413"
FT                   /old_locus_tag="Tmden_0413"
FT   CDS_pept        410278..411138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0413"
FT                   /old_locus_tag="Tmden_0413"
FT                   /product="DNA uptake lipoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43694"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43694.1"
FT                   /translation="MKLKNYALSALASLILLFGGCSKNIEEYNKPAMYWYTKIVEHVSN
FT                   GDLESADNYYSSLQGEHIGSPLLPEATMMLSIAHMQEEEYLLSEHFLDEYIKRYATPNE
FT                   KENAEFLKIKAKYKALPNPRRDQVLIEEAIAQGELFKQAYPDSMYYEVVNTMLTRLYLA
FT                   QFVLNEEISDLYDRLDKPKSALYYRGVNPQPWILLDEIDRANSPWYRSWFEGDGTSSWY
FT                   DFMIPDTKSVVSRNSISEEDGAEKNESKVEKTEPKEDKNSSWYDMFNPFSTIYDLKKET
FT                   NNYEA"
FT   gene            411128..413539
FT                   /locus_tag="Suden_0414"
FT                   /old_locus_tag="Tmden_0414"
FT   CDS_pept        411128..413539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0414"
FT                   /old_locus_tag="Tmden_0414"
FT                   /product="Lon-A peptidase. Serine peptidase. MEROPS family
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43695"
FT                   /db_xref="GOA:Q30TI6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43695.1"
FT                   /translation="MKLSDYSNFPADIPVIAEDEIFLYPFMIAPLFLSDESNIKAATKA
FT                   IEEGSLVIVCPTKPSHEGERVFEALYDAGVVGSIMRKVALPDGRVKVLFQGLARAKTFG
FT                   KVSENPLIANVDVIKAQSVNALKIDAILEILREKVRKLAAVSNYFPPDLLRTIEENHDY
FT                   NRIIDLICSTVKLKKEQAYTLFVETNTEKRFLDLIEHIIDEIEANKLQKEIRSKVHTHI
FT                   EKVNKEYFLKEQLKQIQKELGSDTSRDEELEEYRKKLEAKKDKMNADAYKEVHKQIERF
FT                   SRMHPDSSDASMTQTYLDWALEIPFGEESKKKLKISEVEAQLDKDHFSLEKPKERIAEF
FT                   FAVKELMELRGIKSASGAIICFNGPPGVGKTSLANSIAEALKRPLIRIALGGLEDVNEL
FT                   RGHRRTYVGAMPGRIVQGLIDAKKMNPVVVLDEIDKVAKTGRGDPTAALLEILDPEQNN
FT                   EFRDYYLNFNIDLSKVIFIATANDIGNIPAPLRDRMEFIAISSYTPQEKLEIASRYLLP
FT                   QELKKHGLKKSEVTISRAALKELIHSYTREAGVRNLRRRISNMSRKVAREILEHPEITK
FT                   VSLSVKNLKDYFDKTVFEIEKTTKVPVVGVVNGLAWTAVGGDVLKIESIRIKGKGTMQL
FT                   TGSLGEVMKESAIIAYSVVKTLIDTKKLKIDDINIPLTPKEIEEKIEVDSSEVYKRYDL
FT                   HIHVPDGATPKDGPSAGIALVSAISSILSGRKVRSEVAMTGEVSLSGDVLPIGGLREKL
FT                   IAAHKADMSKVLIPMKNYERDLEDIPSEVRESLKIVGVTRIEEVLSHILV"
FT   gene            complement(413536..413910)
FT                   /locus_tag="Suden_0415"
FT                   /old_locus_tag="Tmden_0415"
FT   CDS_pept        complement(413536..413910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0415"
FT                   /old_locus_tag="Tmden_0415"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43696"
FT                   /db_xref="GOA:Q30TI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43696.1"
FT                   /translation="MSKELVILTVDDDLINLKLLKSMLMKNPDIKEIIEAQNGADAVAH
FT                   IKSRDDISLVLLDIIMPIMNGLEVLRVVRSDKNIEQIPIIVLTTDETKKTEALELGANS
FT                   FLVKPIRSNELSEKMRALLV"
FT   gene            complement(414019..416709)
FT                   /locus_tag="Suden_0416"
FT                   /old_locus_tag="Tmden_0416"
FT   CDS_pept        complement(414019..416709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0416"
FT                   /old_locus_tag="Tmden_0416"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43697"
FT                   /db_xref="GOA:Q30TI4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43697.1"
FT                   /translation="MTSYYVYSSFLGFNAAQQLQERLDQNKHLNEALSNIARERGMSAM
FT                   YLGNKTRNIHKSLIEQRKIVDEKVEDYLKYARNNKRLHTHTSKSNKEECLACSNVDSVI
FT                   SAIVKIKSVRPLVDAHAIEFKEMFIDAYGKAQIAFIKQLEQITENQIDKEVNQLYSLYI
FT                   AMVNAKEASGIERGYMAYIISRSSELQRDDLNEWISLIGKADSINYGGIQNKNLISSLD
FT                   ALFKNEDSLELFGDINSERAAIISISHSGEYDITSGVWFTMLSEKINIIAQAEDLLLNA
FT                   MNTRAQKVQEESLQVLIITFSVWLIAIILAVLGFVLSNQIAKNIRNLESVLEKVAGDYD
FT                   SKERKINLHTAEGTDLAYELLEDIIEQTKMDKISAQEASEAKSMFLANMSHEIRTPLNG
FT                   IVGFTELLKDSGLQQEQSEFVDIIEKSSENLLEIINNILDLSKIESNKLEIENILFNPI
FT                   VEFESAVEVYAVRASEKHINLGCFIDPSLEFWLKGDPTKLKEIIINLLSNAVKFTNNAG
FT                   FINVNIRKIDSDKSTKTRVRFEIQDSGIGVTSEQKSKIFEAFSQADTSITRKYGGTGLG
FT                   LTISSNFVELMGGKLDLESKLAEGTTFFFTLDFEKAETLHETSKNSFNALSALILSDSE
FT                   KIKKQDKYLREYLEYYGVGFKTFNAIEKLELLLKDSDYNLLFVDYDYTSEETLRELSKL
FT                   PQELVVLTKSNLMKRVDSLGLNIFKILYEPIHASKIRQILENYTLLNAKIEVAKKSSCK
FT                   NFDLSKSKFIADVLVAEDNTINQKLIQRTLEDLGLNVTIANNGLDAFQKRKDGKFDLIF
FT                   MDIQMPFLDGVEATAEILEWEADYKQPHVPIVALTANALKGDREKFILAGLDEYTTKPL
FT                   VRAEIITILNMFLADFIVEVNETKS"
FT   gene            complement(416781..417164)
FT                   /locus_tag="Suden_0417"
FT                   /old_locus_tag="Tmden_0417"
FT   CDS_pept        complement(416781..417164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0417"
FT                   /old_locus_tag="Tmden_0417"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43698"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43698.1"
FT                   /translation="MNKIVPNDKEYIFQGKVAICQTDLEGNITFVNRKFCEISGYSVDE
FT                   LNKKNINMLKHPDTNPSIYEKMCSTLKGALVYNDMLKIIRKDGSYYWVDIEVTNIVDKQ
FT                   ERISGYISISKPSARKNIQYEMN"
FT   gene            complement(417232..419034)
FT                   /locus_tag="Suden_0418"
FT                   /old_locus_tag="Tmden_0418"
FT   CDS_pept        complement(417232..419034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0418"
FT                   /old_locus_tag="Tmden_0418"
FT                   /product="Excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43699"
FT                   /db_xref="GOA:Q30TI2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43699.1"
FT                   /translation="MTLRECIKQLPDSAGVYQYFDKDGHLLYIGKAKSLAKRVKSYFNF
FT                   APKFKPNSNLSSRISKMISQTHTLQYIVVNSEHDALILENSLIKQLMPKYNILLRDDKT
FT                   YPYIYIDNSQKYPRFEMTRKIIKSSNIKYYGPFSVGARDILDSIYELCALVQKKGSLTS
FT                   KKLCLYHQINRCLGPCELHVSDEDYQRELDLAKELILNKKILIKKLQEKMFYYADNLRF
FT                   EEATALRDRCERISRSEIKSEIDFASSENYDIFVIASSQSRAVVVRIFMREGKIISSSH
FT                   DYIQLHEGYDEDELYQRAIMGFYSHGKPPIIAPILVASEFEGKDSIEEFLSTLFEKKAD
FT                   IKVPKTAKRKQLIDLALLNAAELLKNETKENQSGILDEIKKLFSLQRVPSRVETFDNSH
FT                   MSGVATVGAMSVYENGAFDKKSYRIYHLEARDEYAQMREMLLRRVESFLKNPPPDLWIL
FT                   DGGSTLLNLALSILESSGVNIDVIAIAKEKVDAKAHRAKGKAKDIIYSREDIFKLLDSD
FT                   KRLHFVQKLRDEAHRCAINFHKKTKLKSDNESKLLTLKGISQAKIIKLLKHFTTFDAIK
FT                   EASVEELSTVLNLKDANIIKSSYI"
FT   gene            complement(419024..419482)
FT                   /locus_tag="Suden_0419"
FT                   /old_locus_tag="Tmden_0419"
FT   CDS_pept        complement(419024..419482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0419"
FT                   /old_locus_tag="Tmden_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43700"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43700.1"
FT                   /translation="MKNASQIINSIQSRPQFSKLIYYKCIKIVQSMFTPPIQNMINFAY
FT                   IKNKTLFFVFNHPIGKQEFDNNIQSIKSALKFYMPTECKECDENLFDDIKAFVTHAPKS
FT                   QNVKTKDIIGTYQERSNGDFNIDIKDEKLNSLAKEIQKIIKETRSHDS"
FT   gene            419638..421089
FT                   /locus_tag="Suden_0420"
FT                   /old_locus_tag="Tmden_0420"
FT   CDS_pept        419638..421089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0420"
FT                   /old_locus_tag="Tmden_0420"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43701"
FT                   /db_xref="GOA:Q30TI0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43701.1"
FT                   /translation="MRYDVIIVGAGVAGLYAATHIPKSKKVLLINKRETFKCNSFYAQG
FT                   GIALAIDAEDIPLHVQDTLDAGAGLCSEEAVRVLSESSRAIIDDLINRGFEFDRDKDGN
FT                   LLYTKEAAHSKERILHAGGDATGRHMHYFLLQQNPHPMLTDARVVDLLIKDGECYGVTV
FT                   LDHRESRNIYADNVILASGGVGSLYEFHTNAPCISADMQGLCVMKGIELSDMEMMQFHP
FT                   TVFVDSDSAQKLLLTEALRGEGATVEDEAGRRFLFDYDERGELASRDIVSKAIYDHNKK
FT                   TKMQTYLSFKNFDHVYFTKRFPNLYKSLQLLGYDVPKQRVPISPAFHYAIGGIKTDVNG
FT                   AVPSIKSLYAIGEVASTKVHGANRLASNSLLEGLVFGKRAVEHILKKKNSKKELFFEVS
FT                   SEIMSLKEDKEKKNLLRRIMWEKVSIVRTKNGLNSALHQINALLNEKIGKLLKFRLLTA
FT                   REIVLGALARDESIGVHFIQKDDND"
FT   gene            421082..422455
FT                   /locus_tag="Suden_0421"
FT                   /old_locus_tag="Tmden_0421"
FT   CDS_pept        421082..422455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0421"
FT                   /old_locus_tag="Tmden_0421"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43702"
FT                   /db_xref="GOA:Q30TH9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43702.1"
FT                   /translation="MIKLLIIMFGVSFAYASSGESVGALPDLTFTWVGFASLAIFIVGY
FT                   YFVASEEKYHIDKAKPALLTGTFLFILVALYYAINGMDMNLVHTEVEHVILEIAEIFFF
FT                   LFVAMTYIESMIHMGVFDSLKYKLVSKGYSYRKLFWATGFLAFFLSPVADNLTTALILS
FT                   TVLITIERNKASFLVPGAINIVVAANAGGAWSPFGDITTLMAWAAGKAPFVDFLFLFPA
FT                   SIGGYFITAYLLSRFVPEDVPPFDASTEKKPEMMRGAKVVMALGVFTIVCAVLSHQVLH
FT                   LPAMWGMLFGLSLLKLYAYRLKRVYNSDFNIFHSIAKIENNTLLFFFGILAAVGALYFV
FT                   GWLALAAVVYDPSVLGPTWSNIGVGFLSAIVDNVPVMSAVLKANPEMGIDQWLLVTLTA
FT                   GIGGSLISFGSAAGVGVMGKLPGIYTFSSHMKYSWTILIGYIVSIGIWYVQFEILGIY"
FT   gene            422554..424104
FT                   /locus_tag="Suden_0422"
FT                   /old_locus_tag="Tmden_0422"
FT   CDS_pept        422554..424104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0422"
FT                   /old_locus_tag="Tmden_0422"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43703"
FT                   /db_xref="GOA:Q30TH8"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43703.1"
FT                   /translation="MTNVSIIVLDFGSQYTQLIARRLREDKIYCEILPYHTKVADIKAK
FT                   NPQGIILSGGPSSVYNKDAYEVDQGVYKMDIPVLGICYGMQRIAADFGGSVVRASHHEY
FT                   GKAELKILNLETNPSPLFKDCDDERIVWMSHSDKVDTLPAGFEPIAVSSNSPYAAIANE
FT                   EKRIYAMQYHPEVQHSEEGYLMLRNFARNICGVTEKWKMEHFLKEQIKNIRAKVGSGKV
FT                   LCGLSGGVDSSVVAAMLYEAIGDQLVPVFVDNGLLRKGEREQVEEVFKINLKVPLVVVD
FT                   ARENFLSKLAGVSDPEKKRKIIGHTFIEEFEKEAKKHDGIKFLAQGTLYPDVIESISVN
FT                   GPSEVIKSHHNVGGLPDWMDFELIEPLRELFKDEVRKIGLELGLPESMINRHPFPGPGL
FT                   AIRIMGDVNEADLTLLREADVILLDELKASGYYAKTWQAFVVLLNVKSVGVMGDNRTYD
FT                   NTVCVRVVEAVDGMTATFAHLPHDLLERISRRIINEVDGINRVVYDISSKPPATIEWE"
FT   gene            424115..424753
FT                   /locus_tag="Suden_0423"
FT                   /old_locus_tag="Tmden_0423"
FT   CDS_pept        424115..424753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0423"
FT                   /old_locus_tag="Tmden_0423"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43704"
FT                   /db_xref="GOA:Q30TH7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43704.1"
FT                   /translation="MSKNIYLFATSKSKHARSIKSLDVRYLKPEIDFSKYDYLIVTSKQ
FT                   TVKALEQYNKEEFINIAALCVSDKTADSYRAIGGKILASGDGYGDNLIKNIRELPHVTK
FT                   WLYLRAELIASSFVQIAKEEGYEIDEKILYISECSKEILEVRVEDDSTLIFTSPSSIEC
FT                   FLKNNTIHPNAKVIVIGTTTAAYLPKDIKYVISQNTSIESCIELAIEAK"
FT   gene            425069..426349
FT                   /locus_tag="Suden_0424"
FT                   /old_locus_tag="Tmden_0424"
FT   CDS_pept        425069..426349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0424"
FT                   /old_locus_tag="Tmden_0424"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43705"
FT                   /db_xref="GOA:Q30TH6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43705.1"
FT                   /translation="MKILILGSGGREYSIARAILNENEAHELFFMPGNGATSSLGKNLN
FT                   IKDYNDLALFAKESGIELTIVGPEAPLVDGVVDIFKSNNLVIFGPSKEAAQLEGSKVYM
FT                   KNFLAKYNIPTARYIETASIEEAFKFTDKLQTPIVVKADGLCGGKGVIIALTHDEAKVA
FT                   ISEMLSGKSFGDAGKKVIVEEFLDGYELSMFAVCDGDDYILLPAAQDHKRVMDGDQGPN
FT                   TGGMGAYAPTPLVDEELYQKVRDRIIRPTLDGMKMENAPFEGVLFIGIMVVNGEPITLE
FT                   FNVRFGDPECEILMPLMTSSVSDMFYKAATNRLGEIKVEFSSQFAVGVVMASANYPYSN
FT                   STPAEIILDNVYHEEIEKYTHISYAGVSMIDDKLYADGGRVLVCVGLGDTIKEARDRAY
FT                   MRCGQVHFAGKKLRTDIAYQALFKEVK"
FT   gene            426346..426795
FT                   /locus_tag="Suden_0425"
FT                   /old_locus_tag="Tmden_0425"
FT   CDS_pept        426346..426795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0425"
FT                   /old_locus_tag="Tmden_0425"
FT                   /product="RDD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43706"
FT                   /db_xref="GOA:Q30TH5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43706.1"
FT                   /translation="MNEDIQDRLYHEDMKLASIKKRSMAFFVDEMLLSLLLIIGLGDSF
FT                   LEAKTLEEMILLTNKFFLEYMVIKIIYQAFFVMQYGATLGKLLVKIRVVEIKTLQKPNV
FT                   IVALNRAIIRVISEMLFYLGFLWGVLDPSRQAWHDKSAKTLVVDV"
FT   gene            426788..429004
FT                   /locus_tag="Suden_0426"
FT                   /old_locus_tag="Tmden_0426"
FT   CDS_pept        426788..429004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0426"
FT                   /old_locus_tag="Tmden_0426"
FT                   /product="organic solvent tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43707"
FT                   /db_xref="GOA:Q30TH4"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43707.1"
FT                   /translation="MFKLFILVALLITGATAENIKNNDKVEIYATTMDTNDNVVTAKGD
FT                   VVVIYQDYHLSAKRARYDRSSGDLELFENIRASQGENIKVLGEYAKLNIANKERTFAPF
FT                   YMLEKKSDVWLSGDKGYSKAKDINVTSGVMSGCNPNNPLWKMEFTSSEYNTDTMWLNLY
FT                   NARLYLYDIPVFYTPYFGYSLDTTRRTGVLPPMVGYSQKEGFYYEQALFIAEQNWWDLE
FT                   LKPQIRTNRGSGLYSTFRFVDSKTSKGSLTTGFFKEQDRYFQENILANNKHYGFNFLYD
FT                   NNDFINQWFGLNLRGQSGIYMDIVNMNDVDYINLSTNDTTQNATTRQLLSRVNLFYNTD
FT                   SDYVGAYFKHYKDLEIDSNEKTLQSLPSLHYHTYLQTLLEDHLSYSLDIKSDNYYRQAG
FT                   VSAVQTDLNIPVTLHTSLFDEYLNISYTANMYAQHTAFKNKNEIAAPTNEYDNGLFARN
FT                   SHQVAASTQLTHAYDDLTHVIEFGSQYQIGGFEMENGYYDEQKDLFVNEQRGDYCAKTV
FT                   NRSDSEYAARCEFYNIADVEKRLQLYFSQYIYDSLGNQIIYHRVAQNISYENVNSGVGD
FT                   LENELDYQITDDFNFYNNLFYNYDENSFSKNFNKISYTGKSLNLGLSHMYKNSFSARPV
FT                   ISYMTASVNYIYDKHYSYSFKHDYDLERSEKRGFEIGFLYQKRCWDFGLRYVENNRPIL
FT                   SLKGSSDSIYDRYIYLTIRLKPIMAPGSEGTGFSYRLPDKSRNN"
FT   gene            429008..429670
FT                   /locus_tag="Suden_0427"
FT                   /old_locus_tag="Tmden_0427"
FT   CDS_pept        429008..429670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0427"
FT                   /old_locus_tag="Tmden_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43708"
FT                   /db_xref="GOA:Q30TH3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43708.1"
FT                   /translation="MGRYKNILKNREDAAKRLYDVIPMQRLKDENWKLIAVSRGGLELA
FT                   FHIRGKYKNSIDFLFSEAIMAPNNHECEIARVCEGEEIVINEKLVSAFGIKYDYIYGEA
FT                   HRKHEEKILSYIYQYRKGRPFTSMHNKIVMLVDEGSETGLKFLTALKAILAMKPKAIYI
FT                   VTPVIPSDVLEFLEPFADDLFYLYKIDDYVETPLYYEELEKIDEERIEKILGEKSEI"
FT   gene            429660..431825
FT                   /locus_tag="Suden_0428"
FT                   /old_locus_tag="Tmden_0428"
FT   CDS_pept        429660..431825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0428"
FT                   /old_locus_tag="Tmden_0428"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43709"
FT                   /db_xref="GOA:Q30TH2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43709.1"
FT                   /translation="MKYDIKIDLKNKNEEYSFGEVAKQANGAAWLKSGNTVILATVVID
FT                   ETEIVKDDFLPLTVQYIEKAYAAGKIPGGFFKRETKASDFETLTSRIVDRSLRPLFPKG
FT                   FGHPTQITIMVFSVDKESDLQVLALNAASAALYVSDIDINKSVSAIRVAKIDGELILNP
FT                   TLSELDKSTLDLYLSGTKEDLLMIEMRSKGGIKVDTNLMIDPLMDPTLSSAIIATHVSN
FT                   AVPEDELITILAKAEELLFETNAMYEEMFKEFKKETSPLECKAHALNEEMLKYVRSNHY
FT                   SDIKSAMNQMAKSERSTALRQLRKKIIITKEEWDEVELKDVIESVKKEQVRGQILNDRV
FT                   RADGRALNEIRPISISTNVLPSAHASCLFTRGQTQALVVLTMGGPKDAQMFENLTDEGT
FT                   QNENFMVHYNFPGFSVGEASPIMGTKRRELGHGNLAKRALEPIVNLEGQTVRLVSEILE
FT                   SNGSSSMATVCGGYMALRAADIETSDTIAGIAMGMVSEGDKYAILSDIMGLEDHDGDLD
FT                   FKVTGSKDGITAMQMDIKLGGISLNILKEALYQAKEGRAHIINIMQEAEKNISFNDGVL
FT                   PSTDFFHINPSFIGDIIGQAGKTIREIIEKFEVAIDIDKKDGKVKVTGKSKSGVQAARE
FT                   HIEGIVSTPKMPKIEYKVGDIHKGIVKKIVEFGAFIELPDGVDGLLHISKISDQRVEKV
FT                   SDILKEGEEINVEILEFKGNKISLGIA"
FT   gene            431999..432313
FT                   /locus_tag="Suden_0429"
FT                   /old_locus_tag="Tmden_0429"
FT   CDS_pept        431999..432313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0429"
FT                   /old_locus_tag="Tmden_0429"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43710"
FT                   /db_xref="GOA:Q30TH1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43710.1"
FT                   /translation="MKKILFLMVALATAALANDGDVANQTLKAYSMIAAGLGLGLAALG
FT                   GAIGMGHTAAATIAGTARNPGLGAKLMTTMFIALAMIEAQVIYALVIALIALYANPYLG
FT                   "
FT   gene            432364..432447
FT                   /gene="tRNA-Leu2"
FT                   /locus_tag="Suden_R0017"
FT                   /old_locus_tag="Tmden_R0017"
FT   tRNA            432364..432447
FT                   /gene="tRNA-Leu2"
FT                   /locus_tag="Suden_R0017"
FT                   /old_locus_tag="Tmden_R0017"
FT                   /product="tRNA-Leu"
FT   gene            432652..433752
FT                   /locus_tag="Suden_0430"
FT                   /old_locus_tag="Tmden_0430"
FT   CDS_pept        432652..433752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0430"
FT                   /old_locus_tag="Tmden_0430"
FT                   /product="Protein of unknown function DUF808"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43711"
FT                   /db_xref="GOA:Q30TH0"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43711.1"
FT                   /translation="MSGLLGYLSVLADDIGSLAGRTMSINAKTLATSLDDIGLLFDDIA
FT                   TYTKLAGVKSSGILIDDLAAIANFTNETTSDILKRELQKARTPQEFEQNINNLDEASKK
FT                   TILEELENLRNLAILEAKRKAAQRELPIVYKIAKGSLINKFIIIPTVLFLSYLAPWAIA
FT                   PILILGGIFLAYEGVHSLFEKFSKHAVEEKVDDDSQKFSNEELENNKIKSAIKTDFILS
FT                   FEIIVISLSLLGNLDFVTKLFVLIFIGILTTIFVYGIVALIIKLDDIGFYLQEKNAKIV
FT                   QKIGDGFVKSMPYIIRAIGILGTVAMLAVGGGIVTHETGVLSSYESMIKVIPLGGFVAD
FT                   IILGVIIGFITLVIVQFITKIVKKVK"
FT   gene            complement(433865..435349)
FT                   /locus_tag="Suden_0431"
FT                   /old_locus_tag="Tmden_0431"
FT   CDS_pept        complement(433865..435349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0431"
FT                   /old_locus_tag="Tmden_0431"
FT                   /product="Sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43712"
FT                   /db_xref="GOA:Q30TG9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43712.1"
FT                   /translation="MYFFKKDEWLGNVRADILSGLVVALALVPEAIAFSIIAGVDPKVG
FT                   LYASFCIAVVISFVGGRTGMISAATGAMALVMVTLVKEHGLEYLLAATLLTGVFQIILA
FT                   YLGIAKLMSFVARAVVVGFVNALAILIFMAQLPELTNVTWHVYALTAAGLGIIYLFPYV
FT                   PKIGKLLPSPLVTIVVLTVFVIFAGIDVRTVGDMGDLPDTLPIFLWPNVPLTFETLLII
FT                   APYAFALSIVGLLESFMTATIIDDMTDTKSDKRAEARGQGIANIASGCIGGMAGCAMIG
FT                   QSVINISSGGRKRLSTFVAGFFLLILVVFLSDILKLIPMAALVAVMIMVSIGTFDWGSF
FT                   KRLKTLPLSTNIVMLSTVVVTVGTHNLAFGVLTGVLLASLFFANKISHFMYCETSQDED
FT                   AKTYKIVGQVFFNSADRFVDFFDFKEKIGSVIIDLRRAHFWDISAVHALDKSVIKFRKE
FT                   GVHVRVIGQSDASATIIDRFAIHDNPQEIEKIMGGH"
FT   gene            complement(435360..435713)
FT                   /locus_tag="Suden_0432"
FT                   /old_locus_tag="Tmden_0432"
FT   CDS_pept        complement(435360..435713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0432"
FT                   /old_locus_tag="Tmden_0432"
FT                   /product="Cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43713"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43713.1"
FT                   /translation="MYIHKEINSIESIAQKAGEGVSMKMLLSPDESPNFAMRNFIIQAG
FT                   GFMPLHTNSVEHEQYVLSGRAKVQLGDKTIEAKAGDILLIPAGVSHSYKTIGDEPYSFL
FT                   CLVPKAQDTITLI"
FT   gene            435773..436696
FT                   /locus_tag="Suden_0433"
FT                   /old_locus_tag="Tmden_0433"
FT   CDS_pept        435773..436696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0433"
FT                   /old_locus_tag="Tmden_0433"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43714"
FT                   /db_xref="GOA:Q30TG7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43714.1"
FT                   /translation="MKIAKNITELIGNTPLVRLNKASKASGANIIAKCEFMNPTSSVKD
FT                   RIGFNMIRRAMEDGTIKHDTTIIEPTSGNTGIALAANCAALDLKLILTMPESMSIERRK
FT                   LLKAFGAELVLTPAALGMSGAIAKSEELSCMIPNSVVLQQFKNRANPEIHMLTTAQEIL
FT                   RDTDKSIDAFVAAVGTGGTLSGVSKVLKEQIPNIAIFAVEPLNSAVLSGESAGPHAIQG
FT                   IGAGFIPDTLDVTVYGEIIKVSNEDAIKTAKMLAKDEGLLVGISAGANVFAIMQIASRE
FT                   EFKGKTLLTILCDTGERYLSTDLFDE"
FT   gene            436689..437288
FT                   /locus_tag="Suden_0434"
FT                   /old_locus_tag="Tmden_0434"
FT   CDS_pept        436689..437288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0434"
FT                   /old_locus_tag="Tmden_0434"
FT                   /product="putative para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43715"
FT                   /db_xref="GOA:Q30TG6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43715.1"
FT                   /translation="MSKTFFETIKAVDGEIFHLSFHQKRYESVLKHFGIKEIQNLSLHV
FT                   NPPKNTLYRCRLTYDLSINPHKIEVEYYEYQKREISSLKLVYDDRIVYDLKSTNRERLE
FT                   ELYELRESCDDILVVKNSLITDTTIANIAFYDSKNWLTPAKPLLKGTTRDRLLSENKIY
FT                   EADIHVKDLKNFSHVALMNAMIDFDIITKNNKEFFC"
FT   gene            437282..437740
FT                   /locus_tag="Suden_0435"
FT                   /old_locus_tag="Tmden_0435"
FT   CDS_pept        437282..437740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0435"
FT                   /old_locus_tag="Tmden_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43716"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43716.1"
FT                   /translation="MLDNIIEDRDFAALMQKSVEGLIIYLFEKDEHFGILCKIENITFE
FT                   PPLPREIASEFRAMTLFFLAGYTFETANIIGENLIFEAGFGSDNFGSIVTVPLHSIVQI
FT                   IVDETPLLINLSNYKKEIEKVKVAETLGVENSMASFLSNPENSKFLKK"
FT   gene            complement(437744..438646)
FT                   /locus_tag="Suden_0436"
FT                   /old_locus_tag="Tmden_0436"
FT   CDS_pept        complement(437744..438646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0436"
FT                   /old_locus_tag="Tmden_0436"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43717"
FT                   /db_xref="GOA:Q30TG4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43717.1"
FT                   /translation="MLKDFAKLQTFLMVIKEKSFSKASAKLGISQPAVTQQIKFIEDYL
FT                   DTKIVDRKKNGILLTKEGEELFRIATRLEKAISGSEKEILKIINKDFTFVMGSSNAIGN
FT                   YILPNYLSEIKNRINNNVYMNVGLSCEIIDQLEDKKIDVALIESPVFRDGIVYREWVLD
FT                   ELVVFSNQPLKKHLTAEDLLGFDWICRDEHSHTRKLTSEAFDEMGVQCSNFHVLGILGS
FT                   PTAIKESILHADPNSERPVVSVMSKHVIAAELAEGKLFDARLKNYKIERNFYIAYLKDR
FT                   KHDAFVDNVVNYLLSLNKV"
FT   gene            438775..440823
FT                   /locus_tag="Suden_0437"
FT                   /old_locus_tag="Tmden_0437"
FT   CDS_pept        438775..440823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0437"
FT                   /old_locus_tag="Tmden_0437"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43718"
FT                   /db_xref="GOA:Q30TG3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43718.1"
FT                   /translation="MEKIFEKLNNSQTDAVKQTEGPVLILAGAGSGKTTTIVSRLAYLI
FT                   EGIGIPASNTLTLTFTNKAAKEMRERASNMMSNLAYPPLLCTFHKFGLLFLKFNIHLLG
FT                   RQNNFVVIDSDDKKRIIKKINSELATPLIASEISRYKNSLLTPDDAYKQAEFFNYQQIA
FT                   KIYEEYENYLLENNLVDFDDLIALTFKLLDENPELARTTSDKYRYIMVDEYQDTNELQL
FT                   KLLQKLCSTHNNICVVGDDDQSIYGWRGAHIRNIMEFDQDFIGTSVFKLEENYRSREPI
FT                   LKVANALIEHNRSRLGKKLIPTRGGGEDITILNSSDENEEARKIATKVNKLLDSGVKAE
FT                   DIAVLYRVNVLSRSIEDGLNRAGIAYKLVGGLRFYDRAEIKDLISYLRVITNFHDDFSF
FT                   KRIVNKPKRGMGKASVDKIELAAHANETSIFEYIEKIAITDLETLVKSKNAKTLKKFVK
FT                   DIRSVANAAKESTYNFIDILEDTFHLKDIYKGLPDEVERVLNMDEFYGLFRDFIKNSPS
FT                   ASLDEFLNELTLQSEQDQVEGDSIYMMSIHASKGLEFDHIFIIGLEEGFLPLVGDGSDL
FT                   EEERRLGYVSFTRAKDTLTLSHVDSRFYKGRRSDLQKSRFFNEAGLCEGSLIVEKNTAF
FT                   KKGDLVRHKIFGTGRVNGVSKSGREFKLNINFAGTKRDILASFVERL"
FT   gene            440820..441641
FT                   /locus_tag="Suden_0438"
FT                   /old_locus_tag="Tmden_0438"
FT   CDS_pept        440820..441641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0438"
FT                   /old_locus_tag="Tmden_0438"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43719"
FT                   /db_xref="GOA:Q30TG2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43719.1"
FT                   /translation="MNRLFVAYKPAGIGSNLFLSRIKREYKTKKAGFSGTLDPFAKGVL
FT                   IIGMGSYTKLFRFLAKAPKVYRATLWLGAKSDTLDTEMIEEVEILEEFDEADVLKAIKS
FT                   LEGSLEYEPPIFSAKQINGQRAYDLARAGVEFSLNKINSTIYETKLVSYCHPFVTFEAI
FT                   VSEGTYIRSLGLIIANRLGVKNGSLSALERLSEGRFKYDNHKPLDIKKSLNMMQNFYHG
FT                   DSDNLKYGRVLALNDLEIKSDGFYWLDSGSFISIIHVKDAKVNYELGRIEC"
FT   gene            441635..441865
FT                   /locus_tag="Suden_0439"
FT                   /old_locus_tag="Tmden_0439"
FT   CDS_pept        441635..441865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0439"
FT                   /old_locus_tag="Tmden_0439"
FT                   /product="carbon storage regulator, CsrA / carbon storage
FT                   regulator, CsrA"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43720"
FT                   /db_xref="GOA:Q30TG1"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43720.1"
FT                   /translation="MLVLSRKIDEAIVIGENITIKVISVEKGVVKLGIDAPKNLSIVRS
FT                   ELLEDVKDSNIAASKEINLLDITSLSAILKK"
FT   gene            441872..442672
FT                   /locus_tag="Suden_0440"
FT                   /old_locus_tag="Tmden_0440"
FT   CDS_pept        441872..442672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0440"
FT                   /old_locus_tag="Tmden_0440"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43721"
FT                   /db_xref="GOA:Q30TG0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43721.1"
FT                   /translation="MKMKLYRAYAKVNIFLKIQGSRGNYHEIVSRFMRVPSLYDELSFV
FT                   PKESSEEFELIGSFSCKREQNTIYKAYRALLEFLDEASGLHVENLMQKYAVKVTKNIPT
FT                   FAGLGGGSSDAATFLKMCNEVLHLGLSQNELALIGLHVGADVPFFIYGYNSANVSGIGE
FT                   VVEEFKEELLDIEVFTPQLEISTPKVYNLYRENFYNPVDGFEVERLKKISSKDALSAMS
FT                   AAEANDLFAPAIQLYKELKNHYKYGYYFSGSGSSFFRVKEKENI"
FT   gene            442672..443124
FT                   /locus_tag="Suden_0441"
FT                   /old_locus_tag="Tmden_0441"
FT   CDS_pept        442672..443124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0441"
FT                   /old_locus_tag="Tmden_0441"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43722"
FT                   /db_xref="GOA:Q30TF9"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43722.1"
FT                   /translation="MGENIAKNKKAYFDYFLEEKFEAGLVLKGSEIKAIRAGRVNLKDS
FT                   FIRFVQGEAFLFNAHIGRLETTHHFYAHEERGSRKLLLHKKQIQKMIKAVEKDGYTVVP
FT                   LQLYFNDRNIVKIQIAIAKGKQLHDKRNDLKEKDMKRDMERSMKDY"
FT   gene            443124..443981
FT                   /locus_tag="Suden_0442"
FT                   /old_locus_tag="Tmden_0442"
FT   CDS_pept        443124..443981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0442"
FT                   /old_locus_tag="Tmden_0442"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43723"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43723.1"
FT                   /translation="MNFLLILFLSVSSLFGFEVEFASGIVENGKVALLEFKKEKNILYE
FT                   EALFDDKKYKILAHPKKSEKFYLLIPIDYEEKIAKKNIEIFYKDSGKEKSKVVVLDIKE
FT                   AKYEKEALQVDSSKVTLSKKDKARSEKEYAEAMKIYNTSTPKSMLTSNFVVPLESKITS
FT                   DFGKARVYNNTLKGYHGGTDFRASIGTPIIAANDGEVALAKDRFYSGMSILINHGDGIY
FT                   TCYFHMSRFDVKEGQRVKKGELLGLSGDSGRVSGPHLHFGVRVGGKQVDPLHFMTLINK
FT                   NLLL"
FT   gene            443994..444575
FT                   /locus_tag="Suden_0443"
FT                   /old_locus_tag="Tmden_0443"
FT   CDS_pept        443994..444575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0443"
FT                   /old_locus_tag="Tmden_0443"
FT                   /product="TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43724"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43724.1"
FT                   /translation="MTLFQLLMLGASAFFAFKVYEHIQGLKDLQPHNEEPRTPSSFDPE
FT                   FLVQKAEEAFETGDLQKAYDLFNEANSKVAQSSETLFKMGYILQQLKREDEALECYKKA
FT                   LEGDRENEFIHNSIASIYRLKEEFVSAKMHLNASLSIDNKNPITYYNYGNLLVDMKHID
FT                   EAKEMYKKALEIDADFAEAKEELEKLEKAG"
FT   gene            444572..445294
FT                   /locus_tag="Suden_0444"
FT                   /old_locus_tag="Tmden_0444"
FT   CDS_pept        444572..445294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0444"
FT                   /old_locus_tag="Tmden_0444"
FT                   /product="Protein of unknown function DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43725"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43725.1"
FT                   /translation="MKISQIYDFLDSLSPFELQEKWDNSGLLVGDFNQDVKKIVLSIDV
FT                   DESLIDSMEEGTLLITHHPIIFGGLKQLEFNKYPANLLQKMIQKNISNISMHTNFDQTH
FT                   LNEYVATEILGYKIAQKDGFVAYLDIDEDFDFFALKVASAFSLPHAKCVKSSQRVKRVA
FT                   LTTGSGSSLIKSIKADCFLTGDIKYHDAMEAKSINLSMIDIGHFESERFFADILFKHLK
FT                   NLGLEAIISSSKNPFTYI"
FT   gene            445332..446045
FT                   /locus_tag="Suden_0445"
FT                   /old_locus_tag="Tmden_0445"
FT   CDS_pept        445332..446045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0445"
FT                   /old_locus_tag="Tmden_0445"
FT                   /product="Protein of unknown function DUF164"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43726"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43726.1"
FT                   /translation="MNLHLRQLIDLSHIDKAIDAFEPQIEEANYKFEAALAKKKSIDSD
FT                   IESLGNEIRDEEIKKKKNEIHLGELSQKLADNSKKSNEVKTEREMKSLQLEEEIAKEQV
FT                   TFANEEIERLERIIDLKTSQIESAKKVLEELDANLASIKAEVDEKLEVINKSRQDVFVK
FT                   KEKLISEMNQKGLAFYQKIRRWAKNSTVVPVEEQACMGCHMHISDKVYADVIKAEEITT
FT                   CPHCGRILYVETDKE"
FT   gene            446087..447214
FT                   /locus_tag="Suden_0446"
FT                   /old_locus_tag="Tmden_0446"
FT   CDS_pept        446087..447214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0446"
FT                   /old_locus_tag="Tmden_0446"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid
FT                   transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43727"
FT                   /db_xref="GOA:Q30TF4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43727.1"
FT                   /translation="MLYLIALPLLVYLSFKQKYKESIPARFFLFKNPKFKSSGGIWFHA
FT                   CSLGEARALKPVLDLLSGCDIKITTITQTGQVEALRYSVDVRYLPYEMFLPFWIKRQDF
FT                   LIVLEAEFWFLLFSVAKAKGARVILLNARISEKSAKKYLQFAWFYKKLLSHVEIIYAQS
FT                   QVDKNRFLALGAKNIEVIGNIKLSANISKTKEYKKPKVEVITAGSTHEGEEESILKSFV
FT                   EYKKQSDAKLFMVPRHPERFQAVFELMRRYCDKNSLTLSRFSNDKEFDTDMVLVDAMGE
FT                   LNNIYAISDIAILGGAFRKDIGGHNPLEPAYFGCKIITGKHFFHQSELFKYVYHVQYVE
FT                   PSEIHKALMASRDLPPSMVEEKTDLKPVIDRILKN"
FT   gene            447226..447960
FT                   /locus_tag="Suden_0447"
FT                   /old_locus_tag="Tmden_0447"
FT   CDS_pept        447226..447960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0447"
FT                   /old_locus_tag="Tmden_0447"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43728"
FT                   /db_xref="GOA:Q30TF3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43728.1"
FT                   /translation="MATEKAYKLLAAQEGISNSEAKSMIDRGLVYAANKKVMIARGDID
FT                   TKTLFKVEKVEKIRPIFENDDLVVVDKPAHVNSDEIERQFKPAVLLHRLDKETSGVLML
FT                   VKNEEFREKAIQEFKKDRVYKEYIAWIEGILSEPVDIDRPILTTKKNNRASSNVSSKGK
FT                   PARTEVFPDLVSANKTKVKCIIHHGRTHQIRVHLRYIEHPIVGDEQYGGRRAKRVMLHA
FT                   HKVRLLGMEFTAPEPKTFLTFE"
FT   gene            447986..448225
FT                   /locus_tag="Suden_0448"
FT                   /old_locus_tag="Tmden_0448"
FT   CDS_pept        447986..448225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0448"
FT                   /old_locus_tag="Tmden_0448"
FT                   /product="Excinuclease ABC, C subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43729"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43729.1"
FT                   /translation="MLKCSDDTLYTGITIDLSRRLNEHNSSQKAAKYTRTRRPLEMIYF
FT                   EEHKDKSSASKRELEIKKLSRDKKLELIKQCGFL"
FT   gene            448210..448665
FT                   /locus_tag="Suden_0449"
FT                   /old_locus_tag="Tmden_0449"
FT   CDS_pept        448210..448665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0449"
FT                   /old_locus_tag="Tmden_0449"
FT                   /product="Protein of unknown function DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43730"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43730.1"
FT                   /translation="MRLFIDGDAFPNTLKPILFRSIQRLNLEVFVVSNKPVTIGKSKLI
FT                   RYLIVEQGADEADNHIVELVEEGDLVITADIPLADRVISKAAHAIDHRGELYSVDNIKH
FT                   YLAMRNLMEKIRESGEMTKGPKPFNQKDAHQFANQLNKFLAKNIIKI"
FT   gene            448746..450089
FT                   /locus_tag="Suden_0450"
FT                   /old_locus_tag="Tmden_0450"
FT   CDS_pept        448746..450089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0450"
FT                   /old_locus_tag="Tmden_0450"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43731"
FT                   /db_xref="GOA:Q30TF0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43731.1"
FT                   /translation="MFDILTDSFTNAIKKIRFNDDDKALTKALDELKKSLLRADVNHKV
FT                   VKDLIFKVQIETKKNGIGKDQFLEALRNALYELLEIGGNRGFVFASKPPTVILMTGLQG
FT                   SGKTTTTAKLANYLKNKQKKVMVVAADLQRLAAVEQLRQLTQQVGVELYEDESTKNPVE
FT                   VVTAALKKANSGIYDVVLIDTAGRLAIDNELMDELEAVKYAANPSEIFYVADSMTGQDA
FT                   IKTATAFKEKIGIDGVILSKYDGDSKGGIALGLSSQVQVPLRFIGSGEKIEDLEVFLPE
FT                   RVVNRLMGFGDIEGLAERTSSVIDEKQAKKFTSKIKKGEFNFNDFLEQMESMKKMGSMK
FT                   SLMGMIPGMGNMSKALKDFDLENSSELKNIKAMVSSMTMKERENPDLLNNSRKGRIAKG
FT                   CGLEIVEINRMIKQFKNAGKMAKRFSGKNGMKDLQAMMGQMGGAGAFR"
FT   gene            450211..450441
FT                   /locus_tag="Suden_0451"
FT                   /old_locus_tag="Tmden_0451"
FT   CDS_pept        450211..450441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0451"
FT                   /old_locus_tag="Tmden_0451"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43732"
FT                   /db_xref="GOA:Q30TE9"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43732.1"
FT                   /translation="MATVIRLTRMGRKKQPFYRIAVTDSRKRRDGGWIELIGHHNPMVA
FT                   EKTTVVDNERLDYWLSVGAKMSDRVKKITGR"
FT   gene            450444..450683
FT                   /locus_tag="Suden_0452"
FT                   /old_locus_tag="Tmden_0452"
FT   CDS_pept        450444..450683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0452"
FT                   /old_locus_tag="Tmden_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43733"
FT                   /db_xref="GOA:Q30TE8"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43733.1"
FT                   /translation="MIADFVAQFAKLIASYPDDVRVEVKEGDETAEILLYANQSDIGKL
FT                   IGKEGKMIGAIKTVISGCKAKDGMSYRINVEAIK"
FT   gene            450664..451203
FT                   /locus_tag="Suden_0453"
FT                   /old_locus_tag="Tmden_0453"
FT   CDS_pept        450664..451203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0453"
FT                   /old_locus_tag="Tmden_0453"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43734"
FT                   /db_xref="GOA:Q30TE7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43734.1"
FT                   /translation="MSKQSNKLLHIATIGKSVGLGGDMKLHIKSDFPEQFKKGVSFFIN
FT                   ENETLTLSDINHERALIKFVGYNSPEDAKKLTNKNLYTTIERTRKECRLEKDEYFWFDI
FT                   EGCSVVEDGKVLGIVDELDRMGITNYLCVITDETLVKSGFAKSFLIPFREPFTINTDIK
FT                   EKIITVIGAMDILEAS"
FT   gene            451203..451898
FT                   /locus_tag="Suden_0454"
FT                   /old_locus_tag="Tmden_0454"
FT   CDS_pept        451203..451898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0454"
FT                   /old_locus_tag="Tmden_0454"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43735"
FT                   /db_xref="GOA:Q30TE6"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43735.1"
FT                   /translation="MKFTFVTLFQNIVEGYFNDSILKRAIQKEILEVEYLNPRDFSDSR
FT                   HNKVDDSAVGGGAGMVMNPQPLFDALDELKRVDSEVHILFLTPVAKSFKQNDAKRLSKK
FT                   PHIAFVSGRYEGIDERVIEKYADEVFSIGDYILTGGELPSLVICDAISRNVDGVLGNSD
FT                   SLSVESFETELLEAPSFSKPEIYKNISVPSEYLKGNHSKIRSLKLALSTCKTKFFRPEQ
FT                   LLKHKTQLH"
FT   gene            452021..452380
FT                   /locus_tag="Suden_0455"
FT                   /old_locus_tag="Tmden_0455"
FT   CDS_pept        452021..452380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0455"
FT                   /old_locus_tag="Tmden_0455"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43736"
FT                   /db_xref="GOA:Q30TE5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43736.1"
FT                   /translation="MRNKYIENFEKAQVVGKNIPDFRAGDTVRLAVTIKEGDKTRIQNY
FT                   EGVCIAKRGQGTGQTITVRKIGANSIGIERIFPIYSDSINEITVIRRGRVRRAKLFYLR
FT                   DLAGKAARIKELRRK"
FT   gene            453120..454567
FT                   /locus_tag="Suden_R0018"
FT                   /old_locus_tag="Tmden_R0018"
FT   rRNA            453120..454567
FT                   /locus_tag="Suden_R0018"
FT                   /old_locus_tag="Tmden_R0018"
FT                   /product="16S ribosomal RNA"
FT   gene            454740..454815
FT                   /gene="tRNA-Ala1"
FT                   /locus_tag="Suden_R0019"
FT                   /old_locus_tag="Tmden_R0019"
FT   tRNA            454740..454815
FT                   /gene="tRNA-Ala1"
FT                   /locus_tag="Suden_R0019"
FT                   /old_locus_tag="Tmden_R0019"
FT                   /product="tRNA-Ala"
FT   gene            455114..457997
FT                   /locus_tag="Suden_R0020"
FT                   /old_locus_tag="Tmden_R0020"
FT   rRNA            455114..457997
FT                   /locus_tag="Suden_R0020"
FT                   /old_locus_tag="Tmden_R0020"
FT                   /product="23S ribosomal RNA"
FT   gene            458180..458295
FT                   /locus_tag="Suden_R0021"
FT                   /old_locus_tag="Tmden_R0021"
FT   rRNA            458180..458295
FT                   /locus_tag="Suden_R0021"
FT                   /old_locus_tag="Tmden_R0021"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(458483..459169)
FT                   /locus_tag="Suden_0456"
FT                   /old_locus_tag="Tmden_0456"
FT   CDS_pept        complement(458483..459169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0456"
FT                   /old_locus_tag="Tmden_0456"
FT                   /product="Leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43737"
FT                   /db_xref="GOA:Q30TE4"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43737.1"
FT                   /translation="MIPKLLKHELTFPHPNDATEDGIVAWGGDLNPSRLIRAYQNGIFP
FT                   WYGKNDPIIWWSPNPRLIMELDDFKLSRSLRKSMKKFEYRFDTNFINVMKNCQNIKRVK
FT                   QDGTWIQDEIIEAYSVLHDMGIAHSVESYLDGELVGGLYGVAVGGLFCGESMFTLVNDA
FT                   SKSAYAVLINHLKIWGYDFIDAQVPTEHLKNLGAKEVSRDYFLDRLHKVNMNIINHKWE
FT                   LLHVNT"
FT   gene            complement(459166..461343)
FT                   /locus_tag="Suden_0457"
FT                   /old_locus_tag="Tmden_0457"
FT   CDS_pept        complement(459166..461343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0457"
FT                   /old_locus_tag="Tmden_0457"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43738"
FT                   /db_xref="GOA:Q30TE3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43738.1"
FT                   /translation="MISYSLNEVFQKAILYAKGLRHEYITIEHLFYQLLNSSEGAKIIF
FT                   TCGGDVEEMREVIKKYIDTNSQTLPPNISEEPFESVALSRLIDNMIKHIQSSNQQSADI
FT                   ADLLVAIYDEVNSFAYILLTEYKISRLDILEVISTLDEKETTKESESYLQKYAINLLKK
FT                   AKDGKIDPVIGRDDEIQRVTQILCRRKKNNPILVGEAGVGKTAIAEGLALNIVAKKVPL
FT                   IIQNSQLFALDLGAMLAGTKYRGDFEKRLKGIMDELKGIPNAILFIDEIHTLIGAGSTS
FT                   GSMDAANQLKPALASGELKCMGATTFAEYRNGFEKDKALSRRFSKIDINEPSLETSYKI
FT                   LKGLKSKYEAHHNVTYTDNALKSAVELSKRYITDKFLPDKAIDLIDECAASFHLKKVKR
FT                   RVVSSTDIQNTLSKIVGISNQKVSKDETLSLINLQESLKQRVIGQDKAVEEVTKAIKIS
FT                   KAGLTPEGKPIASFLFSGPTGVGKTELALSLSEILGVNFERFDMSEYMEKHALSRLIGA
FT                   PPGYVGYEQGGLLTEAIKKHPYSVLLLDEIEKAHPDLVNILLQIMDNATLTDNNGYKAN
FT                   FQNVILIMTSNVGATARSVMGFNKDSSLAKNEELKLFFTPEFRNRLSAIVEFNQLDIEI
FT                   VKNIVKKFIAELNAELKKKKIAITLSPKAMDFIASESYSPEMGARPIKRYIQNNITEQL
FT                   SDEILFGKLKNGGTVNVSFNKKIILKFKELD"
FT   gene            complement(461343..461642)
FT                   /locus_tag="Suden_0458"
FT                   /old_locus_tag="Tmden_0458"
FT   CDS_pept        complement(461343..461642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0458"
FT                   /old_locus_tag="Tmden_0458"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43739"
FT                   /db_xref="GOA:Q30TE2"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43739.1"
FT                   /translation="MATNIDLETKEKVKIKYPKKYKVLLLNDDYTSMEFVIDILITIFH
FT                   KNYEQAHQIMLEIHKKTKGICGIYTYEIAETKVMQVHKKARDNGFALRATMEEE"
FT   gene            complement(461871..463106)
FT                   /locus_tag="Suden_0459"
FT                   /old_locus_tag="Tmden_0459"
FT   CDS_pept        complement(461871..463106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0459"
FT                   /old_locus_tag="Tmden_0459"
FT                   /product="O-acetylhomoserine aminocarboxypropyltransferase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43740"
FT                   /db_xref="GOA:Q30TE1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43740.1"
FT                   /translation="MDYFEEYCTKFVQSVGSKDGAVSPTIVNSASFAYETPEIAEGIFN
FT                   GSIKKPLYSRMGNPTTSKLESIMAEMDDGVGAIATSSGMGAIALAVMSLLTCKDEIISI
FT                   GGLFGGTYSFFSETLSRFGVKTHFFDVDELENIKNAVNENTKIIFLESVGNPNMRLPDI
FT                   KKIAAIANECGVALMVDNTITPLSILPLKLGADICIYSTTKIISGNSSALGGCVVFRAI
FT                   KEKDDKFKTPRYKELEKFIKNMGKMALVVNAKKRAMRDFGMSANAHSSYLTMLGLETLA
FT                   LRMDRIVKSVETVAKELHKNGLNINHPCLDTHPHHQRYLSDFPNGCGTLLTIDMLTKER
FT                   AFAFLNKTKIATITANIGDSRTLALHMSSTIYSDFDEKTKNFLGITDGLIRVSIGLENP
FT                   KDIIEDFLISAK"
FT   gene            463202..463864
FT                   /locus_tag="Suden_0460"
FT                   /old_locus_tag="Tmden_0460"
FT   CDS_pept        463202..463864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0460"
FT                   /old_locus_tag="Tmden_0460"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43741"
FT                   /db_xref="GOA:Q30TE0"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43741.1"
FT                   /translation="MKKRIFITATNTDIGKTYTTKLLLKEFASRGLLVGVIKPIETGVV
FT                   DGYADDGEELLQYVKELNPKLWSLEVEDIVPITYELAAAPFVASNNTPLDLRKIKIKIE
FT                   EMEASCDIVIIEGAGGLYVPIDDKYMMIDLLKKLDAVALLVTHCSLGCINDTLLSKGAL
FT                   EAKEILHVVAFNCKNKDDNFDKISEPYFLKTDFKVFKVDKDIEKICDVLYNLSDVKR"
FT   gene            463972..464847
FT                   /locus_tag="Suden_0461"
FT                   /old_locus_tag="Tmden_0461"
FT   CDS_pept        463972..464847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0461"
FT                   /old_locus_tag="Tmden_0461"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43742"
FT                   /db_xref="GOA:Q30TD9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43742.1"
FT                   /translation="MKHLIRTDDFTTQEIESILADAELFSDGRFDRILRDKIIITLFFE
FT                   NSTRTRSSFEIAAKRLGAEIVHLDVANSSTKKGETLVDTAMNLDAMGPHAIIVRHQNSG
FT                   VAKILSNHTKASIINAGDGAHAHPTQALLDLFTLKKHFKNLEGKKIAIVGDIKNSRVAN
FT                   SNIELLSRFKMEVILVAPPQFLPQSDLRTTHYLEDIIDEVDAIMSLRTQTERHSSQTYA
FT                   SLKDYASDFCITSEVVGDRDIIILHPGPVHRNIDICDALLADKRCKVLEQVANGVAIRM
FT                   AVLKKLIYDV"
FT   gene            464837..465775
FT                   /locus_tag="Suden_0462"
FT                   /old_locus_tag="Tmden_0462"
FT   CDS_pept        464837..465775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0462"
FT                   /old_locus_tag="Tmden_0462"
FT                   /product="aminodeoxychorismate synthase, subunit I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43743"
FT                   /db_xref="GOA:Q30TD8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43743.1"
FT                   /translation="MTFEDINSLGSKREPFLFIVDFKAQNIALLPLDKLKQNDVEFEIN
FT                   EEYKLKVHEDFLQKDGVSFETYKEKFDFVIEKIKDGETYLLNLTQPTYIKTPLTLQEIY
FT                   SAANAPYKLRYKDKFVCFSPEKFISIKDYKISTFPMKGTIDASILNAKEIILEDKKEMA
FT                   EHVMVVDLLRNDLSMVAKNVKVEKFRYITKIEAGEKKLLHVSSHISGDVGDDWHSKIGD
FT                   ILKSLLPAGSISGAPKKSTLEIIHLVEGYERGYFSGVFGVYDGEVLDSAVMIRFVQKTK
FT                   DGYMYKSGGGITLDSDVKSEYNEMLDKVYLP"
FT   gene            465791..467188
FT                   /locus_tag="Suden_0463"
FT                   /old_locus_tag="Tmden_0463"
FT   CDS_pept        465791..467188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0463"
FT                   /old_locus_tag="Tmden_0463"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43744"
FT                   /db_xref="GOA:Q30TD7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43744.1"
FT                   /translation="MFKINGFFTSGWFFDESECELKNRYQMINIGILLSASGLVYGIIG
FT                   NYIRGTDGFIPLELALLCTNIMMFFALRMYRNFFEFFAITMTLQYTFLFLFLIYVGEPS
FT                   DLKHLWIFTYPIILLYFQKTIHALYWLGFMLVMLIIAPLQGFVSTNYSMYQVTYLSFVL
FT                   AVVSIIIYFYKKKIDEAKNTILEQQNMLKNFNSELERQVKDKTTELIKLNESLGIKVEQ
FT                   KLEELRKKDQILELQSKQAVMGEMISMIAHQWRQPLSNITLQIANLQLKHMLDKERRCR
FT                   DVDDALTNISNTIIYLSDTIDDFQTYFCPNKKMDTIEIHELFQRAVNFSQSRVQDNDIK
FT                   ISINKEIKISITVYINELIQVILNILNNAIDAHNEVKPKNPSIIMDATDDDENISLLIT
FT                   DNAGGIDDEHMSHLFEPYYSTKGKNGTGLGLYMSKMIVEKQFNGEIDVQTSSVGSTFII
FT                   KIPKNIK"
FT   gene            467241..468221
FT                   /locus_tag="Suden_0464"
FT                   /old_locus_tag="Tmden_0464"
FT   CDS_pept        467241..468221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0464"
FT                   /old_locus_tag="Tmden_0464"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43745"
FT                   /db_xref="GOA:Q30TD6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43745.1"
FT                   /translation="MYLKDLKFSLWADFIERDYLDNEFKELIDKKIINGATSNPAIFKN
FT                   AILSSSAYKEQLLSLKALSPKEKYEAVAVYDIQKAADILKPLYDAGDDGYVSIEVDPFL
FT                   CDDADATIKEGKRLYKSIGRANVMIKIPATEAGYIAMRSLTSKGIPVNATLIFKKEQAL
FT                   SCAKAFSEGVKEFGSSVDTVISVFVSRIDRALDEILAKAKIKRALSGIYNSAEIYEAVQ
FT                   RLDVEGCRVLFASTGVKDDSLPPHYYIEGLLAYNSINTAPVDTIKAFHANGSKIASLPI
FT                   SSEKIREHFEAIKFLGIDFDAILDKQIEDGLQSFKDAFEDILKSL"
FT   gene            468354..468890
FT                   /locus_tag="Suden_0465"
FT                   /old_locus_tag="Tmden_0465"
FT   CDS_pept        468354..468890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0465"
FT                   /old_locus_tag="Tmden_0465"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43746"
FT                   /db_xref="GOA:Q30TD5"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43746.1"
FT                   /translation="MLEGIIRESIGKKGTKALRRDGYLIANIYGKGLQNLHAAFKENEY
FT                   IRTVRNKETLSFPIKVDSKEMNVVVQAYEAHPVTGKLLHVDLMVAQPNVVTHYHVPVVT
FT                   EGDAIGLKNKGLIHISKPRLRVKATIENTPNSIVVDVTKMDVGDAKMVRDIAKIANVTF
FT                   TDADRVSVLSVIKAK"
FT   gene            468894..469448
FT                   /locus_tag="Suden_0466"
FT                   /old_locus_tag="Tmden_0466"
FT   CDS_pept        468894..469448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0466"
FT                   /old_locus_tag="Tmden_0466"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43747"
FT                   /db_xref="GOA:Q30TD4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43747.1"
FT                   /translation="MLIVGLGNPGANYERTRHNIGFMVIDELVKKQNAQKISSSFDGTL
FT                   FKFSNHFLLKPLTFMNLSGSAIRDVKQFYKIDEVVVIHDDLDLPFGTLRFKKGGGHGGH
FT                   NGLRSTDEHISKEYIRVRMGIGKPEHKGEVASYVLSNFTKDEQAHLDEFITFTCKAIEA
FT                   LLTNTLEDVSSKYTIKNFPLK"
FT   gene            469479..470558
FT                   /locus_tag="Suden_0467"
FT                   /old_locus_tag="Tmden_0467"
FT   CDS_pept        469479..470558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0467"
FT                   /old_locus_tag="Tmden_0467"
FT                   /product="permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43748"
FT                   /db_xref="GOA:Q30TD3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43748.1"
FT                   /translation="MLVFKYITFHYIRYFIIILLALVLFLVGFDYMGNTEKLDISANLF
FT                   LIYVVYKTFYAIDMLLPLSLIFAMISTKIFLIRSNALVSFYSLGYSRIDILKPFVVVAT
FT                   AMITLFISLHSISNFARADEFAKNIRKNAQYLSPTRDLFFTYKDKFVYFSKLLPLQESA
FT                   ENIRVFSFVDNSLKEVLVAKRASYRNDAWLIKMADIITKPDDISFDSLGIKVTQKDNLE
FT                   ILQGFRPKMLDQVYEGKVNFSIKDAIDAYWLLRDQNINTNIVKSALYKIFVYPFFVPSL
FT                   VVIIFFFVPVSVRFLNVSLFSFAAIISSLMIWAFLFSLVELSNHKTIPSELGIVLPNLL
FT                   LFLFALRQWIKYRTSPISD"
FT   gene            470650..471861
FT                   /locus_tag="Suden_0468"
FT                   /old_locus_tag="Tmden_0468"
FT   CDS_pept        470650..471861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0468"
FT                   /old_locus_tag="Tmden_0468"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43749"
FT                   /db_xref="GOA:Q30TD2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43749.1"
FT                   /translation="MINFKELAATYKTPLYVYDLDYMSAQYEELKSAFKGRKSIMAFAI
FT                   KSNSNLSVIKHFATLGSGADCVSIGEVYRAVLAGVPNYKIIFSGVGKSDDEITQAIKLD
FT                   ILYINVESEAELGRVELIAKELGAKCRISIRVNPNIDPQTHPYISTGLHDNKFGVEIDT
FT                   AKRMYIKANNSEYLDPVGIHFHIGSQLTELKPIYESAEIVADLVRSLQNIKIELKFFDI
FT                   GGGLGVKYKDETTITPYDYAQAILSTLKGLDLTVICEPGRFLTANGGYFLTKVLYEKRN
FT                   GDKRFVVVDGGMNDLLRPSLYKAYHKIEAITESLTKLSEADVVGPVCESGDFFAKGYLL
FT                   PTLEHNDLLVIHSAGAYGFGMGSNYNTRGRSAEVAIKGKEVKLIRKREEFEDLIALEKE
FT                   YLDN"
FT   gene            471863..472639
FT                   /locus_tag="Suden_0469"
FT                   /old_locus_tag="Tmden_0469"
FT   CDS_pept        471863..472639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0469"
FT                   /old_locus_tag="Tmden_0469"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43750"
FT                   /db_xref="GOA:Q30TD1"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43750.1"
FT                   /translation="MYFIDVQGTLISDSDKSPVRGSREFIDELNKRKIPYMIITNSTKK
FT                   APIDFFNFLKAKGFNIEFSSYLDPLMLLESHVEKSAVAPYGADEFLDVLKKMGYIFNYK
FT                   NPKTVLISIKENYTSEEFAQIIDFILAGASLVGMHETSIYAKNSKRYPGVGAILKLLEF
FT                   ATSTSYTVVGKPSEAFYSEALMLLCKQKSGVKFSDVTIISDDVKGDLGGAKELGMKTIF
FT                   VTSGKYKSADEIVPFLKPELKPDYVYADMQEILEKI"
FT   gene            472636..473727
FT                   /locus_tag="Suden_0470"
FT                   /old_locus_tag="Tmden_0470"
FT   CDS_pept        472636..473727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0470"
FT                   /old_locus_tag="Tmden_0470"
FT                   /product="chorismate mutase / prephenate dehydratase"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43751"
FT                   /db_xref="GOA:Q30TD0"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43751.1"
FT                   /translation="MKTLEECRDGIDAIDNKILELLNQRMVVVKRVGEIKKDSKSAIYR
FT                   PEREKAIIERLTLQSVNDKGLLNQDAIEAIFLEIFAVSRNLELPERIAYLGPEGSFTHQ
FT                   AAESRFGAMSDYMPMRSISHVFKELETKRAKFGVVPIENSRDGVVGETLDLLAKSSVKI
FT                   VAELYMPIHMSFVTKAKKISDITKIYSRDKGFGQCREFLQEHNLSNVELIPVESTAKAA
FT                   ILASKDDSAAAICSHIAAKLYNVPTMFDHVEDSIGSQTRFFILSDFKNEKSYDDKTSIL
FT                   VRLKDSVKAGSLVHFLQDFEHESINLSKIESRPSKEKGGFEYWFFIDFYGHVDDEKFQK
FT                   VLQKHKEEVTWLGSYVKGEEIEV"
FT   gene            473717..474811
FT                   /locus_tag="Suden_0471"
FT                   /old_locus_tag="Tmden_0471"
FT   CDS_pept        473717..474811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0471"
FT                   /old_locus_tag="Tmden_0471"
FT                   /product="histidinol phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43752"
FT                   /db_xref="GOA:Q30TC9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43752.1"
FT                   /translation="MKFNKHLQNIKTYEAGKPIELVVREYGIEPQDIVKLASNENPLGC
FT                   SPKVIDAVGKILTKMSLYPDDSMISLKNALSKRYNVDSENVIIGSGSDQVIEFLIHAKA
FT                   HSGSKILMNSITFAMYEIYSKHVGADVIRTSSQEHDLDEFYELYKQEKPEIIFICTPNN
FT                   PTGDALDAQKIYNFLEKIDNDTLVVVDAAYMEYAIVKDAKKEINVKELIQKHSNVIYLG
FT                   TFSKAYGLGGMRVGYGISEAKIIKELYKLRPPFNITTLSLEAATVALSDEEFVQKSTAL
FT                   NLEQMKRYEEFAKEQKIDIINSYTNFVTLSLGSNQNSTKIASQLLQNGMIVRDLSSYNM
FT                   NAIRVTIGTQEQNSRFFKLVIKFL"
FT   gene            474830..476530
FT                   /locus_tag="Suden_0472"
FT                   /old_locus_tag="Tmden_0472"
FT   CDS_pept        474830..476530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0472"
FT                   /old_locus_tag="Tmden_0472"
FT                   /product="Flagellar FliF M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43753"
FT                   /db_xref="GOA:Q30TC8"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43753.1"
FT                   /translation="MDFKVLFSQLATLYDKLTKQQKLIISGAVVGIVAFIVFLVVYTEK
FT                   RDALSKYETLFDSLSSEDAAKVIEQLEKDNIPYEILDNNIIKVPKNAVYKERIAIASLG
FT                   IPKNSGVGFELFDKQEFGATSFDQNVKYLRAIEGELSRTINSLAPIESASVSLALPKET
FT                   LFVEKQGEPTASVMITLIEGRKLSSKQIRGIKNLVSAAVPNLSASNVMLIDNDGETLGD
FT                   DDEMAQMGELSSVQQNFKTKEEKKKQRKIIEVVSPFVGGEQKVVAQVTIEFDFSIQNST
FT                   SEVYDPENVVRSEQLSEEKRDGSAPAEVGGVPGTVSNIGPVEGLASNKTIEKYEKNTGT
FT                   TNYEVGKTVSTTKSEFARIKRVTAAVVVDGKYNYKSDADGKPTSELEYEALSESDLEAL
FT                   RALVSRSIGISEDRGDQISVQNLQFKRADSDPSKERVNQVVSFSQTYLAPFSELFKYIF
FT                   VLLLLLILYKKVISPFAQRMLEISKEEDDIGKPILDIEDDEDEDLVEKVQSMRKKVEEQ
FT                   LGVGNHFNEDELKYDVLLEKIKSMTDESPEAVAHVLQALLTEESDVTTK"
FT   gene            476549..477577
FT                   /locus_tag="Suden_0473"
FT                   /old_locus_tag="Tmden_0473"
FT   CDS_pept        476549..477577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0473"
FT                   /old_locus_tag="Tmden_0473"
FT                   /product="Flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43754"
FT                   /db_xref="GOA:Q30TC7"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43754.1"
FT                   /translation="MTLNPTQQAKFDEMSMGQKVAILLMQMGEDATAAIFSNMSIDAIT
FT                   EVSKHIATNKSVEKSVATAILEEFYAIFQSGQFITAGGLEYARELLYRTLGPEEAKKIL
FT                   EKLSKSMQETQNFAYLSKIKPQQLSDFIINEHPQTIALIMAHMDATEAADTLHFFPDDL
FT                   RSEVSMRMAKLGDISPSVIKRVSAVLESKLESLASYKVEVGGPRAVADIFNRLGAKASK
FT                   ETLAKIEERDEEMSNQIKEMMFTFEDIAKLDKNAITEILKAIDKPDLMLGLKSAPEDLK
FT                   QKFFSAMSERAKEAFEEEMQFMGAVKMKDVEGAQRRIVEIVNGLAEAGTIQLGTSSEEM
FT                   VE"
FT   gene            477579..478373
FT                   /locus_tag="Suden_0474"
FT                   /old_locus_tag="Tmden_0474"
FT   CDS_pept        477579..478373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0474"
FT                   /old_locus_tag="Tmden_0474"
FT                   /product="putative flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43755"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43755.1"
FT                   /translation="MTNIISSEKINRHKVDKYNFKVLSVTEELNTEIPQSNVFANDSFV
FT                   DNNESIKEREVDSSSMTQSSKDSLIESLLNKTDEMSSNFIKLQMKLENMTQEHKEELQK
FT                   TKEDSFALGIEAGVEKALKDDKNSIASVMTQYNASIQKLEKNATEFESALEKIKEELIG
FT                   AALDISKEVLKVELSENSHKVAILLAKELIKELQTSSKITLRVNSKDHGEVSQALGSLA
FT                   HVEIISDSAVSVGGVIAISEAGNIDAQISKRFERVKRAALSE"
FT   gene            478383..480203
FT                   /locus_tag="Suden_0475"
FT                   /old_locus_tag="Tmden_0475"
FT   CDS_pept        478383..480203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0475"
FT                   /old_locus_tag="Tmden_0475"
FT                   /product="1-Deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43756"
FT                   /db_xref="GOA:Q30TC5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43756.1"
FT                   /translation="MNIKASRIKELETLCKNIREEILRVVSKNGGHLSSTLGATEIIVA
FT                   MHEVFDSKKDPFIFDVSHQSYAHKLLTGRWDKFDTLREFNGLCGYTKPSESEHDYFVAG
FT                   HSSTSISLGVGAAKAIALKGEQNSRIPVIMIGDGSMTAGMVYEALNELGERKYPMVIIL
FT                   NDNEMSISKPIGAISRILSSAMASPFYQNFKKHTENFVDNFGDGARYIAKRMEESLKLI
FT                   TPGIMFEEMGIDYIGPVDGHNIASLIEILQKAKELKKPVIVHAQTLKGKGYEIAEGKDE
FT                   KWHGVGPFDLDSGAASKKSSAKSATQIYAEALLHLAKNNDKIVGATAAMPSGTGLSELI
FT                   ELYPNRFWDVAIAEQHAVTSMAALAKEGFKPFCTIYSTFLQRGYDQVIHDTCLMNLPVV
FT                   FALDRAGIVGEDGETHQGVFDVSFLRAIPNMTLFAPRDEKSFHQAMAFAAQYQFPCSLR
FT                   YPRGSFTQTSLPESSPFELAKSQLLQSNKGDVLFIGYGNGVGRAYETSKLLEEKISILD
FT                   LRFIKPLDKEMLRDMATKHNKWFIFSDSAKMGGVGSAILEFFADEKILHVELESFEYED
FT                   SFITHGKTKDVEESLGLLPAQLAQKVKALI"
FT   gene            complement(480195..480917)
FT                   /locus_tag="Suden_0476"
FT                   /old_locus_tag="Tmden_0476"
FT   CDS_pept        complement(480195..480917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0476"
FT                   /old_locus_tag="Tmden_0476"
FT                   /product="Protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43757"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43757.1"
FT                   /translation="MKFYYSKKLAQFPNITHAFTTKHSKNLAFHVDDNELDVEKNHLLL
FT                   AKELSYSKDSLVYMKQIHSDIVHVVTDEEFKAPPTCDALITNKPNTPLMVMVADCSPML
FT                   FYDSEKKVIAALHAGRQGAFKNIVKKCIESFIDDFKSEAKNIHVSVGASIGVCCYEVGV
FT                   EIYNEAKGLGLEYALDIRDEKYYLDVNKILKSQLLSCNVKEENIEFLNECTCCNTKTYF
FT                   SYRAEQKTGRFSGVIILN"
FT   gene            480946..483051
FT                   /locus_tag="Suden_0477"
FT                   /old_locus_tag="Tmden_0477"
FT   CDS_pept        480946..483051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0477"
FT                   /old_locus_tag="Tmden_0477"
FT                   /product="Protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43758"
FT                   /db_xref="GOA:Q30TC3"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43758.1"
FT                   /translation="MSRLSLYPVTLDGTDEHKKRQEIREYFRNTFSLFEKVFEVLINDE
FT                   VFYNKSEITRHPMIFYFGHTATFFINKLINMKIIKQRINPEFESIFAVGVDEMAWDDTQ
FT                   SANYMWPKVGEVREYRNRVREIVDELISTLPMPLPITDNSPMWIILMGIEHERIHVETS
FT                   LVLHRQMPIEFVKDVKEFNLCSHSAQAPQNSMIELRGKSVLLGKEKSHNLYGWDNEYGK
FT                   YEESVEDFKASKFLVSNGEFMEFVQEGGYTNDEFWDEEGKKFLEISGAKYPTFWIKDED
FT                   TYMYRTLSKIIEMPYNWPVDVNALEAEAFCRYKSKKDGVKYSLPSEAEYRVIYDYAKLE
FT                   DIPDFHESRANLNFYHYSSSCPVDEFSFNGIYDVVGNVWQWSRTPIFGFEGFVVHEAYD
FT                   DFSTPTFDNKHALILGSSWASSGNLIMKYSRYAFRRHFYQNAGFRYVISNSKIKTQSDV
FT                   YESDELVSQYCEFQYGDDSFGVKNFALESVKIATKFVKNRTKALDLGCATGRATFELAR
FT                   TFDEVEGVDFSARFIGVGVKLKNDDYIAYRVKTEGDLSVDKKISIEELGYENIRDRVSF
FT                   WQGDACNLKPNFNSYNLILAKNIIDRLYNPKLFLGNVHERLESGGILVLTSPYTWQESS
FT                   TKREFWLGGYKDENGTEVKTMDTLKSILGKNFELLHVEDLEFVIKETARKFQHSIAEVS
FT                   VWRKIDL"
FT   gene            483139..485865
FT                   /locus_tag="Suden_0478"
FT                   /old_locus_tag="Tmden_0478"
FT   CDS_pept        483139..485865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0478"
FT                   /old_locus_tag="Tmden_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43759"
FT                   /db_xref="GOA:Q30TC2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43759.1"
FT                   /translation="MISLREIRERSIKFAKEWEGASHEKQEAQSFWIDFFKIFDVSPRS
FT                   MQFEYPIKKIDGSYGYIDVFWRGQLLIEQKSRGKDLVKAKEQALEYLPNLKQRDLPKFI
FT                   LVCDFVSFYLYDLDTNQDYKFLLHELPKNIELFSFIAGYTKKTYKEEEPTNRKAAELMG
FT                   KLHDKLLENGYSGHQLELFLTRLLFCMFAEDTGIFAKNSFREFIENQTDESGRDLGSQI
FT                   SYLFELFDTPNEERQKNLDESFTQFPYINGSIFTEQLKTAHFDRSMREMLLDACAFDWS
FT                   LISPSIFGSMFQASMDVSKRGELGAHFTSETNILKAIKPLFLDELSEEFAKIKNNPKQL
FT                   QIFHAKISNLKFLDPACGSGNFLVIAYRELKLVEFEVLKSLKILTQLVHIDQFYGFEIE
FT                   ELPSRITQTAMLLIDHQMNLLFAQMFGEPHFNIPIKDSANIFNVNALRVDWEKILDGVK
FT                   IDFIIGNPPFLGSKMQSKEQKEDMAEVFSGVKNGKELDFVTAWYIKSAKYLQGKNTKVA
FT                   LVSTNSITQGEQVGILWQEMFNKYKIKIHFAHKTFKWNNDAKGVAQVYCVIIGFAGFDI
FT                   KEKRLFEYESVKSEPHEIKVANINPYLVNGDDFFISSRRKHIQSFIPQIVFGSMPNDGG
FT                   NLLFDDKEKEEFLALEPKAELYMKPLISAKEYLNGKTRWCLWLKDCPPNELKSMPKVIE
FT                   RVENIRKLRNESSREATQKLAKFPALFGEDRQPESDYIFIPRVSSENRDYIPMEFFTKD
FT                   FICGDTGLAVPNATLFHFGILTSKMHMDWVRYVAGRLKSDYRYSNEIVYNNFPFPLEIN
FT                   DKQKDQIEQLAQNILDIRAEFVGSSLADLYNPLTMPPKLLKAHETLDRAVDKLYSKTLF
FT                   KTDTERVAHLFELNKQLTSLIVENEKKAKKVKKIITK"
FT   gene            485931..486467
FT                   /pseudo
FT                   /locus_tag="Suden_0479"
FT                   /old_locus_tag="Tmden_0479"
FT   gene            486513..487328
FT                   /locus_tag="Suden_0480"
FT                   /old_locus_tag="Tmden_0480"
FT   CDS_pept        486513..487328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0480"
FT                   /old_locus_tag="Tmden_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43760"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43760.1"
FT                   /translation="MAKIIVQEQEITILKINNEDYISLTDMLRAKDGDFFISDWLRNRN
FT                   TIEYLGIWEKIYNPDFNYGEFAIIKSQAGLNSYKLSVKEWSEKTNAIGLIAKAGRYGGT
FT                   YAHQDIAFEFGMWISAEFKIYLIKEFQRLKEQEFTQCGWDIRRNLTKMNYRIHTDAIKE
FT                   NLIPKELTPLQINFVYASEADILNVALFGMTAKEWRDKNQTSKGNIRDEADVNQLVCLA
FT                   NLESLNAHFIHEGLSQNERLQKLNHLAITQMKILSSDNQRELESLGKIK"
FT   gene            487420..488604
FT                   /locus_tag="Suden_0481"
FT                   /old_locus_tag="Tmden_0481"
FT   CDS_pept        487420..488604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0481"
FT                   /old_locus_tag="Tmden_0481"
FT                   /product="Aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43761"
FT                   /db_xref="GOA:Q30TC0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43761.1"
FT                   /translation="MKYTFQTSTCRENTNAEKYVLREKLFGTNEVMPLWVADMDIDTPD
FT                   FVLDAVRKRLEHQIVGYEELPQSAFLAQIEWMKKEHGVEFALEEMLYSHSVVASMNVAI
FT                   EAFTEKGDKVIVQTPVYPPFFHSVIEHERELLKNPLKLRDDGTYTFDIEDLKSKINEKT
FT                   KLLLLCSPHNPVGRVWRREELEQILELCVKHNIVVFSDEIHSDLVYAPNVHIPFASLSA
FT                   DARDITVTAIGIGKSFNMAGFAISSVAIQNKILRENFLKVYNRTHFANGSTLSHVAFEA
FT                   AYRDGKEWLEELKIHLYKNFYMLDELCKKYPHYIKLTPIEGTYLAWLDCRGLGFGDREL
FT                   RDFFIHKAGLGLSAGISFGREGSGFMRLNFAISSDKMLEVIKKLDEALLLKCRQ"
FT   gene            488647..488883
FT                   /locus_tag="Suden_0482"
FT                   /old_locus_tag="Tmden_0482"
FT   CDS_pept        488647..488883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0482"
FT                   /old_locus_tag="Tmden_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43762"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43762.1"
FT                   /translation="MVEINWEDFKFFKQYSNKKNDNFEILLDFLKNYCKITSPKEMFET
FT                   MLNDETAQLMLKKREMYTLEDLERHLYKDFNAK"
FT   gene            488873..489301
FT                   /locus_tag="Suden_0483"
FT                   /old_locus_tag="Tmden_0483"
FT   CDS_pept        488873..489301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0483"
FT                   /old_locus_tag="Tmden_0483"
FT                   /product="Pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43763"
FT                   /db_xref="GOA:Q30TB8"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43763.1"
FT                   /translation="MQNNLLKIEAFLQKHHVLSLCTTDALELSACNLFYVFDVLSNSFV
FT                   VASSDETTHVKNILQNPKVAGTVVLETKAVGKIEGVQFRGDFLALEDNALKKLYFSHFP
FT                   YALAMNPKLWQIKINYFKLTDNRLGFGKKIIWKRNSLE"
FT   gene            489556..490248
FT                   /locus_tag="Suden_0484"
FT                   /old_locus_tag="Tmden_0484"
FT   CDS_pept        489556..490248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0484"
FT                   /old_locus_tag="Tmden_0484"
FT                   /product="putative dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43764"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43764.1"
FT                   /translation="MDKILLMLQLQATLNEATNGDGWTSGVTKNSKVINWKRCIYMECA
FT                   EMIGSFSWKHWKNIDQEADWANLQIEVVDVWHFIMSLAIENYANSHKGGVEELALDISE
FT                   LENFCKIDTKNELFASQDEIMQKVESIIFNVLNRDNFELEKLIEEFFDLVVMSGLDLET
FT                   LYKLYVGKNILNQFRQDNGYKDGSYIKVWAGEEDNVVMKRVLDESSNFSPNELYNELTK
FT                   LYLSLNKS"
FT   gene            490250..490819
FT                   /locus_tag="Suden_0485"
FT                   /old_locus_tag="Tmden_0485"
FT   CDS_pept        490250..490819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0485"
FT                   /old_locus_tag="Tmden_0485"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43765"
FT                   /db_xref="GOA:Q30TB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43765.1"
FT                   /translation="MYSVLEVENLSFGYKKDFLLFDNLSFTLKKGEIKAIVGASGAGKS
FT                   TLFELILKNLRPFSGTVQSSFCSEVFQDPYSSFHPSYTLLNQINEVAKVDELETYIKKL
FT                   NLDYELLLKLPHELSGGQLQRASILRAMLMKPDLLLLDEPTSALDNITQLEVMKMFLDN
FT                   LENMGMLLITHDLDLAKWCADEIIML"
FT   gene            complement(490809..491201)
FT                   /locus_tag="Suden_0486"
FT                   /old_locus_tag="Tmden_0486"
FT   CDS_pept        complement(490809..491201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0486"
FT                   /old_locus_tag="Tmden_0486"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43766"
FT                   /db_xref="GOA:Q30TB5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43766.1"
FT                   /translation="MMSWQTILAIGSGGFIGAVLRAYFNGIISHKMPHDIPFGTLGVNL
FT                   VGSFIMGILIAYFMYSTIFSLHVKSFLSTGVLGALTTYSTFAIESFLLLNSGHIALALA
FT                   NISLNAFGSILMAGGGFYIIKLSLRA"
FT   gene            complement(491167..491865)
FT                   /locus_tag="Suden_0487"
FT                   /old_locus_tag="Tmden_0487"
FT   CDS_pept        complement(491167..491865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0487"
FT                   /old_locus_tag="Tmden_0487"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43767"
FT                   /db_xref="GOA:Q30TB4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43767.1"
FT                   /translation="MKIFAHISWLFATIIILASLTIMIVTFYIFPKPYSRKLAAWLIRL
FT                   TIFFTTSIKGKEDPNTQLFLINHQSDLDIAVIETVSNRDIAWVAKKELFDIPFFGLALR
FT                   LPKDIAVQRDSKTSLIKLLKDAKNVLSTNRAIAMFPEGTRSSKGVMLPFKSGAKLLADS
FT                   NSLIVQPVVLIESAKRYNTKEFYYKPGCIKVIFLDSFVADKKDSEWLNNLRVKMQKVYD
FT                   DELANNSSNR"
FT   gene            complement(491843..492988)
FT                   /locus_tag="Suden_0488"
FT                   /old_locus_tag="Tmden_0488"
FT   CDS_pept        complement(491843..492988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0488"
FT                   /old_locus_tag="Tmden_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43768"
FT                   /db_xref="GOA:Q30TB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43768.1"
FT                   /translation="MIKFLLAWLFFHALLFANIDDANNIQTSTQKQEFGGEDVPYEENL
FT                   DTLSKVIYLNYEKIPQRVLKGEIFSITIKNLCVVKNFVDITYKLSNETGLKILNPLPSR
FT                   QKDSKYYYDTFYFIATSQNAKLPDFEATLIDTGEKAYKTTILSGEKLNVISLNPKSDFS
FT                   NIIANSFDIIEYKTTSYDATHNIVVFVATAINSDISALKLNGVYKQGIESATHTGNDSK
FT                   ITYYAIVGKSMSNLSFSYFNVLKNRFIFVNIPLIVSDDSVTTQSDLKPTDQSNEMIKMG
FT                   VAATVAFLAFLIILWRKRYIYLIFIFIPLGYILSIALPSKEVCVKEGSSIYLLPMNNGT
FT                   IFEKAASQYNLQKEAEVNGWIKVQLNNKKIGWVKNEDICSH"
FT   gene            complement(492985..493659)
FT                   /locus_tag="Suden_0489"
FT                   /old_locus_tag="Tmden_0489"
FT   CDS_pept        complement(492985..493659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0489"
FT                   /old_locus_tag="Tmden_0489"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43769"
FT                   /db_xref="GOA:Q30TB2"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43769.1"
FT                   /translation="MKVTILQFPGTNCEYDAQHAFKSLGAETEILWHKSDTIPSDTDLL
FT                   IVAGGFSYGDYLRSGAIAKFSPVMKAVIKYADDGGKVLGICNGFQVLTESGLLPGALKR
FT                   NESLHFLSKHHHLKVINNENIFLEKLDKGDIVNIPIAHHDGNYYIDDSGLKELYANNQV
FT                   LLKYCDENGNDKNPNGSIDSIAGICNKERNVFGLMPHPERAMEAILGSDDGIKMLQGFL
FT                   RA"
FT   gene            complement(493656..493898)
FT                   /locus_tag="Suden_0490"
FT                   /old_locus_tag="Tmden_0490"
FT   CDS_pept        complement(493656..493898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0490"
FT                   /old_locus_tag="Tmden_0490"
FT                   /product="Phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43770"
FT                   /db_xref="GOA:Q30TB1"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43770.1"
FT                   /translation="MKVVVNVFLKAGVLDSQGKAVHHALKSIHFENVSDVRVGKQIVLK
FT                   LNESDEKKAMEDVTRMCEDLLANTVIEDYTIEIVK"
FT   gene            complement(493930..494643)
FT                   /locus_tag="Suden_0491"
FT                   /old_locus_tag="Tmden_0491"
FT   CDS_pept        complement(493930..494643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0491"
FT                   /old_locus_tag="Tmden_0491"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43771"
FT                   /db_xref="GOA:Q30TB0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43771.1"
FT                   /translation="MEKRELIYEGKAKKLFSTDDENLLISEFKDDLTAFNGEKKSSEVG
FT                   KGALNNKISTELFKLLEKSGIQTHFVKMLDDNHLLHKKTKVILIEVIVRNIATGSLSKN
FT                   LGIKDGTVLPFTLVEFDYKNDALGDPKLNDQHALILGLVEYQDELDKLRRMARQINDIL
FT                   KPYFAQKGLNLVDFKLEFGKDSSGNIILIDEISPDNCRFWDIESGEKMDKDRFRQGLGG
FT                   LRVAYEQVLSRILAK"
FT   gene            complement(494645..495964)
FT                   /locus_tag="Suden_0492"
FT                   /old_locus_tag="Tmden_0492"
FT   CDS_pept        complement(494645..495964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0492"
FT                   /old_locus_tag="Tmden_0492"
FT                   /product="Peptidase S41A, C-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43772"
FT                   /db_xref="GOA:Q30TA9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43772.1"
FT                   /translation="MKNKKLITLGFASVTVALALLFSTNLFASVADKKEKSKEASRLEA
FT                   LAKFTKVISIVEQYNVDNVTIEELMNKALEGMMNNLDAHSNYLTQKDYKNLKVQTNGEF
FT                   GGLGITVGVKDGALTVIAPIEGTPADKAGIKAGDIILKINEKSTLNMTIDEAVSIMRGK
FT                   VGTKIELTIVREGETKPLAISITRGIITIESVYAKSVGTDIQYIRVTSFDKKVVTDVAK
FT                   AIKEKKATTKGIVLDLRNNPGGLLDQAVGLVDIFVDSGDIVSQKGRNKADDESYSAKSS
FT                   NTITKVPLVVLVNGGSASASEIVSGALQDHKRGIVVGQNTFGKGSVQVVLPITDEEAIK
FT                   LTVARYYLPSGRTIQAVGVKPDIEVFPGEVKSTKNEFALKEADLKKHLVEELEKVDGEQ
FT                   GAQLPEPDSKLVISNEMISKDLQLKTAIDILKALIITKGE"
FT   gene            496106..496546
FT                   /locus_tag="Suden_0493"
FT                   /old_locus_tag="Tmden_0493"
FT   CDS_pept        496106..496546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0493"
FT                   /old_locus_tag="Tmden_0493"
FT                   /product="Hemerythrin HHE cation binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43773"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43773.1"
FT                   /translation="MSSIKEYLSEDHGRCDELFAIMEDAAAKSIESAKEAYDEFAKNTE
FT                   RHFQMEERVMFLEFEQKTGMTQGPTAIMRHEHIQMRNLLEEMRKAIEAKDKDKFFGNSE
FT                   TLMILMQQHNMKEEQMLYTMAQQHLSADAERIIDMMNSMIVE"
FT   gene            496559..497857
FT                   /locus_tag="Suden_0494"
FT                   /old_locus_tag="Tmden_0494"
FT   CDS_pept        496559..497857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0494"
FT                   /old_locus_tag="Tmden_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43774"
FT                   /db_xref="GOA:Q30TA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43774.1"
FT                   /translation="MDFDGLSVDQAPPISAPLRFFLTAPLFAILAGVLILFSDVLTLSS
FT                   RYSIETIAVTHAITIGFLGFVMLGALVQMLPVLAGVKIPKVDIISKISYILLLFGALFM
FT                   IFGLWFSMSKIILLASLFLTCGFLILIISMLLAFRDVINVTASIRAMITSLFFALFITL
FT                   LGAHLLASYGVGKFSELHHVFANVHSVWAIFGFAGILIIGVAFHVLPMFYVAPRFKKFC
FT                   KKSVVLLITTGLGLWLFLNLFFDSYSTIAKIWIALFFWAFSTTVYLKLNARRRKVSDVT
FT                   VWYWKSAAIFMTLGTFAWSINDFFGEKYIVIVSVLIGGGFIFSIMSGMLYKIVPFLVWF
FT                   HLNAKGYMSIPTMNEMIDKRLSKAQFILFILSLVGFIFSFFIASLMPIFAVSFILSMAI
FT                   LEYNIVSVVLIYYKTLKRKPDFDMSMFTMKAEN"
FT   gene            497860..498375
FT                   /locus_tag="Suden_0495"
FT                   /old_locus_tag="Tmden_0495"
FT   CDS_pept        497860..498375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0495"
FT                   /old_locus_tag="Tmden_0495"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43775"
FT                   /db_xref="GOA:Q30TA6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43775.1"
FT                   /translation="MKNIVLIGFMGVGKGSVAREIIKLSDYMSVDTDDLIESMENRVIK
FT                   KIFEQSGEAYFRNLEKRVSLWLGQNVTNTLISTGGGFYKQDNLKEIGIVVFLNSPFEKI
FT                   LKRIKNHPNAVKKLKKRPLLKDLKKAKELYYERLPQYTAVADITIDVTDKSALDCAKEL
FT                   LLKVKQYA"
FT   gene            498368..498784
FT                   /locus_tag="Suden_0496"
FT                   /old_locus_tag="Tmden_0496"
FT   CDS_pept        498368..498784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0496"
FT                   /old_locus_tag="Tmden_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43776"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43776.1"
FT                   /translation="MRKFFIFLLMGILVNLMGSEIKWAKDYNEGIKSAQASSKPVLFVS
FT                   SRHSCKYCVVLDETTFKDKRVIEELNKSFVSIISYSDENDYMPRELWQPGTPAIWFLYS
FT                   KGEPMFQPLMGAIDPENFLKALAIVKEEFTKGKK"
FT   gene            498788..500080
FT                   /locus_tag="Suden_0497"
FT                   /old_locus_tag="Tmden_0497"
FT   CDS_pept        498788..500080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0497"
FT                   /old_locus_tag="Tmden_0497"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43777"
FT                   /db_xref="GOA:Q30TA4"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30TA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43777.1"
FT                   /translation="MIFTTSKNSSFKAEFKELLERGKMDIAHVSATVGTIIDEIKSNKN
FT                   QALKEHITKFDKWTPVSDEDLKISTESMSRAYENLDKALKAALHLSYDRIKAYHEKQKP
FT                   RSWFDDEPNGTILGQRVTPVDSAGLYIPGGKAAYPSSLLMNVIPAQVAGVQNIVVCTPT
FT                   PENEPNELLLAACHLCGVSEVYKVGGASAIAAMAYGTETIPKVDVITGPGNIFVATAKK
FT                   MVFGDVNIDMIAGPSEIGILADDSANPSHMAVDMLSQAEHDEMASSILITPSQKLADAI
FT                   KAEIENWLKILPRQKIARESIEKRGAIIVTSDMQEAIDLMNEIAPEHLEVATLSPFELL
FT                   PLIKHAGAIFLGHNTPEAVGDYMAGPNHTLPTGGTAKFFSPLGVENFMKKTSIISFSAK
FT                   AINEIGEECALIAKIEGLTAHEQSIRVRLVK"
FT   gene            500272..500910
FT                   /locus_tag="Suden_0498"
FT                   /old_locus_tag="Tmden_0498"
FT   CDS_pept        500272..500910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0498"
FT                   /old_locus_tag="Tmden_0498"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43778"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43778.1"
FT                   /translation="MQLGFLVDLHLCMGCKGCEIACKVENEVPLSTWRLRVKYVDVGTF
FT                   PETKRTFTPLRCNHCENAPCERICPVSALHYLENGIVNIDKERCIGCSGCVMACPYGAI
FT                   YIDPQTQTADKCTYCAHRVASSMMPACVVACPVQANIFGDLEDPTSNISKYIQLHQGGV
FT                   QVRKPEKGTNPHHYYVNAGNVSLNPLASHRVDGHSLFNKITTLPVGGHH"
FT   gene            500910..501809
FT                   /locus_tag="Suden_0499"
FT                   /old_locus_tag="Tmden_0499"
FT   CDS_pept        500910..501809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0499"
FT                   /old_locus_tag="Tmden_0499"
FT                   /product="NrfD-related membrane anchor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43779"
FT                   /db_xref="GOA:Q30TA2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43779.1"
FT                   /translation="MAHEILAATNAVVTLDVALPGIVWPWLVTVNMWAKSIGTGLIFML
FT                   FMLLRMHPESAKNLRFSTTVVAFVFINIFLLFTLADLHQPFRMWHIFVYSHWTSAIAIG
FT                   SVMASMYLGLLTLLGFLAFKKNDVLFDKVLLWTTILAIPVTLYTASLMAQCTARELWQM
FT                   PAESAQMILAALLAGSATMLLLGGNKLSSEAKNSLGVVLGLSALMAFIIYMSEYIFGPM
FT                   KAEEIAATIDYVKGNGEYAVMFWLGQWMTFILPMLLIVLSRASKSDAILKLAAILALVG
FT                   LAIVKHVWLMIPQLLPMS"
FT   gene            501822..505205
FT                   /locus_tag="Suden_0500"
FT                   /old_locus_tag="Tmden_0500"
FT   CDS_pept        501822..505205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0500"
FT                   /old_locus_tag="Tmden_0500"
FT                   /product="Molybdopterin-containing oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43780"
FT                   /db_xref="GOA:Q30TA1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43780.1"
FT                   /translation="MYLESRRTFLKGAAFTVAGATIAKGVFTTDVLAESVSNSKFTNTP
FT                   DTLSFYPPMSEWNDFKELDGDDWKRGGIDRHGVRSESNPEGIEVNDYMIVPTACSNCEA
FT                   SCGLTAWIDKKTFTVKKYMGNPLHPASRGRNCAKGYATQSQMYDPDRIAFPLKRAPGSA
FT                   RGEGKWIRTTWDEAMSTIGKKMRDTIKIGDDVSKKSVMYHVGRPNENGFVPAIWHSMGL
FT                   DAYNSHTNICSSNGRTGILHFANDDRPSPDWANAKLVFLNSSHAADAGHYYQQSASFIA
FT                   DARKKGAKLVVMDPRMSNSAGMADLWIAVWPGTEPAIYLYLVQRILNENKVDKDFVKKW
FT                   INWEVFLDNKKYLEFMVSKGYISKLPNGDQFEDFIDVLKELYSPYTLDYAVKETHVPAY
FT                   KLEALYDMFLWAGTSISTYFWRASAAGNRGGWTAGRTGYFALALRGAVGPEGGTFFHHW
FT                   HVISVAGKGGSSTIGQGKRGADVPKVDVYNELTYPPEWPISSYELSFLLPHLLTDTEWQ
FT                   KKWIDRGFSVPQKLSVYIPRMYNPVWINPDGFRWIEVLKDESKMELTMNLSPVWSETNW
FT                   YMDYVLPVGLAGERHDQHSEATMPARWTSFRQPVMRVALEKMGWKPKNPARGTLEAHIK
FT                   AGLGEVWEENEFWFELCVNYIDPTGELGIKKMWESKKNPGKPVTIAEWYDAAFGDNLPN
FT                   LKAAATTDERYKNSEFPVYEYMRDYGAWMEENHIYSPQEREIKDDGENYISHGHKYDKK
FT                   HVHIDKRTGVMSAEHDGKKTPMGIEIGGKKMEGFATLDKKLDFFCEWLADDWKWPEYAI
FT                   PFYPRSEEEKKEMVHIVSHVNHSFMTEENSYALNTVFRLPYNIHTRSANSKHLMEISQN
FT                   HDPIWISTKDATRQGFKRGDAIRVNIVDSLTGLESGYFVAMAVPTEGVLPGTLACSHHG
FT                   GRWKLVNSVAVPNGVTDGKVDAQPVLRNMNDPKFIAHSPENVGNEGAQIKIEDYSGKAG
FT                   INSFGVPTAEIQMDGKVGKLKYVEGIKPFKAERFAEYNRDSGNIWWDGLSGSWQNAVAA
FT                   AHPDPISGMHCWHQKVILEKAQAGDKIGDIHVNYDNNFKVYQGWRDKLTRGLDDNSTLR
FT                   RPEHLKRPWVPLSSKAYKIK"
FT   gene            complement(505253..505747)
FT                   /locus_tag="Suden_0501"
FT                   /old_locus_tag="Tmden_0501"
FT   CDS_pept        complement(505253..505747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0501"
FT                   /old_locus_tag="Tmden_0501"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43781"
FT                   /db_xref="GOA:Q30TA0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q30TA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43781.1"
FT                   /translation="MKNKLLNYSKEIFLFLIFITIFSNLLSLYRSNNLNQDSIDVNSFT
FT                   LMDGSSYMLSENKPILLHFWATWCPTCKAEAGNIETISKEFEVITIATKSGDNSNIQSY
FT                   LKSRNLTFKVVNDNNGSLAEKFNISVFPTTIIYDKNREIFYSDVGYTTTFGLWLRMWLA
FT                   K"
FT   gene            505848..506324
FT                   /locus_tag="Suden_0502"
FT                   /old_locus_tag="Tmden_0502"
FT   CDS_pept        505848..506324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0502"
FT                   /old_locus_tag="Tmden_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43782"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43782.1"
FT                   /translation="MSLLLLIGCSSQKEVVAKSAIFQSVSNDEALLLSKESDNGSCLRC
FT                   GMDLVKYYKTNHAASLDEKIYQYCSIHCLQDHLYDGVSLKNPQVVDINSLKFIGVDKAY
FT                   YVVGSNVKGTMSRISKYAFSSKEEAEIFQKKHGGEVMDFYKALEVATKDFKERR"
FT   gene            complement(506345..507994)
FT                   /locus_tag="Suden_0503"
FT                   /old_locus_tag="Tmden_0503"
FT   CDS_pept        complement(506345..507994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0503"
FT                   /old_locus_tag="Tmden_0503"
FT                   /product="Phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43783"
FT                   /db_xref="GOA:Q30T98"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43783.1"
FT                   /translation="MEFRTIDKLQKNALKRSATDFTRLGFAIFFMIVVLTFTFLNNGGI
FT                   PNSMFLAVAALIGAYMAMNIGANDVANNVGPAVGSKALTLTAAIIIAAIFEASGALIAG
FT                   GEVVKTIKNGIIDISAFDSHPEQFIWAMMAALLAAALWLNFATMMKAPVSTTHSIVGAV
FT                   MGAGIAAAGFHVVNWETMGSIVASWIISPILGGVIAALFLFAIKKSIIFKDDKVEAAKK
FT                   YVPFFVAIMSLAFVAYIILKGLKSIWPKIIDILNFIPFVSLQTTNDPTFMTAFSIGLIV
FT                   AIFVYFFVKKRLYSGLTALENTKESVNTLFTIPLIFAAALLSFAHGANDVANAIGPLAA
FT                   INDAVINGGVSASASIPLWVMGVGAFGIALGLALYGPKLIKTVGSEITDLDQIRAFSIA
FT                   MSASLTVILASQLGLPVSSTHIAIGGIFGVGFLREWLHIKDENNHTIEEDTLIIMDEEL
FT                   NKSAYKHELKILQDKSDKTQSDYTRIVNLYKLIADEKKIIKSTKKNIKKAKKVQYVRRD
FT                   AIKKIVAAWLITVPAAAILAGTLFFTIKGIMI"
FT   gene            complement(508067..508612)
FT                   /locus_tag="Suden_0504"
FT                   /old_locus_tag="Tmden_0504"
FT   CDS_pept        complement(508067..508612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0504"
FT                   /old_locus_tag="Tmden_0504"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43784"
FT                   /db_xref="GOA:Q30T97"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43784.1"
FT                   /translation="MRKIAVAILMILSINLYAQEKNPHVVLETTQGVIEIELFEEVAPL
FT                   AVENFITHVKNGYYDGLTFHRIIKNFMIQGGDPTGTGRGGESIWNKPFKDEFKGKLFDK
FT                   SGILAMANAGPHSNGSQFFITTTPTPWLNGRHTIFGQVTPQSLLIVNKLENVATLGQMG
FT                   MDKPIETQKIIKAFVKKD"
FT   gene            complement(508751..509035)
FT                   /locus_tag="Suden_0505"
FT                   /old_locus_tag="Tmden_0505"
FT   CDS_pept        complement(508751..509035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0505"
FT                   /old_locus_tag="Tmden_0505"
FT                   /product="Histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43785"
FT                   /db_xref="GOA:Q30T96"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43785.1"
FT                   /translation="MNKAQFVELVQASGNYKTKVEAEAAIKAFTEAVASALVKKEDVSL
FT                   VGFGSFGASLQKGKSGKVPGTDKTYTTKDKMVPKFKAGKGLKDRVAAGK"
FT   gene            complement(509370..509609)
FT                   /locus_tag="Suden_0506"
FT                   /old_locus_tag="Tmden_0506"
FT   CDS_pept        complement(509370..509609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0506"
FT                   /old_locus_tag="Tmden_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43786"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43786.1"
FT                   /translation="MQINDLFNILHNSIEAKNNGKKISLKDMADSLGIPMRTYQDWKLA
FT                   RAKPQAAITVMQMLGRLEDEEIIRTVRKINKLKD"
FT   gene            complement(509836..511515)
FT                   /locus_tag="Suden_0507"
FT                   /old_locus_tag="Tmden_0507"
FT   CDS_pept        complement(509836..511515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0507"
FT                   /old_locus_tag="Tmden_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43787"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43787.1"
FT                   /translation="MIIVICLLTKRFKTKNINATIKKFALENDCSPLEFTFNINGVETY
FT                   LKNVSQKDFLLYTEDIFDYFNNHQKMINEHVEIKQIFLITIKQTPKNIIKLDYSIEFSP
FT                   NKDSVHIVLYPESQIPYKKYQPKEIYLLLLKELNNIKALNNILINIFDNEMKEKLKQFV
FT                   KYIYAGKFIKKIKIPLYIGIEPDITRESRLLFRFLNKKSNHQVIEVAEDEILVEFIKPL
FT                   FGKNGFNAFGEIIDNFYLKNIDDLKYNVDENSIKIIENSDRKIYKSKLKGYVHLDDKNF
FT                   YVDNKIEIESLSRVQNRIAKDESNNIEVIISQHDTSLDSLGEGVELTSETININGHVGA
FT                   KSTLRAVNLTIDGATHQDSYQEAKFANINRHKGKLRCHDAKIKLLEGGEVHATNVDIQN
FT                   SLSGTIYAENVTIHQVKNNLKIYASNSITIDIVSGEDNLFKINYKDIPTLISKYNYLSQ
FT                   EIEDLKYKLEGAKKHSPLKVPALKEKIDELKVAQDKITTSSMNAKIIIKNSFRGLNTII
FT                   FTLNNNEELIFKTEATTYEPFYIVESQEYLTLHPTNKKIAKG"
FT   gene            complement(511487..512173)
FT                   /locus_tag="Suden_0508"
FT                   /old_locus_tag="Tmden_0508"
FT   CDS_pept        complement(511487..512173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0508"
FT                   /old_locus_tag="Tmden_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43788"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43788.1"
FT                   /translation="MRLTIDEYCKHFKMSKEMLNSKIRAKKLNYIIEDSTTFIIVTNTP
FT                   SITEKNEEIIEESKSVASQNTQISKPKITIATVLTLFQKENTFLKNKINKLEDKIDKLI
FT                   NDKEQMLRAERDKIEQIYSSKDEQLKNILTLVNKKIRIEREKEPLEKSNILEDFTHQGE
FT                   AELVHNLNFIELKEYLKSLDIKSSQRKIIKKRFLDAYDNDSRVIHRDGKLYLDLSKYDY
FT                   SDLLAY"
FT   gene            512289..513362
FT                   /locus_tag="Suden_0509"
FT                   /old_locus_tag="Tmden_0509"
FT   CDS_pept        512289..513362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0509"
FT                   /old_locus_tag="Tmden_0509"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43789"
FT                   /db_xref="GOA:Q30T92"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43789.1"
FT                   /translation="MGILDIVKAGVLFGDDVKKVYQHAKENGFAIPAINVVGTDSINAI
FT                   LEAAAKVKSPVIIQFSNGGASFYAGKGLSNDGEKAAIAGAVSGAIHVHMMALSYGVPVI
FT                   LHTDHAAKKLLPWVDALLEESEKYYKTHARPLYSSHMLDLSEESLQENISISKKYLQRM
FT                   SKIGISIEIELGVTGGEEDGVDNSSVDNSLLYTQPEDVAYAYKELSEVSPNFTIAASFG
FT                   NVHGVYKPGNVVLTPKILDNSQKYIQEKFKTEQKPVNFVFHGGSGSSLQEIREAISYGV
FT                   VKMNIDTDTQWATWVGVKEYYEKNRDYLQGQIGNPEGEDKPNKNYYDPRKWLRDGQKTL
FT                   IKRVEEAFSDLNAIDRN"
FT   gene            complement(513368..513670)
FT                   /locus_tag="Suden_0510"
FT                   /old_locus_tag="Tmden_0510"
FT   CDS_pept        complement(513368..513670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0510"
FT                   /old_locus_tag="Tmden_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43790"
FT                   /db_xref="GOA:Q30T91"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43790.1"
FT                   /translation="METSTLMMIFFIIFLAISIWKIYAFLPSKQLSDDDTTKEAQETLR
FT                   ELMIKIMEKNSSEIDNKKLFELMISDAEFNKEKFWRFNQNKLNNLLSNYKQEAKR"
FT   gene            513755..514462
FT                   /locus_tag="Suden_0511"
FT                   /old_locus_tag="Tmden_0511"
FT   CDS_pept        513755..514462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0511"
FT                   /old_locus_tag="Tmden_0511"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43791"
FT                   /db_xref="GOA:Q30T90"
FT                   /db_xref="InterPro:IPR005271"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43791.1"
FT                   /translation="MNDKVFTKAIKKQFEFDEEVAAVFDDMLQRSVPFYKESQKISEFF
FT                   AQKALQNGGIAYDLGCSTATLLINISRKLQNKATLIGLDNSEAMLQRARKKCEAFKADI
FT                   ELENADILEYDYREANLFISNYTLQFVRPLIREELVKKIASSLKKDGLFIFSEKVISHH
FT                   SKLHKDLIECYYDFKKEQGYSEYEIVQKREALENVLIPYSEEENIKMAKNCGFSHCEVV
FT                   FRWANFATFIAIK"
FT   gene            514540..515223
FT                   /locus_tag="Suden_0512"
FT                   /old_locus_tag="Tmden_0512"
FT   CDS_pept        514540..515223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0512"
FT                   /old_locus_tag="Tmden_0512"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43792"
FT                   /db_xref="GOA:Q30T89"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43792.1"
FT                   /translation="MKTNPLEIEFFGKIDKNFEKEFYSCAKTIKYRKGDSPFSVDNLLS
FT                   YFYIVLDGRIKTYQLNFENAKEQILFIYKRGDMFDVVSLLDGKAHEVIYEVMEDCRVLQ
FT                   FPVQKIREWLESDLAFKNMFYTYLASSIRYTENLAVELSLYEVKDRLMNLLLENLNPNA
FT                   RFRYKVLHNLSNSEISNMLGTVRHVVERAIKQLKDEKIIKSGRKNITVINVHKLLEKST
FT                   KMLHK"
FT   gene            515309..515752
FT                   /locus_tag="Suden_0513"
FT                   /old_locus_tag="Tmden_0513"
FT   CDS_pept        515309..515752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0513"
FT                   /old_locus_tag="Tmden_0513"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43793"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43793.1"
FT                   /translation="MLVSRYLNPIHGYGKNKRLGLLNDFLNSFDESENSPLADFKPAVN
FT                   TREGRDAYHVDVDLPGVKKENIEVDVDNNILTISGQREVKSEVKEADYYKIESSFGKFQ
FT                   RSFTLPEKVDVENIRAACEDGVLEVVIPKLQIEPKSTKKIEIK"
FT   gene            515763..516188
FT                   /locus_tag="Suden_0514"
FT                   /old_locus_tag="Tmden_0514"
FT   CDS_pept        515763..516188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0514"
FT                   /old_locus_tag="Tmden_0514"
FT                   /product="Heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43794"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43794.1"
FT                   /translation="MSIINSSKKLVDKVEEKVEKGLQTVKETFDNVARHLPFANLAKRS
FT                   NDTFDIEIDLPGVKKEDIEITIEGNYLSVNAQRKYKNETKADDYYLCESSFGMFSRSFA
FT                   LSDNINRDKVDAKYEDGRLYITLEKEESKKSKKIALK"
FT   gene            complement(516234..516479)
FT                   /locus_tag="Suden_0515"
FT                   /old_locus_tag="Tmden_0515"
FT   CDS_pept        complement(516234..516479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0515"
FT                   /old_locus_tag="Tmden_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43795"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43795.1"
FT                   /translation="MMKYLLLITTLFLFSGCINKHGISMQYYSECKEYYDLQGYYHNEC
FT                   GKDDIISHKEIRQNSSDAYDYLFGEEKQEKPKGNVW"
FT   gene            complement(516514..517200)
FT                   /locus_tag="Suden_0516"
FT                   /old_locus_tag="Tmden_0516"
FT   CDS_pept        complement(516514..517200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0516"
FT                   /old_locus_tag="Tmden_0516"
FT                   /product="Endonuclease III/Nth"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43796"
FT                   /db_xref="GOA:Q30T85"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43796.1"
FT                   /translation="MLMIIKQDYFIYNSFMKKATKEEIKEIHQLFIDNYSEAVTELDYK
FT                   NAYELVVAVSLSAQCTDKRVNLITPALFKRYPDTKSLAIADIEDVKNIINSCSFFNNKA
FT                   KNIIEMAKRVEDVYGGNIPMDEKELITLSGVGQKTANVVMIEYTGANLMAVDTHVFRVS
FT                   HRLGLSSDATASKTEATLVKKFKNNLRTLHQGMVLFGRYICKAKNPKCDECFLASYCKS
FT                   KESFKV"
FT   gene            517240..518073
FT                   /locus_tag="Suden_0517"
FT                   /old_locus_tag="Tmden_0517"
FT   CDS_pept        517240..518073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0517"
FT                   /old_locus_tag="Tmden_0517"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43797"
FT                   /db_xref="GOA:Q30T84"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43797.1"
FT                   /translation="MKSVTKLVSSLALLSAISLSAQTLVSVNGTEITQQDVDKELMAAT
FT                   QGRFNQVPAEKQAEFRKQVLEQLVAKELVYDDAKKTGVLTSPEYKEKYEEVTQRIQKEI
FT                   AIQVWQKREIDKIAISNDELKKYYDANKEEFVENESVNARHILVEKESDAKNIIAELKP
FT                   LKGDALKNKFMELAKSKSTCASAAEGGDLGYFTAGQMVPEFNDKAFSMKAKEMTLEPVK
FT                   TQFGYHVIYIEDKKAKATKNFTEVKSFIEQRLKMEKAKTVMLAKMKELEKKATIK"
FT   gene            518077..518928
FT                   /locus_tag="Suden_0518"
FT                   /old_locus_tag="Tmden_0518"
FT   CDS_pept        518077..518928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0518"
FT                   /old_locus_tag="Tmden_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43798"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43798.1"
FT                   /translation="MNSPISKIGLDGRDFYVKRDDLIDPYLAGNKYRKLYTLLNTPSNR
FT                   LKTIISYGGTQSNAMLAIAAMCQKKSWEFIYYTKPISKAIQNENSGNFFHSKRLGMLHV
FT                   EIEHEYYRDFIASLRLNLDEETFIIDQGGAVEEARCGLEVLAHEIRESGLHVNSLATPS
FT                   GTGTTALFLALCLPEYNIYTTPCVGDVEYLRSQMRALCELPTNLIILEPKRKYHFAKPH
FT                   VELLHVWQKLLTTKIEFDLIYAPSMWMALLEQTKEDILYIHSGGVSGNESMLERYKQKG
FT                   LI"
FT   gene            complement(518921..519598)
FT                   /locus_tag="Suden_0519"
FT                   /old_locus_tag="Tmden_0519"
FT   CDS_pept        complement(518921..519598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0519"
FT                   /old_locus_tag="Tmden_0519"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43799"
FT                   /db_xref="GOA:Q30T82"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43799.1"
FT                   /translation="MPTIIDAIINRSSKRAFLKKPVSKEIQQKILKAAAMTPSGANMQP
FT                   WITYAISDEKVLKNIGDAIIEKMSSGVKHDQFIQYYPIEWKPLYKKRRFETGIGLYEHM
FT                   GVDRKDLQTREKMWHDNFRWFNAQCVFFVFTDKAMIDGAVGALIDCGAYMQSIMLLARS
FT                   FGLESCPQGSTTEFGRVVAKILDAPENLALLYSVVIGYEDKDAKINGYRPQRADISENV
FT                   IFI"
FT   gene            519743..522319
FT                   /locus_tag="Suden_0520"
FT                   /old_locus_tag="Tmden_0520"
FT   CDS_pept        519743..522319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0520"
FT                   /old_locus_tag="Tmden_0520"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43800"
FT                   /db_xref="GOA:Q30T81"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43800.1"
FT                   /translation="MNNIFEKLTNNMTESIESALSLALYNKNQEVEPIHFLWSQLTNSN
FT                   SVLNQMFNKMSIDKVAIELDVKSMSEKLPKSSSVTKESIKLSRNFVQSLENGIGTMTKN
FT                   GDSFLAVDTYILANIKNEPFYSVLKKYIDISELIKNIESSRGTSKIDSQSSDETMESLK
FT                   KYGIDLTHEAKEGKLAPVIGRDEEITRMMQILIRKTKNNPMLLGEPGVGKTALVEGLAQ
FT                   RISDGNVPTSLQNKKLVALDMSALIAGAKYRGEFEDRLKAVIDEVKKSGNVILFIDEIH
FT                   TIVGAGASEGSMDAANILKPALARGELHTIGATTLKEYRKYFEKDMALQRRFLPINLDE
FT                   PSVNQTLQILRGIKERLETHHNVTITDSALVAAAKLSDRYIADRFLPDKAIDLIDEAAA
FT                   ELKMQIETEPNVLKSAKIKISELSVEQEALKMEDSPSNTKRLEEIKKELADEQERVRTL
FT                   QAQFSNEKEVFGKISSIKNEIEAKKREAHIAKSTSEFNRAAEIEYGEIPALITQEKEIT
FT                   QNWENLQKEGTLLKNSVDEEAIASIVSRWTGIPVKKMLQADKDKILNVEEELNKEVVGQ
FT                   SKATHAVARAIKRNKAGLSSGNSPIGSFLFLGPTGVGKTQTAKTLAKFLFDSPDAMVRI
FT                   DMSEYMEKHSVSRLVGAAPGYVGYEEGGQLTEAVRRKPYSVILFDEVEKAHPDVFNILL
FT                   QVLDDGRLTDNKGVTVDFTNTIIILTSNIASDKIINNPNSAELQEMVMSELKSAFKPEF
FT                   LNRLDDIVIFNALGREQIVGIVDIFFSEIAKKVTSRDITLTLSKEAKAYIAEAGFDPVY
FT                   GARPLKRALYEIVEDRLAELILEGKVVEGSHVEFDFIDNEISVKIS"
FT   gene            522437..522571
FT                   /locus_tag="Suden_0521"
FT                   /old_locus_tag="Tmden_0521"
FT   CDS_pept        522437..522571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0521"
FT                   /old_locus_tag="Tmden_0521"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43801"
FT                   /db_xref="GOA:Q30T80"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43801.1"
FT                   /translation="MKRTYQPHNRPRKSTHGFRARMATKNGRNVINRRRAKGRKKLSV"
FT   gene            522688..522927
FT                   /locus_tag="Suden_0522"
FT                   /old_locus_tag="Tmden_0522"
FT   CDS_pept        522688..522927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0522"
FT                   /old_locus_tag="Tmden_0522"
FT                   /product="ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43802"
FT                   /db_xref="GOA:Q30T79"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43802.1"
FT                   /translation="MGFTATKKIGNAVKRNRAKRRLRALFFTYSSLLQDGTYIFVAKQT
FT                   ISETSHQKLQNDFEKVLSRLDTLKKKTDDQSIPA"
FT   gene            522905..523249
FT                   /locus_tag="Suden_0523"
FT                   /old_locus_tag="Tmden_0523"
FT   CDS_pept        522905..523249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0523"
FT                   /old_locus_tag="Tmden_0523"
FT                   /product="Protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43803"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43803.1"
FT                   /translation="MIKAFLLKLLWLYQKFFTLIGYGSCRYYPSCSEYAKIHFENNSIS
FT                   SAFYHTFTRILRCNQLFEGGIEYPLLDKLSLKPKKIGIDSIKYWLVPNKKNRFYIIKNF
FT                   SYKGRMCSTK"
FT   gene            523234..524844
FT                   /locus_tag="Suden_0524"
FT                   /old_locus_tag="Tmden_0524"
FT   CDS_pept        523234..524844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0524"
FT                   /old_locus_tag="Tmden_0524"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43804"
FT                   /db_xref="GOA:Q30T77"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43804.1"
FT                   /translation="MFDKMTPNQRLIIAVLLSFVFFIAYTAIYPTEQPTETAQVQNSTE
FT                   QKVELKEAPKVEDIVGHKISAQEATIANDLSTLTTLKSNDFILKIDTLGRISSKVLLQE
FT                   MYNTNDNVHAQLIPQSGTKPLFIRFLDPALNEEATKIPYTADISEINLQDTPQKVVLTQ
FT                   KLSNLTVTKEITFYADGHYDVDVSLTQDKRYFIYLGQRPKVNEKEQMMAAVGALIYNDE
FT                   ELLTIIEDGDANERKSYSHIELAAAFDQYSASIMYGFSKDTNIIIDRDRDSNPIVYFEA
FT                   VQNMKFSGYIGQKRYKTLHAIKPILTNAIEYGWFTFASKPLFQLLMWLHGLIGNWGWSI
FT                   VALTVLIRVVLYPLTYKGMVSMQKMKDIAPQVKALQAKYKGDPQRMNAAVMDMYKKHGA
FT                   NPLGGCLPMLLQIPVFFAIYRVLLNAVELQGAPWMLWVNDLSRMDSTFVLPILMGASMY
FT                   YQQKLTPSNFTDPLQEKIFKFLPIIFTFFFITFPSGLVLYWFVNNMFSIGQQFIVNQQF
FT                   KNAKDAQIAAHKNVEKKDD"
FT   gene            524837..525841
FT                   /locus_tag="Suden_0525"
FT                   /old_locus_tag="Tmden_0525"
FT   CDS_pept        524837..525841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0525"
FT                   /old_locus_tag="Tmden_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43805"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="InterPro:IPR040977"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43805.1"
FT                   /translation="MIKIESTTLEQACKDAALALECSASELAIEIVQSPSKGFMGLFKK
FT                   SAIIVAAKKTKDKISQQTQKTQDISVGTKPAPFIKKDKHVEDRVESKPEPKKEFKAEVK
FT                   KEYKSEPKPEYKSEPKPDYKPKKESPKQHHNIVNDTIMPQSFVSMQDDDDDYNIEDINY
FT                   TADYDEDEDYNENKKAKISAYEVSKNVEKEINQLFESICFNIEKIEVTPYDENTLLIEF
FT                   KGEDAALLIGKEGYRYKALSYMIFNWINTKYQLQLRLEIAEFLKNQEESVARYLVTVCE
FT                   NIDRDGRAQTKILDGVLIQIALKELREKYPNKYVAVRSTRDGLKFIIINDYHN"
FT   gene            525845..527185
FT                   /locus_tag="Suden_0526"
FT                   /old_locus_tag="Tmden_0526"
FT   CDS_pept        525845..527185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0526"
FT                   /old_locus_tag="Tmden_0526"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43806"
FT                   /db_xref="GOA:Q30T75"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43806.1"
FT                   /translation="MSEDTISAIATANGIGSIAIIRISGDRALEIASKITHKDNFTPRY
FT                   ASLSNIYDFHGELIDEAIVIYFKAPFSFTAEDVVEIQCHGGFIVAQSILKTTLLHGARL
FT                   ATAGEFSKRAFFNGRIDLSKAEAIAQLIEAKSEDAAKILAQQMKGSLKEYVEKIRDDLI
FT                   HILAYSEVSIDYAEEDLPEDLVMQIQAKLKELKTSLNKTLQASKAREGLMQGFKVAIIG
FT                   KPNVGKSSLLNALLNYNRAIVSDIAGTTRDTIEEQVKIGTHLIRIVDTAGIREASDEIE
FT                   RIGIERSLEAINESDIVIALFDASRVADYEDEQILSLIESKAGSKNVLHVKNKIDLEEK
FT                   FYRSSLEFDIEINSKEGVEELILALENIMNQANTSDEMMLISQRQIGAVQNTLNYIDEA
FT                   FEPLQEQELEIFSFNLNEAIKEIASITRPFENDEMLDKMFGSFCLGK"
FT   gene            527185..527577
FT                   /locus_tag="Suden_0527"
FT                   /old_locus_tag="Tmden_0527"
FT   CDS_pept        527185..527577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0527"
FT                   /old_locus_tag="Tmden_0527"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43807"
FT                   /db_xref="GOA:Q30T74"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43807.1"
FT                   /translation="MKYIAIDLGLKRIGLAYSAHKDLVTPLKAVERKNRDQAARDVKKT
FT                   LIEWEVDAVVVGIPLGGSSEDEMRRRVAHFMNLVAFEGEIFYQDESNSSIEAESMMRGE
FT                   IKYIRDGRIDSISAMIILQRYLRQKC"
FT   gene            complement(527560..529683)
FT                   /locus_tag="Suden_0528"
FT                   /old_locus_tag="Tmden_0528"
FT   CDS_pept        complement(527560..529683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0528"
FT                   /old_locus_tag="Tmden_0528"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43808"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43808.1"
FT                   /translation="MINNHNDDSFAFYGINSDSIVDQSNIDIETIKSLIRNLNEAQEIA
FT                   QIGHWKLNINTNELFWSDETYRIFGLKPKEVKPSYENFFTFVHEDDRSLVNDAYIKSLE
FT                   DKSPYSIIHRIITKDKKLKYVEERCVHKLDESGNVVKSIGTVHDITERVEHEKELEIAS
FT                   NVFKYSSDGIVITDKNNNIVSVNKSFEKLTGYSKEEIIGKNPKLLSSGWGDEEFYKNMW
FT                   SSLLSNDLWRDELWDRKKDGSLYAIEQTIICVRDKNQDIVNYIGMSRDITEAKNKEEKI
FT                   HQLAFYDFLTKLPNAKLFQQEVEAYIKSTHYNNETFAILFLDLDNFKWVNDSLGHQIGD
FT                   LLLIEIAAKLKEIISQDSIISRLGGDEFVILAPYENLLTISQLANTILCSVKDPIKVQN
FT                   REVNVSWSIGISLYPQNGENYNDLLKNADAAMYESKNRGKNTFRYFNDMMNQDAMYRLE
FT                   LDTKLRYAITNNSFFLNYQPKYSFEHGKTIGVEALIRWIDKDLGFIAPDKFIPIAEESS
FT                   YINEIGSWVMKQALNDLKIINSKLSSPISISINVSGKQLEHESFYDEARTLLKESGIEP
FT                   SLVEFEITETSIMQNIDHVVDILKKIKMLGVKISIDDFGTGYSSMSYLKKLPIDTLKID
FT                   REFIKELEIDEDSKSIVNAIIALAKSFKLTTVAEGVENEEQKLILDGLNCDMTQGYLYS
FT                   RPLSLDDLLAFLS"
FT   gene            complement(529772..530425)
FT                   /locus_tag="Suden_0529"
FT                   /old_locus_tag="Tmden_0529"
FT   CDS_pept        complement(529772..530425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0529"
FT                   /old_locus_tag="Tmden_0529"
FT                   /product="TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43809"
FT                   /db_xref="GOA:Q30T72"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43809.1"
FT                   /translation="MTYVVIGLGRFGYHVAKGLAQQGEAVIAIDNDEEKARDISEFVQD
FT                   AIALDSSDPKALYEAGIADAEMAILSIGENIEASILTVMALKELGIKTVVAKAITQVHG
FT                   QILSKLGAAKVIYPEMESAKKLVKTIVENMNYETIDLSITMKIAKMAVNSLWVGTSILS
FT                   PIFKNEFDVKPIAYKHQGEWHTSFNKNDILEAGDILVVLGNSNNIEALSKRVLM"
FT   gene            complement(530422..530703)
FT                   /pseudo
FT                   /locus_tag="Suden_0530"
FT                   /old_locus_tag="Tmden_0530"
FT   gene            complement(530863..531552)
FT                   /locus_tag="Suden_0531"
FT                   /old_locus_tag="Tmden_0531"
FT   CDS_pept        complement(530863..531552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0531"
FT                   /old_locus_tag="Tmden_0531"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43810"
FT                   /db_xref="GOA:Q30T71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43810.1"
FT                   /translation="MKNYLIQIIEDDSSVKKLLEITFREHNLNYISCDNKKNAMMLFLT
FT                   HSSDLLLVDLGLPDGDGKEFIREIREISKVTIVVLSARDDEKEIVAALDAGADDYITKP
FT                   FSVNELLARIRANLRRSISGENISSKITCAELEMDIASRDIFFKNEQLKLTPIEFELLK
FT                   YFLLNANKTLTHKQILKEVWGVGYQSEMQYLRTYVNTLRKKIEQNSTRPTYIKTESGIG
FT                   YRFCCNN"
FT   gene            complement(531549..532262)
FT                   /locus_tag="Suden_0532"
FT                   /old_locus_tag="Tmden_0532"
FT   CDS_pept        complement(531549..532262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0532"
FT                   /old_locus_tag="Tmden_0532"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43811"
FT                   /db_xref="GOA:Q30T70"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43811.1"
FT                   /translation="MEFYFSLHLSATCFINLLNIISHDLRTPLSTIIGTTNLLLSNSNL
FT                   DEQGRKNLLDDINYASIRMKRLITNILDSTRLSSLNIDLKFDWCDFEDIIGVALEEFAD
FT                   KLQDDLLDIKIEDFRLFWGDNILLKQLLVNLLDNAFKFSVNNTKVSLHIIDSKNSLKIE
FT                   VFNQSSYIDERKLKNIFDKFYRLEDSNDISGSGIGLAICKSIVTLHGGEIKASAINNGV
FT                   LIEAKLPILKKANLV"
FT   gene            complement(532534..533031)
FT                   /locus_tag="Suden_0533"
FT                   /old_locus_tag="Tmden_0533"
FT   CDS_pept        complement(532534..533031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0533"
FT                   /old_locus_tag="Tmden_0533"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43812"
FT                   /db_xref="GOA:Q30T69"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43812.1"
FT                   /translation="MKKNRVNSDLITNFYDKVEAKELPEIFLMTFPIALIHKTIFSHSE
FT                   SFLKERFDLLNSEVDVLASLYTHGKVLSPTQLYDMTIFSSGGMTKVLKRLQERDLISRK
FT                   EDESDKRCMLVCLTKKGEELIVKSLNDISKECSKYFEAFSQDETELFSNLLKKILLNIN
FT                   KV"
FT   gene            533126..534358
FT                   /locus_tag="Suden_0534"
FT                   /old_locus_tag="Tmden_0534"
FT   CDS_pept        533126..534358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0534"
FT                   /old_locus_tag="Tmden_0534"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43813"
FT                   /db_xref="GOA:Q30T68"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43813.1"
FT                   /translation="MRFFLPILCLPLFLYSYTLDELLELSHKNRVIESQTHTLISKERL
FT                   YESAKSSYLPSVDIGGSYQNAYKETAATAQNSLKFQASLKYTIYDGGKKDSLYNQLESS
FT                   IDSSKSTITATKNSISLDIARLYFEYFALEADKTATTQEIEQLKEELKRVEFFYEAGAI
FT                   TKDEVAKIDSRVKNTLVLLQEIELKSQKVMHTFEYYTSERVESIDGNATIKLPNEQSET
FT                   IRADIRALEYEAASVLHESNVKKSQNMPVVYLDDTWSHSDYYFDNKALESGFLVENQNI
FT                   AMVNVSWNIFDFGSRTKAYESKLQEYLSKKSTIEYEKSRADVEYRLAKKSLAIALAKVE
FT                   STKATSDAASLAYELIKFKYQNKTIDNVSYLAALSEKFNAQRDSQRALYDLEIKKAELI
FT                   YFSGKDIKEFL"
FT   gene            534359..535459
FT                   /locus_tag="Suden_0535"
FT                   /old_locus_tag="Tmden_0535"
FT   CDS_pept        534359..535459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0535"
FT                   /old_locus_tag="Tmden_0535"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43814"
FT                   /db_xref="GOA:Q30T67"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43814.1"
FT                   /translation="MKNLTILTVVLSLFLVGCGDEKKSTSVAPQAAEMPPLPVKAYSVK
FT                   FESAPLVKSYSALLKPFNEVEIVARVSGVLLSENFKEGAYVKKGDILYEIQKEEYATSL
FT                   NEAKASLLKAEANFNKAQKDWERNEYLFKNSAISAQQRDELFYIYEDAKAEVKKANAAV
FT                   ENAKIKFDYTTIKAPISGTIGMSSSDVGSYIDATEPSAKLVTITALEPIYVEFSLPSSD
FT                   VTKYISQIKNSKKVNLNVGAKIYNGEIDFIAPKIDAQTDTLQLRAKFENQNRELIVGSY
FT                   AEIKIDGLSYEHVAQIPQEALVKTQDATIVFVIKDSIASMRPVKSVHVQDGIAYIEEGL
FT                   LEGEKIVVSNIAKLRPNTKVTIVEGN"
FT   gene            535461..538565
FT                   /locus_tag="Suden_0536"
FT                   /old_locus_tag="Tmden_0536"
FT   CDS_pept        535461..538565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0536"
FT                   /old_locus_tag="Tmden_0536"
FT                   /product="Resistance-Nodulation-Cell Division Superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43815"
FT                   /db_xref="GOA:Q30T66"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43815.1"
FT                   /translation="MFSIFFIKRPVFASVISILIVLAGVIAMRSLPIGEYPRVIPPQIV
FT                   VTATYQGASAQTISKTVAAPLEEQINGAKDMLYMSSIAADNGTLSISIFFKVGTNPDDA
FT                   KIDVNNRVQAALSRLPEQVKRQGVRVNEKSPDMLQVIILNSPKQSRDVGFLSNYALMNI
FT                   VDDLKRVKGIGDVTIFGAKDYSMRVWIDPSKLKKYSLTVSDLVTSIQEQNEQYAAGKLA
FT                   AEPISNKEMFTYTIETPQRFDDPSQFSEIIVRANEDGSSLKLKDVATIELGSQSYDMKN
FT                   KLNNVPAVPILIFLQSGANAIETAKEVRKTIASISENFVEDVEYVIPYDITDFVQISIN
FT                   EVIKTFVEAIILVILIIFLFLQNFRATLIPVLAVPVSIVGAFAGMYMLGFSINLLTLFG
FT                   LVLAIGIVVDDAIIVIENVERHIKEGLSPKEASIKAMQEVSGALIAIVLVLSAVFLPVA
FT                   FLGGLSGEMYRQFAVTIVISLAISGLVALTLTPALCALMLKPIHKEPKYFFKWFNNFFD
FT                   SATRGYSNALKLTVRYSFLSMLLFGGLIYITYDMFINLKTGLVPTEDKGTVFVFSYNPP
FT                   SASLSRTETLTSEIYEIASKEKESIKNIVQFAGIDFVTFSQRTNSAATILKLQPWDERK
FT                   DPTQHASYIAADISKKLSRTSDGFSFGVVPPPIMGMGIAGGFEMYVQNRTGADLKELQK
FT                   YVNEIIQKANQRAELAGVRTTLNTSVPKYSIKVDTAKAKSKGVNIDEIYQTLNATFGSF
FT                   YVNDFNLLGRTYMVNMQAEESFRKTPQDLEKIFVRSVQGEMIPLSSFVTLKQSVGADLV
FT                   ERFNLFSAAKVSGQASLGYSSGDALKAIEEVSNEVLPEGYSISWIGTAYQEKQISSAGN
FT                   LAFIFGIIFLYLILAAQYERWLMPIAVILAVPFGIFGAVVANHLRGLENDIYFQIGILV
FT                   LAGLSAKNAILIVEFAMQKRAQGMELVEAVLEAAKIRLRPIIMTSLAFTLGVIPLAISS
FT                   GAGAASRHSIGTGVVGGMLAATFLAIVFIPLFYILVSKIRNKKES"
FT   gene            538770..540779
FT                   /locus_tag="Suden_0537"
FT                   /old_locus_tag="Tmden_0537"
FT   CDS_pept        538770..540779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0537"
FT                   /old_locus_tag="Tmden_0537"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43816"
FT                   /db_xref="GOA:Q30T65"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43816.1"
FT                   /translation="MALYKLEDHVNDWVKAKLEALNLKNQKDYHTESAIPDYLKEALQG
FT                   RAKTEKKTNFGKPDFSITKYKQAPIVIENKLGLKKLIEETKDGVKFDEKSISNYAVNGA
FT                   LYYATGMIASGKYHEVIAIGIAGDGDDAIELKVYYVYGSGENSFKLLENVSTLDFLENQ
FT                   KTFDVFYKDAILTEDEKHEILIKSQAELQKYSKSLNKLMHNHNITAPQRVLYVSGMLLS
FT                   MQNVVDTKGTKIQDGLVPQDLKGVQTESKRDAIQIVNQIKEFLTARNIPIEKQNLMLSS
FT                   FYEISKDVQRDELEILDKEVSKLIDGKASINKQIFTFIYHNIFLSIDAMAGHLDIMGEM
FT                   YSEFLKYALGDGKEIGIVLTPPYITKMMTTILGVNQNSKVMDLATGSAGFLISSMEMMI
FT                   DDAEANYGKETTAAKKKIDIIKKEQLLGVELNAEMFTLAATNMILRGDGSSNIHKGNTF
FT                   NTPEQLYTSFKANKLLLNPPFSYDENGMPFIAFGLDKMEKGGLGAIIIQDSAGSGKATK
FT                   SNQAMLKKHTLKASIKMPTDLFQPMAGVQTSIYVLEAHKPHDFEQTVKFIDFRNDGYKR
FT                   TSRALQEIDEPTKRYADIVKIYKAGKNAKVEAPWNLNEVYIEDFITPSGSDWNFDQHKT
FT                   IDSKPTLEYFKKTVSDYLSWEVSNILKQRGDKGK"
FT   gene            540797..541909
FT                   /locus_tag="Suden_0538"
FT                   /old_locus_tag="Tmden_0538"
FT   CDS_pept        540797..541909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0538"
FT                   /old_locus_tag="Tmden_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43817"
FT                   /db_xref="GOA:Q30T64"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43817.1"
FT                   /translation="MLNSVEWGEEVYLKDLFTIKRGKRLTVENRVKGNRPLITAGYENT
FT                   GVAEFIGNNNQEIFPEDTITIDMFANTFYRNYSYSADDNILVLFDKEKIPSKAKNFIVG
FT                   LINKVLSTKFSYGKQYRMGSFEETKIQLPIKNGKINFSFMEKFIAELEAEHIAELEAEH
FT                   IAELEAYLVATGLKDHTLTVKEQQVLDDFENGKITFKEFTYESIFNKIVQGRRLTKNDQ
FT                   ISGDIPFVMAGTTNTGVVNYISNPVASFPKNSITIDIFGNTFYRSYNFGAGDDTGVYWS
FT                   DEKNYSKETMLFFAASMGKSLFGKFDFGKKLRSSQSLNFKMKLPFINKQPNYIIMETFI
FT                   SAIQKLVIKDVVLYADKKIATTKSVVEKEI"
FT   gene            541922..543001
FT                   /locus_tag="Suden_0539"
FT                   /old_locus_tag="Tmden_0539"
FT   CDS_pept        541922..543001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0539"
FT                   /old_locus_tag="Tmden_0539"
FT                   /product="Protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43818"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43818.1"
FT                   /translation="MDNLTNDNEYKNFIVDVATKIKQTQVKLAVSVNSGLLHFYFELGG
FT                   MISQKQQKAKWGAKFIETMAKDIKKEFPELKGFSRTNLFSMKKFYEFYSIDLVQLRVGL
FT                   IENPQNQLEDILFSIPWRHHIEILNKVDSIGEAVYYIDQTLQNNWSKDTLAINLKSKLF
FT                   QRDSKGVNNFSNTLPKPLSDLAVQTIKDPYVFDFFSFDKPFIERDIENKLIDNITKFLL
FT                   ELGRGFAFVGKQYHLEIAGFDRYIDLLFYHIDLKCYVVIELKNKKFIPEYAGKLNYYIS
FT                   AVDTMLKKENDNPTIGILLCRDKNNIEAEFALRDINKPMGVSEFELKLTEILPENLRSS
FT                   LPTIEEFEAGFGDILGDDE"
FT   gene            complement(543096..543716)
FT                   /locus_tag="Suden_0540"
FT                   /old_locus_tag="Tmden_0540"
FT   CDS_pept        complement(543096..543716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0540"
FT                   /old_locus_tag="Tmden_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43819"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43819.1"
FT                   /translation="MKKFNLFKEIIVVDKNILLEAISSQEHFGIRIDGAICHEPFTTDD
FT                   ILIYSGVADKEATLENSLGKNYQIVVDANRVLIKAFSNWQEIIGFNKLRATYDDTTADG
FT                   VDEFGSKEMEDIGWHATEFNISYRAIVDMLESTCDGTLICIEQVEPYQFSGLGFVVNLE
FT                   SAKDMMFEYCQKEIKRLLSEDEDFALENLNDDELEAAEFFKAL"
FT   gene            543824..544846
FT                   /locus_tag="Suden_0541"
FT                   /old_locus_tag="Tmden_0541"
FT   CDS_pept        543824..544846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0541"
FT                   /old_locus_tag="Tmden_0541"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43820"
FT                   /db_xref="GOA:Q30T61"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43820.1"
FT                   /translation="MALTVYYDKDCNINLIKSKKVAMIGFGSQGHAHAENLRDSGVEVV
FT                   VGLRKDGSSWAKAEAKGFKVMTVGDASAYADLIMILLPDENQAEIYKDEIEPNLKNGAT
FT                   IAFGHGFNIHYGRIHPRADINVTMIAPKAPGHTVRSEFVRGGGIPDLIAVGQNPSGNTR
FT                   ELALSYASAIGGGRTAIIETTFKDETETDLFGEQAVLCGGAVSLVQAGFETLTEAGYAP
FT                   ELAYFECLHELKLIVDLMFQGGIADMRYSISNTAEYGDYVSGKRVINAESKAAMREILK
FT                   EIQDGRFAKDFILEGQSGYPRMNAERANAKASLIEQTGVKLRTMMPWIAANKIVDTSKN
FT                   "
FT   gene            complement(544990..545952)
FT                   /locus_tag="Suden_0542"
FT                   /old_locus_tag="Tmden_0542"
FT   CDS_pept        complement(544990..545952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0542"
FT                   /old_locus_tag="Tmden_0542"
FT                   /product="DNA polymerase III, delta"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43821"
FT                   /db_xref="GOA:Q30T60"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43821.1"
FT                   /translation="MYKNELDKHIKNNSLSTSFILFGESTFLIDRYTDILSINEGASVL
FT                   KFYHDEYNFNSAKAHLSQASLFGDQNILIIKSEKKIPKKELDILIEQCEKGSDNIFVYA
FT                   YYGSDYTSYAKPLSKTKTMPVRFFHPSHSEAIASVAQIAHEKNVKIDTQAINHLLNIQN
FT                   SDIALACNEIEKLRVYDRAITTKDIDSLIFGLAQINIDDFIKKILNKRDFKSDLMSLLE
FT                   HGEDEIRLLTALTSYLTQLYMFNIYIRVNGAPNPIEILGYKPPPHVVEEKATQAIKIKP
FT                   RQYYKLHELLLESELKMKSSHVDKSAILLSTFIRVQQLL"
FT   gene            complement(545955..547904)
FT                   /locus_tag="Suden_0543"
FT                   /old_locus_tag="Tmden_0543"
FT   CDS_pept        complement(545955..547904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0543"
FT                   /old_locus_tag="Tmden_0543"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43822"
FT                   /db_xref="GOA:Q30T59"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43822.1"
FT                   /translation="MMKSLLIKLTHGFDEQDISADELKFVNDFLAKEYITKDGTLYKFN
FT                   SKYRAGTLGLVQNGTAYLHVIGEYVRDLFIDDVESSKAKEGDLVIAQRLLGKRGSPSAK
FT                   IVEVLGRAQTYSVAYIITKDAKKSLVDLKTDFPIGVEITQDELESYKDGDVFKINNQDF
FT                   TIMELLGNIKDPLVDEKIVLAHYNKHDAFEPEVLEIASSFTEVDASKHPLRVDLRKLPF
FT                   CTIDPVTAKDFDDAIYYDEKESTLYVAIADVSYYVEPFGAIDNEAIYRSFSIYLPHRSI
FT                   PMLPRELSETLCSLQPHVDRLAYVFEMKLDLETLEVSSSKVYEAIIHSQRRFNYEEVDE
FT                   LFEGNLEPQNPSEIEIFEYIHKLRVITDALKAKRLKIGYNFRSNELEMFLDKNSNISST
FT                   SYAEETPSHALIEDCMLLANKEAAKRFTRGIFRIHEPPNQMKLQNLYQELAGIGMFINI
FT                   KKSIKETITEIQKQAAEMNLVSEVDTLIIQSQMQARYAPINAGHFGLGFDEYTHFTSPI
FT                   RRYSDLIVHRLLKAISNHDTTEGSYVLRNIESLCMSVSEKEREASTIEVEFMARKFARW
FT                   AAENIDELFSARVTSTDPFFKAELHDTISGARFYITHNLDAALFDDVKVRIDKVDIAKA
FT                   KIYASITEIVEKEI"
FT   gene            complement(547909..548706)
FT                   /locus_tag="Suden_0544"
FT                   /old_locus_tag="Tmden_0544"
FT   CDS_pept        complement(547909..548706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0544"
FT                   /old_locus_tag="Tmden_0544"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43823"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43823.1"
FT                   /translation="MTDEILKKIKQLPPLPESAMQIEAVYQDPDSTFNDMVKILEKDPL
FT                   LTADILKAANSPLYGFSREINTINQAVGLFGMGTVRGFALASIVKKSFVLDLSPYNIDG
FT                   DMFSALSKKQHALVTSWCLRKEAKLLGILSPAAFLVEIGKVLIAQQIISSNSQEKFKEV
FT                   LNSLGDVEAAEREVTGVDTPEVSATIFEHWRFETGLVETIRNCLNPENAKDDIKKAVQI
FT                   LQVARRAVQINGSITEESIASAKELILKYNLDMESFEKALENI"
FT   gene            548833..549159
FT                   /locus_tag="Suden_0545"
FT                   /old_locus_tag="Tmden_0545"
FT   CDS_pept        548833..549159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0545"
FT                   /old_locus_tag="Tmden_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43824"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43824.1"
FT                   /translation="MQKEAMLTQLGYSPNDALLKQLERIETNTTGYEKIQKHIMDLNDH
FT                   LKVDDSYVAMSNSNDYFKIKIDSSSPEAIEQAHEKVKHFSQKYKVKVDKLENKNTYYIV
FT                   GFEH"
FT   gene            549170..549694
FT                   /locus_tag="Suden_0546"
FT                   /old_locus_tag="Tmden_0546"
FT   CDS_pept        549170..549694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0546"
FT                   /old_locus_tag="Tmden_0546"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43825"
FT                   /db_xref="GOA:Q30T56"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43825.1"
FT                   /translation="MQEPMSIEGYDVLIEEFKFLLEVEKPKTAQEKLVAAALGDRSENA
FT                   DYQAAKEKLRHIDKRLFYLNAMIQKAHIIDPSTLLHTKVSFGSSVRILDLESDKEEVYT
FT                   ICGVLESEPENGLISIHSPLAQVMLGKRVSDEFKIQLPLMKKEYEILEIYYKNIFSLKK
FT                   NVRKKSDFAFH"
FT   gene            549766..551979
FT                   /locus_tag="Suden_0547"
FT                   /old_locus_tag="Tmden_0547"
FT   CDS_pept        549766..551979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0547"
FT                   /old_locus_tag="Tmden_0547"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43826"
FT                   /db_xref="GOA:Q30T55"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43826.1"
FT                   /translation="MSQQLQEIEKVLSSHKLSGDDYAHIKQILGREPNLVEIGIFSAMW
FT                   SEHCSYKSSKVHLSGFPTKAPWVIQGPGENAGVIDIGGGYAAVFKMESHNHPSFIEPYQ
FT                   GAATGVGGIMRDVFTMGARPIANLNALRFGDVLKDNKTSAHQRYLVRGVVAGIGGYGNC
FT                   MGVPTIGGETSFDECYNGNILVNAFTLGLAKSDEIFYGRADGIGNPVIYVGAKTGRDGL
FT                   GGAVMSSDSFTEESKSLRPTVQVGDPFTEKLLLEACLELFKTDHVVGIQDMGAAGLTSS
FT                   SFEMAGRSGSGMIMHLDRVPAREEGMTPYDFMLSESQERMLLCAKKGSEAEIIKIFEKW
FT                   DLDAAVIGEVTATGNMELFWHGDKVAEVPVNPVSEEAPVLNRPMSRPAYLDKIASVTID
FT                   DFARVPNQEAFERLTKSMEVVDKSWIYTQYDSMVQTNTIKKGGMLDASVVRVKENGKAL
FT                   AMSADCNVRYCYIDPKGGAAAAVIESGRNVAMSGARPLAITDCLNFGNPENPEVMWQFG
FT                   QSCLGIKEACSALTTPVIGGNVSLYNETNGVSVFPTPSIATVGVNDDQNKVLMSSFQGE
FT                   GNTLYLVGESNSEFGGSLYMKEICGVVAGVLPEIDYEKELTLWDLVIEANKKGILECAK
FT                   DASSGGVAIALAKMAAVSGLGCSARMLVNDERDIFAESMSRAIIEVKQENSASFESMAG
FT                   VLQCQKLGTVGGDIVKINNVSMSMKELQDNYFNTFKRVIERDI"
FT   gene            complement(551976..552668)
FT                   /locus_tag="Suden_0548"
FT                   /old_locus_tag="Tmden_0548"
FT   CDS_pept        complement(551976..552668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0548"
FT                   /old_locus_tag="Tmden_0548"
FT                   /product="MOSC"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43827"
FT                   /db_xref="GOA:Q30T54"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43827.1"
FT                   /translation="MKSSVVSIQIGKVNAYGNKESSEFLQKYWESASFKEVVESTVFVS
FT                   KYGIVGDEVADKVHHGGLEKAVFANSYENYKEWAEFLHVDELPFGALAENLTISGLHES
FT                   SVYLGDTHKIGSTLLQVSQARKPCYKIAKRWNNKKFTNEIYITGLTGWYYRVLQEGEII
FT                   AGDEVVLQSRDENQVSILDANMAFANPIQHRDILEKILSIDSIAPNYRSSIEKRILGEF
FT                   ALEYMRVD"
FT   gene            complement(552751..553710)
FT                   /locus_tag="Suden_0549"
FT                   /old_locus_tag="Tmden_0549"
FT   CDS_pept        complement(552751..553710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0549"
FT                   /old_locus_tag="Tmden_0549"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43828"
FT                   /db_xref="GOA:Q30T53"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43828.1"
FT                   /translation="MKNIAILSSGGDVSGMNPAIKHFVEYALHNGLTPYFVYNGFEGLI
FT                   DNKITKASHSDVAGIINRGGTILGSSRSKRFMLKNYREVAKKNLDALDIDMLIVLGGDG
FT                   SFRGMDIFYKEHGVKFCGIPSTIDNDINGTIYCLGVDTALNVIKDSIDNIRDTASSFSR
FT                   AFVIETMGRDCGYLALVSSLCSGAELCLIPEVEYNLSSYEDSFKEQIKNGRKYFIVIVS
FT                   EGIKDNSKEIAEWLEQKVGIESRVTVLGHTQRGGTPSIYDRLMAYKFVNHAIDALLGDI
FT                   NSSVVCYSKTGFIHKDIDEITSQKYMLDPELLSYLKKF"
FT   gene            553798..555333
FT                   /locus_tag="Suden_0550"
FT                   /old_locus_tag="Tmden_0550"
FT   CDS_pept        553798..555333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0550"
FT                   /old_locus_tag="Tmden_0550"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43829"
FT                   /db_xref="GOA:Q30T52"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43829.1"
FT                   /translation="MKRALVSVSDKSGVVDFCKSLVKNGFEIISTGGTYKILVENGIKA
FT                   IEIDEVTKFPECFEGRVKTLNPFVHGGILHRRDKQSHLDQAKELGVEAIDLVCVNLYPF
FT                   KATIEKTDDFEEIIENIDIGGPAMVRSAAKNFDGVMIVTDADDYVKVIDAIENEKNTLE
FT                   FRRNLMIKAYEHTAAYDSMIANYMNTRFNGGFGEKQFIVGNKVMDTRYGENPHQKGALY
FT                   EFDKHYSDNFKTLKGEASFNNLNDLSGAVKIASAFGAENAVCITKHGNPCGFAIKDTLL
FT                   EAYEEALKCDPVSAFGGVVAVNGVVNKELALKMNEIFLEVIIAGRITQEAQEVFASKKR
FT                   IKLFEMGSEKLLLANDAKDFKHIDGGFVYQDADKVNNDEVKNAKLMTTRDATSQEKKDM
FT                   EIAYKVASLTKSNCVVYVKNSAMVAVGMGMTSRVDASECALKKAKAMGLDVTGAALASE
FT                   AFFPFRDSIDAAAAAGVKSVIEPGGSIRDEEIIEAANEFGMSLYFSEVRHFLH"
FT   gene            complement(555689..557716)
FT                   /locus_tag="Suden_0551"
FT                   /old_locus_tag="Tmden_0551"
FT   CDS_pept        complement(555689..557716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0551"
FT                   /old_locus_tag="Tmden_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43830"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43830.1"
FT                   /translation="MLGQAKGVRANYAKNKDIYSQNAEYGEESKQQATNAKIAAQGGIA
FT                   AAVTVDVKDASMKAAEQAGNVGRKWDNIHDAKFLENQIAGLESAGADMSEFKGKEGLDY
FT                   LKQIGSSQAMKAMMKDSIVDANGKSVSFATGKDGHVGMVSVDGQTKMANGVSVETGGAV
FT                   AALAEGFNMTEAAIKDGHHVDIQNGKLIGNKASKEAFMKHIGNNQKNQAMVTSAPGEFL
FT                   TVLQDLAEEFTPEVVADNFGKVAFAAVMGTAAKKMVVDPLKKSLPPKNTSSSKDISDNS
FT                   ISSNSKESKDSVNHDNTSEHRNNIKDYTEDYQKSQESRDKEIQNASNLKKQRNKLFEQG
FT                   KDTSALDDKISDSYERAKGHQENMDKADRNIKAEKYIASKNIDKEAMDRKDKNGGSSKA
FT                   GWLSALAMPLVNELADVMGVDKSQNLAFSTIEAGSEIIDGGFTAALDVLKATGIGGFKA
FT                   LRGDGDAGQYFSKNMSSAASSVMSGFSNANETMATYAIMQEFNRQQAAPQHQGFSTLPS
FT                   GHHTMQAVSADMQQQAAQAQITMANNTQALSSIAPNRSYVGLSMTDADQNPVSFTTDKA
FT                   SRNMMINGYNTGMPAQQFGSMMQNPEAVSQFANAISQTSFSNVEAYNATNNILMDMNAQ
FT                   TQRANMQQKIHNNASDTRNAMQHKESLEANSQKSKEEYEI"
FT   gene            557886..558740
FT                   /locus_tag="Suden_0552"
FT                   /old_locus_tag="Tmden_0552"
FT   CDS_pept        557886..558740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0552"
FT                   /old_locus_tag="Tmden_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43831"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43831.1"
FT                   /translation="MKKLKLVSSITLSALIFTACSAGSPKPSVNGEKPTLFIESHTANK
FT                   FKDITEENADANGISSAFVKDKQYLRCDILPEVIVTFTKEGFSVIHDKKKADYTVDLSL
FT                   LSCGQGREYYEFRNANPPKSKDFYKRNIELAHEYLQRTNNVVMPNKYYGIPEEDKKILE
FT                   SYFKETQIKSNDTNVVTSGVISGMGYIGNTAGALGTLGGGSAPTGAKALGGFGLAMGII
FT                   SLTGGVRNPDVYNEFKITKNSSGKSWSKTVNLLTFTPQDWKININKPIYDWTIDEIPWN
FT                   ELD"
FT   gene            complement(558795..559916)
FT                   /locus_tag="Suden_0553"
FT                   /old_locus_tag="Tmden_0553"
FT   CDS_pept        complement(558795..559916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0553"
FT                   /old_locus_tag="Tmden_0553"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43832"
FT                   /db_xref="GOA:Q30T49"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43832.1"
FT                   /translation="MNPLLFFIVFLSVFALINFYISRRFIAYLDVKATHKFYFHIFLFV
FT                   NYLGIIGYMLGRYYLDFANWLYFLFSLPIGLLFLLFCTAIIYDISRVILKIAPLSAKRR
FT                   NFFKRSLDLSSLLLASTLSAKSIYNARDIKLEKIDIKIKKLKKSYKIVQLSDIHIGGLI
FT                   DKAFIKNLVLRVNDIRADLVVITGDLIDIKMDRGRDILAELKHLESAYGTFFVTGNHEY
FT                   FHDIAKIIESLKELDIRVLENENIYIGDEGEGFNLAGVYDIFGYRTKSYVPDLSKALEN
FT                   LKNSPTILLAHQPKYIEEVTHSVDLMLSGHTHGGQLFPFRFLVKLQQPYISALHQHNKE
FT                   LQIYVNKGTGFWGPPMRLGACSEITEITLIPAL"
FT   gene            560033..560905
FT                   /locus_tag="Suden_0554"
FT                   /old_locus_tag="Tmden_0554"
FT   CDS_pept        560033..560905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0554"
FT                   /old_locus_tag="Tmden_0554"
FT                   /product="Heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43833"
FT                   /db_xref="GOA:Q30T48"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43833.1"
FT                   /translation="MAKSLYDTLEISENATEAEIKKAYRKLARQYHPDVNKEKGAEDKF
FT                   KEINSAYEILSDKKKKAQYDAHGDNMFGGQNFHDFSRSHGGGSGDLDEILRSMFSGGGG
FT                   FGGFGGSSFGGGGFGGHQQPNLDIETSVTIPFSVSILGGSHSVAVNGERFDIKIPAGVN
FT                   SGEKMRVKGKGHAQGGRAGDLFLKINVASNPEYIRDGDDLVKKFDVPLYAALFGDKITI
FT                   QTLEKEIKLKIPQNTKNNQRFRVKEMGAMNRKTKERGNLYLEANIVLPKIEDLDEKLAE
FT                   LMQEKLPKE"
FT   gene            560909..561286
FT                   /locus_tag="Suden_0555"
FT                   /old_locus_tag="Tmden_0555"
FT   CDS_pept        560909..561286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0555"
FT                   /old_locus_tag="Tmden_0555"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43834"
FT                   /db_xref="GOA:Q30T47"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43834.1"
FT                   /translation="MIHDYDEPVYLISIVAKVLEIHPQTLRQYERENLVTPSRSNGKIR
FT                   LYSQRDIDRIKLILRLTRELGVNLAGVDIILRLKENVDGMEQDILDLRQEVMRAKNSQT
FT                   VSHDKALVAKKSIYEMIIFKK"
FT   gene            complement(561437..562705)
FT                   /locus_tag="Suden_0556"
FT                   /old_locus_tag="Tmden_0556"
FT   CDS_pept        complement(561437..562705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0556"
FT                   /old_locus_tag="Tmden_0556"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43835"
FT                   /db_xref="GOA:Q30T46"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43835.1"
FT                   /translation="MDYLQIKKSPKLHGEIKISGAKNAALPLIAMSILAKNIVTIKNLP
FT                   HVADIKTLLKLLSNLGAECSSSWENYSTTINTSTLNQTKATYDIVKTMRASILVLGPIL
FT                   ARFGHCEVSLPGGCAIGQRPIDLHLKALEQMGAVINIEAGYIHAIAPDGLKGCNIIFDK
FT                   ITVTGTANIVMAAALAKGVTTITNAAREPEVVQLCEILNASGVKIEGIETAVLTIHGTG
FT                   GELLEIAPFSVIPDRIEAGTYLCAGAITKSELTLKGANAKHLGAVLSKLEEMGSKFTIT
FT                   DDSITIHPSKIIKHVKIVTQEYPAFPTDMQAQFLALATQADGTSIIEERLFENRFMHVS
FT                   ELQRMGADISLNGNVATVNGHSKLSGTDVMATDLRASSALVLAGLVADGITDVHRIYHL
FT                   DRGYDSLEKKLQNVGADISRLKE"
FT   gene            562793..563221
FT                   /locus_tag="Suden_0557"
FT                   /old_locus_tag="Tmden_0557"
FT   CDS_pept        562793..563221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0557"
FT                   /old_locus_tag="Tmden_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43836"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43836.1"
FT                   /translation="MSSALDRLKNLTNKISSYERTRKDNLILLEKLYNELEINQKVEEF
FT                   SELFSYKAINLSGASLLSDSLGEVKKGKYLQILAIGYDRDAVVKSKNISLGYFGKAQNV
FT                   DVDLKNRVVEFIIRFRFEKSFMTLEHYHIMLESFKSDE"
FT   gene            563214..563753
FT                   /locus_tag="Suden_0558"
FT                   /old_locus_tag="Tmden_0558"
FT   CDS_pept        563214..563753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0558"
FT                   /old_locus_tag="Tmden_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43837"
FT                   /db_xref="GOA:Q30T44"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43837.1"
FT                   /translation="MSKFFFLLWLKWAFRVTLCSTLLAFSLSGLLTFFLYLYQGSQELT
FT                   SEVYMALFDILKFWFVIFWSFTILIALFRSLKYLFNSCINGFELKLLSCDEKSYIEKIG
FT                   YGDLVRVWRKWLMLLIWLVSALVILALVYTYIFSSYGGLFEWFDIYTLYAFILISGYLS
FT                   FILMSSRCKKVKIRPC"
FT   gene            563747..564451
FT                   /locus_tag="Suden_0559"
FT                   /old_locus_tag="Tmden_0559"
FT   CDS_pept        563747..564451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0559"
FT                   /old_locus_tag="Tmden_0559"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43838"
FT                   /db_xref="GOA:Q30T43"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43838.1"
FT                   /translation="MLIFLDVETTGLENGDKICSIGIICVSETAIFSKYELVNEGKKIS
FT                   SKASSINHITNEMIKDKPKFKDSKTWEILHENNNQSSTIIAHNVNFDLKMLLQSGFLWQ
FT                   GKVVDTLRVTKHLIPECEEFSLQFLRYELKLYKDEKKEAAKYSAEISAHNALSDALHVK
FT                   LLYEYLLEIKEHDELVALSLKNVLIEKFNFGKYKGRYIEEISMCDRGYLEWMLLHVADL
FT                   DEDLRYSIRGVL"
FT   gene            564507..564896
FT                   /locus_tag="Suden_0560"
FT                   /old_locus_tag="Tmden_0560"
FT   CDS_pept        564507..564896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0560"
FT                   /old_locus_tag="Tmden_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43839"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43839.1"
FT                   /translation="MRVAVECKSPLLQKSLEIFLSKHLSSLKNCDIVVRDIKVLDDERT
FT                   FYISSSNGSDLIKPFSKSQLILALERRYKEMNRGNLHYLNKIYQEDELDDDSVMGFDIL
FT                   QKRIESLTKEYQENILRAVRAFYEK"
FT   gene            564886..565476
FT                   /locus_tag="Suden_0561"
FT                   /old_locus_tag="Tmden_0561"
FT   CDS_pept        564886..565476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0561"
FT                   /old_locus_tag="Tmden_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43840"
FT                   /db_xref="GOA:Q30T41"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43840.1"
FT                   /translation="MKSNLIIKKIVAGKFKNKTIKLPSKTTTRSSKAIVLESFFNTIQF
FT                   EIIDATFVELFSGSGSVGLEALSRGAAKIIFMEKNSEALKILRENIAQTDPSLCEVYGG
FT                   DTFSNISTVIKNLEKKNHKAYFYIDPPFSTRDGMEEIYNKTLSLIATLPKECVKLIIIE
FT                   HMSTLIIPDEIGTFRVKKVKKFGNTTLSYMQSQ"
FT   gene            565522..566577
FT                   /locus_tag="Suden_0562"
FT                   /old_locus_tag="Tmden_0562"
FT   CDS_pept        565522..566577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0562"
FT                   /old_locus_tag="Tmden_0562"
FT                   /product="Flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43841"
FT                   /db_xref="GOA:Q30T40"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43841.1"
FT                   /translation="MKKILFLFTASLLLHVTLQAAKISDVASIVGVRDNHLIGYSLVVG
FT                   LQKTGDGTTSKFTLQSIANMLKAMNIDMKPIDIKSKNVAAVVVTAELAPFARQGDKINI
FT                   TVSSIGDAKSLEGGTLLMTPLKGVDGKIYALAQGAVSIGGRNGKGAGDSHPTAGLIYDG
FT                   GLVEREIAIDLYNQDYVTLSLKDANFQNSVSIQKTLNGYYSTEVAVAMDSRTVKLKKPS
FT                   NKTMIEFLAEVQEINMDYNVQDRIVINERTGTIISGVGIHIKPIIMTHGDITIKITEQE
FT                   NPDKPAGSMVVDENMVIGLNENELYTKEGTTTVANLVRSLQKLGATPKDIISILEAMKS
FT                   AGSISAELKLI"
FT   gene            566577..566879
FT                   /locus_tag="Suden_0563"
FT                   /old_locus_tag="Tmden_0563"
FT   CDS_pept        566577..566879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0563"
FT                   /old_locus_tag="Tmden_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43842"
FT                   /db_xref="InterPro:IPR016511"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43842.1"
FT                   /translation="MKGVNSIDLQAAFVSQQHQIPKIDPKAENKELRAQTDAFESVILK
FT                   MMMDNAMQDEKNIFSEENDPGDKIYKSMYREELAKASAGGFGFSQMLYDFLSQKQ"
FT   gene            566973..567182
FT                   /locus_tag="Suden_0564"
FT                   /old_locus_tag="Tmden_0564"
FT   CDS_pept        566973..567182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0564"
FT                   /old_locus_tag="Tmden_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43843"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43843.1"
FT                   /translation="MISQLNSAGVRTAYANSFGEAKEASQKGTLSVSKQGDTSKVEQIK
FT                   DAIASGEYKINLQTLSQKIAQELL"
FT   gene            567213..567641
FT                   /locus_tag="Suden_0565"
FT                   /old_locus_tag="Tmden_0565"
FT   CDS_pept        567213..567641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0565"
FT                   /old_locus_tag="Tmden_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43844"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43844.1"
FT                   /translation="MLSYHLQSALSDLRDLIKITESDVEDIKIANHNPQFDRLKLKEEK
FT                   LKSFESKKAMIDHEIASLISINPSTELTQLLNEEQHEYLAELKVELQNLRDANKRYAKL
FT                   VLAVSNLYNTFLERLVPTEMQGYNRVASKDSTILKVRV"
FT   gene            567643..569529
FT                   /locus_tag="Suden_0566"
FT                   /old_locus_tag="Tmden_0566"
FT   CDS_pept        567643..569529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0566"
FT                   /old_locus_tag="Tmden_0566"
FT                   /product="Flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43845"
FT                   /db_xref="GOA:Q30T36"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43845.1"
FT                   /translation="MGTSIFNSLSIGYSGLSAAQAGVSTTSHNITNAESEGYTRQRVVT
FT                   AAATPVNMAPGNVGNGTQIMDIARIFDNFVYDRYTGISAEKEYSDFTKQTLETLSTYFP
FT                   EIDGVGIKSDLQDYYNMWQTFADNPDNDAIKLSLAKQTEALSNGIISTQNKIYDLQSTL
FT                   NTQLKVNVDEVNLLAKELSKINISIEVAEAGDTFTANDLRDKRNSIELSLAKLIGADSI
FT                   SGQINSNIIINSASNEKNGSYTLSVNGFNIVDGGTYHPIHISSDKNSNGFYELSYERQD
FT                   GVLIAMDEKIPGGRIGAILDLRGDKIEGNSSGTPSNGTLQKVLDELNAFATTLIESTNN
FT                   LYASSATKSMSSKNISINPTLPILDSNLNIRAGAFDIVIYDIDGNESARRVININNLTT
FT                   MNGVAGSNSIQGQIIDQKDDNADANANNDIDDFMQFHWATYQGGGNALELVMDSSYGAK
FT                   GYTFSIEDNLKTNQFDSGSNFAGALGLSRFFDGDSAKDIGLNSALRDNPTNIKAGKTSS
FT                   SGDNTLALNMIQQQFENYSFEVGKLKYESTIYGMFDVVATEVGIRTKEAILNNQTITAQ
FT                   FNATELEYSSISKVSIDEELTNLIKYQTSYGAASKIITTIDQMMQTLLGIKQ"
FT   gene            569537..570331
FT                   /locus_tag="Suden_0567"
FT                   /old_locus_tag="Tmden_0567"
FT   CDS_pept        569537..570331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0567"
FT                   /old_locus_tag="Tmden_0567"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43846"
FT                   /db_xref="GOA:Q30T35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43846.1"
FT                   /translation="MPKFSIFILLSVFVFSFFGSVIYAIDAYTLDSQAILIPPSFEHIL
FT                   GTDRLGRDILARLIEGGKTSLIIGVGSAFIASLIGLLLGSMAGYFRGGFDKGFIILVDL
FT                   FLTFPTFFLLLALVSYVNASSWVLIVIISITGWMTTARLIRSESFKITSQPYIKILNIA
FT                   KVGRLKILFKYYAPLLAPIYFVSFTFGVGGAILAESGLSFLGLGIVAPQMSWGTILSSG
FT                   KDVVEIAWWVSFFPGLMIFLVTFSLINISNYLQQLTNKKEIK"
FT   gene            570415..570984
FT                   /locus_tag="Suden_0568"
FT                   /old_locus_tag="Tmden_0568"
FT   CDS_pept        570415..570984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0568"
FT                   /old_locus_tag="Tmden_0568"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43847"
FT                   /db_xref="GOA:Q30T34"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43847.1"
FT                   /translation="MILMIDNYDSFTYNIVQYCRELGADLKIIRNDEMSVKEIEALGPQ
FT                   KIIISPGPATPNDAGVTLEVIEHFKDKVPILGICLGHQSIAQVFGAKVVRAKNMMHGKT
FT                   SLMKRSGDCAIFKDIPQEFIATRYHSLIVDKNFIPDIIEPTAYSQDDNEIMALKIKDKD
FT                   IYGVQFHPESIMSEYGHEIIGNFLKL"
FT   gene            570981..572174
FT                   /locus_tag="Suden_0569"
FT                   /old_locus_tag="Tmden_0569"
FT   CDS_pept        570981..572174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0569"
FT                   /old_locus_tag="Tmden_0569"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43848"
FT                   /db_xref="GOA:Q30T33"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43848.1"
FT                   /translation="MSIRLALFIILTLDALLLIFQISELSISYNEALLLSGDFSFLQVL
FT                   IKTSFYFFGQNDFALRLPMIILHILSAILVYKISEKYLKINRNRVWLLLVFIFLPGVMS
FT                   AGIIVNEAGFILFALLLFVYLYKKISYPHMYILLILYMLLDGSFVYLFISLAMFAIYSK
FT                   NRAFFILNILLIIGSLYIYGIDMHGSPRGYFLESLGIYAAIFTPIIFIYLFYVLYRRYL
FT                   TKDIDMLWFIATVTLAISLTLSFRQRIEIEYFAPFVILALFLVAQTFEHSYRVRLNIFR
FT                   KNYKLMFLISLILLFVNSSVVFFNKYLYLIVEEPKKHFSYNMHVAKELSVELKKRDIYC
FT                   VNTSTKMAKRLEFYGVTKCNSYILQENYLGESTQDNVTISYKNVVVYSANVTKINTN"
FT   gene            572262..573596
FT                   /locus_tag="Suden_0570"
FT                   /old_locus_tag="Tmden_0570"
FT   CDS_pept        572262..573596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0570"
FT                   /old_locus_tag="Tmden_0570"
FT                   /product="ATP-dependent citrate lyase beta subunit"
FT                   /EC_number="2.3.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43849"
FT                   /db_xref="GOA:Q30T32"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032263"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43849.1"
FT                   /translation="MAQKAIREFDAKSILAKHWDKYFPNFTYAYETVMVQNGSELKKAA
FT                   KEKTWLKDKKLVAKPDMLFGKRGKNGLVLFRDSKPGDVSLTKASSWIDEKSGEKQSVYF
FT                   SFDGDTPSGEAKVDMLTHFIVEPFTPHSQEEEYYISATCVGDDDVLYMSAEGGMEVEEN
FT                   WDKVTEVAFPITATEEEIEKKIKASIPKDVAAKDKEAFADFAIGFFRAYRELNFAYLEI
FT                   NPFVLQGKKVELLDMVAKLDDTAGFMMREEWGDVDFPTSFGMEEKSPEVLAIEDADSKS
FT                   GASLKLTILKPEARVWTMVAGGGASVVYADTIADLAGIEDLANYGEYSGGPTTSETKFY
FT                   AETILDLMTRDKDLKGRDKVLIIGGAIANFTDVAKTFTGIIQAFELYADKMKQVGIKIY
FT                   VRRGGPNYEKGLKDIKEAADRLGLYIEVYGPETHVTDIVRMALAK"
FT   gene            573606..575420
FT                   /locus_tag="Suden_0571"
FT                   /old_locus_tag="Tmden_0571"
FT   CDS_pept        573606..575420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0571"
FT                   /old_locus_tag="Tmden_0571"
FT                   /product="ATP-dependent citrate lyase alpha subunit"
FT                   /EC_number="2.3.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43850"
FT                   /db_xref="GOA:Q30T31"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43850.1"
FT                   /translation="MAQLYTRDTQAIFWNNNASAIQRMLDYDYTIKRQKPSVAAIVAPT
FT                   SNSKFDKFFYGPDEIMIPLYRNTTEAKSAQPQADVLLNFASFRTAYDVTMEALELGGFT
FT                   SIMVTAEGIPERLARKMNATGREKNVTIIGPATVGAIAPGAFKIANIGGTIENIVQSKL
FT                   HRAGSCGLVTRSGGLFNELSNIIAINADGIAEGVAIGGDRFVGSVFIDNLLRMEANPEV
FT                   KYMLLLGEVGGTEEYKVIEAVKSGKIKKPIIAWCIGTIAKYYDSGVQFGHAGASANGDM
FT                   ETAEAKNRAMKEVGIHVPASFNDLPEIISALYHELHAEGTIKDIIEPSMNVCPSVRKSK
FT                   QFICTISDDRGDEAHYCGYPISSVATPDTGFTIGDVMSILWFKKRYPRWAVDFLETVLK
FT                   TVADHGPAVSGAHNAKVTARAGKDVISSLISGLLTIGPRFGGAIDDAAKYFKYASDNGM
FT                   SPNDFLNHMKKEGIPIPGIGHRIKSLKNPDLRVEGLKKFAKANFPSTPLLDYALTVEQL
FT                   TTSKKENLILNVDGTIGILMVDMWRSLGYKDEEIDVFINAGALNAFFILGRSIGFIGHI
FT                   LDEKRLAMPMYRHPMDDILYDVKLAENL"
FT   gene            575563..576213
FT                   /locus_tag="Suden_0572"
FT                   /old_locus_tag="Tmden_0572"
FT   CDS_pept        575563..576213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0572"
FT                   /old_locus_tag="Tmden_0572"
FT                   /product="N-terminal methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43851"
FT                   /db_xref="GOA:Q30T30"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43851.1"
FT                   /translation="MKKAFTMLELIFIIILIGILVTVVIPRTGSNKLQEAATQVVSHIR
FT                   YTQHLAMVDDKFDANDANWYKNRWQIFFASTEGSSGEWAYSIFSDSSGRSTGNPDETEL
FT                   AINPLDRSKYLTGGYSAGIIPFGHPKVTKELNLGKEYDVKNIVFSNSCSITKSTRIAFD
FT                   YLGRPLRGAFYNYNSAYPAKNRLITTQCTITLSNNSKSIVIAIEPETGYSHIL"
FT   gene            576631..578078
FT                   /locus_tag="Suden_R0022"
FT                   /old_locus_tag="Tmden_R0022"
FT   rRNA            576631..578078
FT                   /locus_tag="Suden_R0022"
FT                   /old_locus_tag="Tmden_R0022"
FT                   /product="16S ribosomal RNA"
FT   gene            578251..578326
FT                   /gene="tRNA-Ala2"
FT                   /locus_tag="Suden_R0023"
FT                   /old_locus_tag="Tmden_R0023"
FT   tRNA            578251..578326
FT                   /gene="tRNA-Ala2"
FT                   /locus_tag="Suden_R0023"
FT                   /old_locus_tag="Tmden_R0023"
FT                   /product="tRNA-Ala"
FT   gene            578625..581509
FT                   /locus_tag="Suden_R0024"
FT                   /old_locus_tag="Tmden_R0024"
FT   rRNA            578625..581509
FT                   /locus_tag="Suden_R0024"
FT                   /old_locus_tag="Tmden_R0024"
FT                   /product="23S ribosomal RNA"
FT   gene            581655..581770
FT                   /locus_tag="Suden_R0025"
FT                   /old_locus_tag="Tmden_R0025"
FT   rRNA            581655..581770
FT                   /locus_tag="Suden_R0025"
FT                   /old_locus_tag="Tmden_R0025"
FT                   /product="5S ribosomal RNA"
FT   gene            582220..582807
FT                   /locus_tag="Suden_0573"
FT                   /old_locus_tag="Tmden_0573"
FT   CDS_pept        582220..582807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0573"
FT                   /old_locus_tag="Tmden_0573"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43852"
FT                   /db_xref="GOA:Q30T29"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43852.1"
FT                   /translation="MKKYIKEQIKKSFEIKQTIYENENLINKIEEVSKLCVALYRGDKK
FT                   TILAGNGGSAADAQHIAAELVGRYGFDRPSIPSLALTTDTSCLTAIGNDYGYDNVFSRQ
FT                   LEGMGQAGDIFIGISTSGNSKNIINAFISAKKKGITTVALVGRDGGEMAKMADVALVVP
FT                   SDSTPRIQESHILIGHIICDIIEKEIFGDGVN"
FT   gene            582814..583320
FT                   /locus_tag="Suden_0574"
FT                   /old_locus_tag="Tmden_0574"
FT   CDS_pept        582814..583320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0574"
FT                   /old_locus_tag="Tmden_0574"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43853"
FT                   /db_xref="GOA:Q30T28"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43853.1"
FT                   /translation="MNRALFLDRDGVINVEINYLIKIEDFVFIDGIFELCKKYQDRGYL
FT                   IFVVTNQSGIARGFYTQEDFDVLTSWMMKEFLNRGVIIKKVYFCPHHPEISGECSCRKP
FT                   KAGMLLEAKKEFDIDLQNSILVGDKERDIEAALASGIKESYFFDEKGICKESKATKIIS
FT                   NLREV"
FT   gene            583323..583808
FT                   /locus_tag="Suden_0575"
FT                   /old_locus_tag="Tmden_0575"
FT   CDS_pept        583323..583808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0575"
FT                   /old_locus_tag="Tmden_0575"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43854"
FT                   /db_xref="GOA:Q30T27"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43854.1"
FT                   /translation="MLILNSGGTFNKKYNSLNGELEIPYNNSVIEEILKSVEFKYDLAG
FT                   VVYKDSLDMNMDDRKRIAHIIMESSDDTFIIVHGTDTMLLSAEFLSEVFDDRKIVFVGS
FT                   MRPFEIDNIEASLNLGMAIGFAKALKENGVYICMSGHVEPWQKIYKNKKFGKFEVVL"
FT   gene            583783..586236
FT                   /locus_tag="Suden_0576"
FT                   /old_locus_tag="Tmden_0576"
FT   CDS_pept        583783..586236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0576"
FT                   /old_locus_tag="Tmden_0576"
FT                   /product="Copper-translocating P-type ATPase:Heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43855"
FT                   /db_xref="GOA:Q30T26"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43855.1"
FT                   /translation="MENLKLSSKVACSHCNIKFEESVMIKEVQSSSKESSASQTLIRYF
FT                   CCSGCQGVFYLLQDKGLESFYEKSKDIELSLQNQNLKDSSSFDSQSFYDKFVKKNSDGF
FT                   CEVSLVIEGIHCSACVWLNEKVLHNMDGVIEVNINFTNNKAIIVWADDIVKLSNIIDTI
FT                   RSIGYNAFAYDSSAQELHANKERKSYYLKMAVAIFASMNTMWIAVAQYAGYFSGITQDV
FT                   KTILNIAEGVLATPVLFYSGWVFFRGAYYGYKNRVVNMDMLVATGATLTYMYSLYITII
FT                   QRGEAYFDSVSMIITFVLIGKFLEVLSKKNAADTLDKIASSIPSEVKILKENRIVNVKL
FT                   DDVGIGDIVIVSSGERVLLDGEIIKGGGSFDESNLTGESEPIYKSVGMSVISGTLSIDA
FT                   DINFRASKDFKHSTLSNIVKLLESAINKKPKIQQMANRLSEHFSSVILALSVLTLFGWW
FT                   FWTNNFETSLMIAISVIIIACPCALALATPVATLVGLGLGASRGVLFKEAAGLEIMAKT
FT                   DTLVLDKTGTITVGKPEVVKEHILEEFDKKLLYSLVSSSKHPVAKGIANYLKNSEYICD
FT                   IVFDEFAQLPALGIKAKLGKIELLGGNKKLLDENKIEIDFFTQGTLFYFAIDKQVVAIY
FT                   ELEDRVKDGVKEFVNRMHKMNIDVVMLTGDNENIAKRVAQKVGIKTIFYEQTPQSKAEY
FT                   ISTLSKNKKNVVMVGDGINDILALASADIGIVMGSGSDIAVEVGDVVLLNSSIKSLEEA
FT                   LKISRTTFGLIKQNLALSLIYNALTIPLAMAGYVIPLVAAISMSVSSLLVVGNSLRIKY
FT                   KWNRG"
FT   gene            586239..586454
FT                   /locus_tag="Suden_0577"
FT                   /old_locus_tag="Tmden_0577"
FT   CDS_pept        586239..586454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0577"
FT                   /old_locus_tag="Tmden_0577"
FT                   /product="Cytochrome oxidase maturation protein cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43856"
FT                   /db_xref="GOA:Q30T25"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43856.1"
FT                   /translation="MDSWVIAMMLGASLFLGAIALFAFLWAIKNGQFDDEEKFLNAAKF
FT                   DGEDELNDAIKREQKKENLKKSYKPE"
FT   gene            complement(586490..586774)
FT                   /locus_tag="Suden_0578"
FT                   /old_locus_tag="Tmden_0578"
FT   CDS_pept        complement(586490..586774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0578"
FT                   /old_locus_tag="Tmden_0578"
FT                   /product="cytochrome c-553"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43857"
FT                   /db_xref="GOA:Q30T24"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43857.1"
FT                   /translation="MKKIVLSIVALTATTALMAGVAAGACQGCHGADWTKPALGKSKNV
FT                   AEMTHADIATSLKGYKDGSYGGAMKGLMKGQVAKYSDAELEEFAQTIGK"
FT   gene            586888..587898
FT                   /locus_tag="Suden_0579"
FT                   /old_locus_tag="Tmden_0579"
FT   CDS_pept        586888..587898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0579"
FT                   /old_locus_tag="Tmden_0579"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase precursor"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43858"
FT                   /db_xref="GOA:Q30T23"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43858.1"
FT                   /translation="MRYIDDDLKDKTILITGGAGFIGSNLAFYFQENHPDAKVVILDSF
FT                   RSKETLSNGNLKSFGHFKNLIGFLGKVISGDINDKELLNSLEKEYKFDYIFHEAAISDT
FT                   TAQEQDLMIKTNVNAYEDLLLLAQKHGANMIYASSAATYGNAESPQRVGYEAPQNVYGF
FT                   SKLCMDNLSREFMKKSTISIVGLRYFNVYGAREYFKNSTASMVLQFAHQMLSGKNPTLF
FT                   ESSDKILRDFIYIEDVIFANIKAMQPKRSGIFNVGTGKARSFQDIVDILQSELGTNLTC
FT                   EYIPNPFIGSYQFHTEADISSTKEVLGYESRFELEDGIRAYANEIRRIYNQEVEK"
FT   gene            587895..589328
FT                   /locus_tag="Suden_0580"
FT                   /old_locus_tag="Tmden_0580"
FT   CDS_pept        587895..589328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0580"
FT                   /old_locus_tag="Tmden_0580"
FT                   /product="D-beta-D-heptose 1-phosphate adenylyltransferase
FT                   / D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.7.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43859"
FT                   /db_xref="GOA:Q30T22"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30T22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43859.1"
FT                   /translation="MKILKSFTPRILVIGDLMIDHYLWGNCERISPEAPVQIVDISKET
FT                   TVLGGGGNVVNNLVALGAKVSVSGVIGNDENGVELLKLLREIDVNVDNIVIQEGRKTSK
FT                   KSRVIAASQQILRYDKESKEEISKSSIEVILNSLAKDISRYDAVVLSDYSKGVLTKELC
FT                   QGVISTCSKNGIKVLVDPKGSDYSKYSGAYLLTPNKKEAIQATKIDIKDKQSLKEALLK
FT                   MKKDANLAISLITLSEDGVAIYDDEMKIFPTVAKEVFDVTGAGDTVIASIAFAISAGKS
FT                   IEESAKFANLAAGVVVGKIGSATVSISEIEEYEASLHKSTSDAHIKGFEEIEAIVKRYK
FT                   ESGKKVVFTNGCFDILHVGHVKYLQIAKSFGDVLIVGLNSDTSVTRLKGPSRPVNIAED
FT                   RAYLLAALEAVDFVVPFEDDTPYELIKMIKPDTLVKGGDYEGKSVIGTEFAQELKLVDF
FT                   VDGKSTTKTIQKIKGDLHV"
FT   gene            589321..589893
FT                   /locus_tag="Suden_0581"
FT                   /old_locus_tag="Tmden_0581"
FT   CDS_pept        589321..589893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0581"
FT                   /old_locus_tag="Tmden_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43860"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43860.1"
FT                   /translation="MFKKISLSMLCAASAFAMHSAEINVNNADLELAAKLDVGQFNYNV
FT                   EPNTIFVGAKYLKADEKHSDVNKIYDYQEINFLMQRDVSHEFRVGLGLKLNHTKEFVST
FT                   PLGIGALYKLPITSSVPFYLGGSVYVAPEVLSYDKADNFLEYRATLEAEAIKNGFLRVG
FT                   YRHIDTNYKNFDVEFNDSICFGFKFLF"
FT   gene            complement(589904..590881)
FT                   /locus_tag="Suden_0582"
FT                   /old_locus_tag="Tmden_0582"
FT   CDS_pept        complement(589904..590881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0582"
FT                   /old_locus_tag="Tmden_0582"
FT                   /product="Lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43861"
FT                   /db_xref="GOA:Q30T20"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43861.1"
FT                   /translation="MRILVVLPNWLGDTVMATSAIELLASHYRDVKFTFVGAFASVEVM
FT                   KYHPLCEKIVIDETKKAPSRVLATYKLGRELGKFDLAITFRKQLHSSLLLKFTGTVLTI
FT                   AREAWHSKFLLSHTPNIPKYTKHLAQQYAQLAMINVDNWNGITPPSKLYIDALKFDKPT
FT                   LGINGGAAFGSAKQWYPERFAQVAANYSSVYDIIILGAPNEMEIANKIEKELVSLGIKN
FT                   YTNLAGKTSIKELCANIGACSLMLTNDSGPMHIAAAYQIPTVAIIGPTEYKQTYPWMNE
FT                   KGKIVRHDLECSPCVKRECPLKHHDCMKGITSVEVIQAVKELNL"
FT   gene            complement(590878..592143)
FT                   /locus_tag="Suden_0583"
FT                   /old_locus_tag="Tmden_0583"
FT   CDS_pept        complement(590878..592143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0583"
FT                   /old_locus_tag="Tmden_0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43862"
FT                   /db_xref="GOA:Q30T19"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43862.1"
FT                   /translation="MKQPFNWDNYSDQPYPLKDKSYKKKMRKNQLASLIKTFLISFVML
FT                   PFAIIMTPFVKRKKIASSDFFSLGLDFEREPQETLKLLQELEIERVLLRIKLWEMDKLP
FT                   LLKEFILQCKDKKITLKILQDREHVEDLQLLQKDLETIFNSLSSHVDMFEIGSTINRAK
FT                   WGFFSVDEYANFYQVAYNLKKSKFKDIKLIGSGVIDFEYHFTSHTLFNSLGCHFDATSA
FT                   LLYVDRRGAPENMQMGFTLQDKISLLSTMVWLSPKSAHELHITETNWPISNTAPYAPTS
FT                   EHECVSEELYADFMLRYHLLTLASQQVDTLSWHQLIASGYGLVDARDGLRKREAFEVYK
FT                   YMLKSLKDAQFLRLDIKRGYYILQFLINNQLLQIHWSLKKTTLKREDFFEKVCSYDGKE
FT                   IENETLHIGSSPLYIYIKDSLS"
FT   gene            592181..592999
FT                   /locus_tag="Suden_0584"
FT                   /old_locus_tag="Tmden_0584"
FT   CDS_pept        592181..592999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0584"
FT                   /old_locus_tag="Tmden_0584"
FT                   /product="ATP dependent DNA ligase, central"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43863"
FT                   /db_xref="GOA:Q30T18"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43863.1"
FT                   /translation="MKNLFKLIIFTLLFVTSSSALTLQKGTLYTNQDIKGYLMSEKLDG
FT                   IRAYWDGKNLLTRQNKVINAPEFFTQNLPPFELDGELWTSRGDFENIQSIVMDKTPSKK
FT                   WSEIKYMIFEVPHAKGDFLKRLEKAREHIEKKRALHVEIIEQKICNSKRDLDLFLKEIL
FT                   SRGGEGVMLKDASREYFEGRSEHLLKVKKADDMEAEVIGIKEGKGKFKGLMGSLHVRVE
FT                   SGVEFFIGSGFSDEDRKNPPKIGEIVTFKYYGFTKEGKPKFASFMRVRED"
FT   gene            592999..593967
FT                   /locus_tag="Suden_0585"
FT                   /old_locus_tag="Tmden_0585"
FT   CDS_pept        592999..593967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0585"
FT                   /old_locus_tag="Tmden_0585"
FT                   /product="heptosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43864"
FT                   /db_xref="GOA:Q30T17"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43864.1"
FT                   /translation="MNILVVRTDKLGDFITALPAVYVLKQQNLKNRVIVCVAPLNRALA
FT                   ESCEFIDEVIVDDGKSFWELVFKLRKAKIDASVTLFSNTRVALAQLIAAIPKRIAPATK
FT                   IAQIFYNKRVVQRRSRVEMAEFEYNLELTKSLFSDISLEYKKPLLTFDDSKTIYKTFCI
FT                   NNDIEKEILAFHVGFGGSSDANLSLDEYEILIREVITRDKYQVVLTFGPDEKELYEEMQ
FT                   DRLFDVNAVFYFSLEGLVYFAKLVSNFKLFISTSTGTYHVASLVGTPTMTFFADNLFSS
FT                   PARWKSVGDESLQTHFVIPHDKEKREKLFEEIKKELTIDKN"
FT   gene            complement(593968..594717)
FT                   /locus_tag="Suden_0586"
FT                   /old_locus_tag="Tmden_0586"
FT   CDS_pept        complement(593968..594717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0586"
FT                   /old_locus_tag="Tmden_0586"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43865"
FT                   /db_xref="GOA:Q30T16"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43865.1"
FT                   /translation="MLIENISCVIIVKNAASTLGSTLDSLADFRDVVLYDNGSTDETIE
FT                   IAKKYKNVTLVIGEFLGFGPTKNLACSYAKNEWVFSLDADEVLSDEFIKNISNLELNDR
FT                   NIYTILRENYYKSTQVKHCWGNDIIVRLFNRSKTSFSEEKVHEKVIEEGFKTILISGAV
FT                   KHYPYNTITDFILKLDRYSTIFAQDNVGKKKSSPSKAFFNAAFSFFKTYFLKKGFLDGY
FT                   AGLVIAFSHMATNFYKYIKLYELNKKL"
FT   gene            complement(594707..595441)
FT                   /locus_tag="Suden_0587"
FT                   /old_locus_tag="Tmden_0587"
FT   CDS_pept        complement(594707..595441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0587"
FT                   /old_locus_tag="Tmden_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43866"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43866.1"
FT                   /translation="MKFEVIQNEYSALLKEIQSYFKNSQNSIHKARNEIKIIDFKQKSL
FT                   VIKSFKVPHLINRVVYTFFRDSKAKKSYENSVKIAQFVPKPIGFVELKKSGLLHESYFV
FT                   SENFEYDFTIREPLLESVFLDREKIFKAFAEFTFKLHVEGIFHLDYSPGNILIKKESDG
FT                   YIFKIVDINRMEFKPLNLDKRLKNFSKLWAKDEDLKIIIKEYARLYKSDEERSIKIALQ
FT                   YSQAHKNRKNRKKRLRGEAVVD"
FT   gene            complement(595431..596534)
FT                   /locus_tag="Suden_0588"
FT                   /old_locus_tag="Tmden_0588"
FT   CDS_pept        complement(595431..596534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0588"
FT                   /old_locus_tag="Tmden_0588"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43867"
FT                   /db_xref="GOA:Q30T14"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43867.1"
FT                   /translation="MNLLVLTATNGSYNSIRPEAEIYISLLKFGYNITIMTEKDSQYAK
FT                   RFEENGIRVIDTHYKKKISPSTIKKIKGAIKEYDIDILYATNSKSISNATIASIGTDVK
FT                   LITYRGTTGGLYRHDPSSYLNALNPRVDGVICVSKAVARHVKEQIFDKSKRVEAIYKGH
FT                   ELSWYETSKISLEEFGTNQENFNVAFVANVRPHKGLIYLLKAAHKLASYKNIHIILIGQ
FT                   NISQEPYMSEIKNCGMQERIHVTGYRNDAPQIIASCSVLVQASTRKEGLSRVILESLAA
FT                   NTPVIASAIEGNSEIIEDEFNGYIVPIKDADAIAQKIIELSTSPQKLQELSANCADTIE
FT                   NKMSHKTTVIEFDKFFKSILKKIQNEI"
FT   gene            complement(596531..597511)
FT                   /locus_tag="Suden_0589"
FT                   /old_locus_tag="Tmden_0589"
FT   CDS_pept        complement(596531..597511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0589"
FT                   /old_locus_tag="Tmden_0589"
FT                   /product="Lipopolysaccharide heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43868"
FT                   /db_xref="GOA:Q30T13"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43868.1"
FT                   /translation="MKICIVKLSAMGDVIHAMVALQFIKKELPNAQIDWVVERSFADVL
FT                   KNNPHIDNILEVDLKSIKKQKSKIFTQLKILKKYSKNSYDIVIDAQGLLKSAIVSKIIG
FT                   AKVIAGFDKDSIREGVASFFYDKKVSIAYSANTIDRNATVICEPLGIEVTNEKIINKEK
FT                   FLFSSSHVKNLPEIFNLFVIGSTWESRNYPKEKFVKIAEALHVKTFIVWGSEEEHKKAL
FT                   WMQDKSEFLHLLPRGSLDELKYVISKCSLLIGNDTGPTHMAWGLNVPSITLFGPTPLNR
FT                   IYVTPINRAIKSSSIVNHYKLDKNDFSICDINSDEIIKIAKELLS"
FT   gene            complement(597511..598254)
FT                   /locus_tag="Suden_0590"
FT                   /old_locus_tag="Tmden_0590"
FT   CDS_pept        complement(597511..598254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0590"
FT                   /old_locus_tag="Tmden_0590"
FT                   /product="transferase hexapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43869"
FT                   /db_xref="GOA:Q30T12"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43869.1"
FT                   /translation="MPIHKFQFNYVIIAHFIGIKSMINSRKISNLFKYLFAIPKSIYVN
FT                   LRVLPLNQAIKLPIIVSNKTKLISLGGKINLGKVKTGIIRIGFGGTEHIDYAYTRTLLK
FT                   IDGVVTFKGRAKIGLGSKFIIDKEATFSAGERFGITGETTILCAKKITIGDNARISWQC
FT                   IIMDSDHHPVFDKNYSIINTPTEVNIGNNVWIGARCFILKNTLIDDGCIIAANTTITKK
FT                   FSGVKHSVIGGDSARVLKTDIRWCN"
FT   gene            598344..600044
FT                   /locus_tag="Suden_0591"
FT                   /old_locus_tag="Tmden_0591"
FT   CDS_pept        598344..600044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0591"
FT                   /old_locus_tag="Tmden_0591"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43870"
FT                   /db_xref="GOA:Q30T11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43870.1"
FT                   /translation="MFKRYLPYIKEYKKEYFLVVIGMLFTVAATTATAHIMKPLMDEMF
FT                   IEKKEEMLYLIPLGLIGIYFFKSIGRYIQSVYMTYIGQHIVSRFREMMLEKIINFDMMY
FT                   LYQNRSGELISRVTNDIDRIRYFVSNMLPELIRESLTVIALVAYVIYLNPMLSFYSLVL
FT                   LPLAVYPIIQIGKKLKKYSRRSQEKNADVISRLTEVFNNSEIIKANATQKFELERFGVQ
FT                   NWQFFKINMKSVYVGDIVSPLMELVGAAGLAAVIYIGGREVYSGNMSVGEFSAFLTAVG
FT                   LVFQPIRRIGSIYSKIQDALSASERVFELLDKENKIVDGKKVLKEDITHIEFRDVSLKY
FT                   EERYILDGVNIEIKQGQNIALVGDSGGGKSTFINMLLRFYDPQDGSVLVNGINIKEFTQ
FT                   DSLKHHISLVTQRIYIFQDTLAANVAYGQDIDEKRVKDALILADALSFVESLEDGIETK
FT                   MEEFGSNLSGGQRQRIAIARAIYKHASLILFDEATSALDNESEKRIQEALHNYTKDKIT
FT                   ITIAHRLGTIQNADKILVVQKGKIIASGSHSELLESCEVYQRLAGGLKK"
FT   gene            600064..601269
FT                   /locus_tag="Suden_0592"
FT                   /old_locus_tag="Tmden_0592"
FT   CDS_pept        600064..601269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0592"
FT                   /old_locus_tag="Tmden_0592"
FT                   /product="Polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43871"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43871.1"
FT                   /translation="MKKILNLIGRTKELFIDDINTHNKELKNIVSSSTFLVLGGAGSIG
FT                   QAVTKEIFKRHPKKLHVVDISENNMVELVRDIRSSFGYIDGDFQTFALDIGSSEYDAFI
FT                   KSDGKYDYVLNLSALKHVRSEKDPFTLMRMIETNVFNTDKTLLQSIENGVKKYFCVSTD
FT                   KAANPVNMMGASKRIMEMFVMRKSQQIDVSMARFANVAFSDGSLLHGFDQRIKKLQPIV
FT                   APNDIKRYFVTTQESGELCLMSCIFAQNRDIFFPKLSENLHLITFAEIAVKYLKDLGYE
FT                   PYLCKDEDEARNFFTENFKSNTEHSKQWPCLFTASDTTGEKDFEEFFTDAETLDMNRFE
FT                   NLGVIKNEANYDEEKLNHFENTIKKYKQNLTWTKEDIVKEFFKMIPDFGHKESGKYLDA
FT                   KM"
FT   gene            601256..602407
FT                   /locus_tag="Suden_0593"
FT                   /old_locus_tag="Tmden_0593"
FT   CDS_pept        601256..602407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0593"
FT                   /old_locus_tag="Tmden_0593"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43872"
FT                   /db_xref="GOA:Q30T09"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43872.1"
FT                   /translation="MQRCNMKNIVDFIQNTFKTKEFVPLHEPRFIGNEKKYLNDCIDST
FT                   FVSSVGKYVDTFEKEFALRVGSKYAIATVNGTAALHVSLLLVDVKKDDEVITQPLTFIA
FT                   TCNAISYLGAKPVFVDVDIDTMGLSPDSLKRFLEKNCEIKNSTCINKISGKVIKACVPM
FT                   HTFGHPCRIDEIKEICDKWNISLVEDAAESLGSYYKNRHTGTFGKVGAFSFNGNKIITS
FT                   GGGGVIVTDDEAIAKRAKHITTTAKIPHPYEYVHDEVGYNYRLPNINAALLVAQLEQLD
FT                   GFLASKRELALRYKEFFSKSEIVFAEEPKESKSNYWLQAILLSDKNQRDEFLEFTNKNG
FT                   VMTRPIWRLMNELEMFKDCQRDNLKNAKYLEQRVVNIPSSVIL"
FT   gene            602407..602982
FT                   /locus_tag="Suden_0594"
FT                   /old_locus_tag="Tmden_0594"
FT   CDS_pept        602407..602982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0594"
FT                   /old_locus_tag="Tmden_0594"
FT                   /product="acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43873"
FT                   /db_xref="GOA:Q30T08"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43873.1"
FT                   /translation="MKEKIILIGGGGHCHSVIDVIELEDKYEIVGIIDIKENIGKKVLG
FT                   YEIIGCDDDLSTIFQTCKNAVITVGQVKSNSIRVELFEKLKRVGFKLPTIISPLAYVSK
FT                   HACVDEGTVVMHHALINANAKIGKNCIINTKALIEHDAIVEDYCHISTASVVNGGVIVK
FT                   ADTFFGSNATSKQSVKVEGFIKAGSVAK"
FT   gene            602979..603980
FT                   /locus_tag="Suden_0595"
FT                   /old_locus_tag="Tmden_0595"
FT   CDS_pept        602979..603980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0595"
FT                   /old_locus_tag="Tmden_0595"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43874"
FT                   /db_xref="GOA:Q30T07"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43874.1"
FT                   /translation="MSKVFIIAEAGVNHNGDIKLAKKLIDVACIAGVDAVKFQTFKAIN
FT                   LVSKNAQKAEYQKKNMSDGDDSQFNMLKKLELDIDTHKELIAYCNSNKIMFLSTPFDHD
FT                   SIELLNDLGLQIFKIPSGEITNLPYLRHIGKLNKKIILSTGMADMGEIEDALDVLVNAG
FT                   TKKENITVLHANTMYPTPMEDVNLRAMITIGEAFDVAFGYSDHTLGIEVPIAAVAMGAT
FT                   CIEKHFTLDCTMDGPDHKASLEPDELKAMVKAIRNIELAMGSGIKKPSKSEMPNIQIAR
FT                   KSIVAKSGIKKGEILSEENLAIKRPANGINPMRWDEIVGTIASKDYEEDELI"
FT   gene            603977..604858
FT                   /locus_tag="Suden_0596"
FT                   /old_locus_tag="Tmden_0596"
FT   CDS_pept        603977..604858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0596"
FT                   /old_locus_tag="Tmden_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43875"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43875.1"
FT                   /translation="MNEIITTDNQMIQDKIYTLRDEQVMLDKDLAELYGVETKRINEAV
FT                   KNNQDKFQEDFFFELTNDEFSILRSKLSTAKFAKTRTNPKVFTEQGVYMLATILKSKVA
FT                   SQTTVLIIKTFANMRKFLLSNASIFQRLDSLEVKQIQSKLESDEKFNKIFNAIEEKGIP
FT                   QKQHIFYNGQIFDAYLFVSDIIKNAKTSIKLIDNYVDETTLILFTKRDANVSMTIYTKT
FT                   ISAQLNLDLQKYNAQYPNIEIKKFDLSHDRFLIIDEKEIYHFGASLKDLGKKWFAVSKM
FT                   DIDSFEFMEKLK"
FT   gene            604855..606018
FT                   /locus_tag="Suden_0597"
FT                   /old_locus_tag="Tmden_0597"
FT   CDS_pept        604855..606018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Suden_0597"
FT                   /old_locus_tag="Tmden_0597"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Suden_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABB43876"
FT                   /db_xref="GOA:Q30T05"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q30T05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABB43876.1"
FT                   /translation="MSKRKICVVTGTRAEYGLLYWLMKEIQNDSELELQLIVTGMHLSP
FT                   EFGLTYKEIEKDFKIDKKIEMLLSSDTAVGISKSMGLAQISFAEAYEELKPDILVVLGD
FT                   RYEIFSAVSAAMIARVPIAHLHGGESTEGAFDESIRHSITKMSHLHFTATEEYKKRVIQ
FT                   LGEQPKRVFNVGGMGIENIKRLKLLTKKEFEESINFKLNKKNILVTFHPVTLENSTAKE
FT                   QFQELLDAIDELRDTNIIFTKANSDTDGRVINQMCD